Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0C065705.698ON59059031680.0
Suva_11.3295.698ON60156722220.0
Smik_11.3565.698ON60256221750.0
YKR093W (PTR2)5.698ON60156021730.0
KAFR0H00230singletonON59655621460.0
TBLA0A091205.698ON63355421440.0
ZYRO0G06688g5.698ON61356721290.0
NCAS0A032205.698ON61154921280.0
Kpol_529.285.698ON61056921240.0
KAFR0H002405.698ON59158721220.0
TDEL0B022305.698ON57456821190.0
CAGL0G02453g5.698ON59756421180.0
TPHA0N01960singletonON59157120890.0
TPHA0O02000singletonON62056520740.0
NDAI0E050205.698ON61956120590.0
SAKL0E14828g5.698ON59258120380.0
TBLA0E01140singletonON61158819890.0
TBLA0B04710singletonON61555919530.0
KLLA0E12915g5.698ON65458219330.0
Skud_11.3315.698ON39936615630.0
Kwal_47.16930na 1ON6116166304e-73
KLTH0D16544gna 1ON6265646141e-70
Ecym_2823na 2ON6136035701e-64
AGL365Cna 2ON5995385587e-63
AFR228WsingletonON5765645015e-55
ADL156Cna 3ON483195830.17
KNAG0D00130na 4ON56552780.77
SAKL0G07964g5.386ON122184761.3
KAFR0C04860na 4ON53470732.9
NDAI0C024605.211ON905126715.0
CAGL0B01859g8.270ON62246715.5
SAKL0A05676gna 5ON61380706.8
KAFR0H031701.395ON24156689.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0C06570
         (590 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0C06570 Chr3 (1273605..1275377) [1773 bp, 590 aa] {ON} Anc_5...  1224   0.0  
Suva_11.329 Chr11 (600372..602177) [1806 bp, 601 aa] {ON} YKR093...   860   0.0  
Smik_11.356 Chr11 (605836..607644) [1809 bp, 602 aa] {ON} YKR093...   842   0.0  
YKR093W Chr11 (615730..617535) [1806 bp, 601 aa] {ON}  PTR2Integ...   841   0.0  
KAFR0H00230 Chr8 complement(33231..35021) [1791 bp, 596 aa] {ON}      831   0.0  
TBLA0A09120 Chr1 complement(2259486..2261387) [1902 bp, 633 aa] ...   830   0.0  
ZYRO0G06688g Chr7 complement(535282..537123) [1842 bp, 613 aa] {...   824   0.0  
NCAS0A03220 Chr1 complement(635016..636851) [1836 bp, 611 aa] {O...   824   0.0  
Kpol_529.28 s529 complement(82303..84135) [1833 bp, 610 aa] {ON}...   822   0.0  
KAFR0H00240 Chr8 complement(36393..38168) [1776 bp, 591 aa] {ON}...   822   0.0  
TDEL0B02230 Chr2 complement(402022..403746) [1725 bp, 574 aa] {O...   820   0.0  
CAGL0G02453g Chr7 (218003..219796) [1794 bp, 597 aa] {ON} highly...   820   0.0  
TPHA0N01960 Chr14 complement(418505..420280) [1776 bp, 591 aa] {...   809   0.0  
TPHA0O02000 Chr15 complement(404570..406432) [1863 bp, 620 aa] {...   803   0.0  
NDAI0E05020 Chr5 (1146336..1148195) [1860 bp, 619 aa] {ON} Anc_5...   797   0.0  
SAKL0E14828g Chr5 (1226652..1228430) [1779 bp, 592 aa] {ON} simi...   789   0.0  
TBLA0E01140 Chr5 complement(250628..252463) [1836 bp, 611 aa] {O...   770   0.0  
TBLA0B04710 Chr2 (1104183..1106030) [1848 bp, 615 aa] {ON}            756   0.0  
KLLA0E12915g Chr5 complement(1142167..1144131) [1965 bp, 654 aa]...   749   0.0  
Skud_11.331 Chr11 (597847..599046) [1200 bp, 399 aa] {ON} YKR093...   606   0.0  
Kwal_47.16930 s47 (176926..178761) [1836 bp, 611 aa] {ON} YKR093...   247   4e-73
KLTH0D16544g Chr4 complement(1366262..1368142) [1881 bp, 626 aa]...   241   1e-70
Ecym_2823 Chr2 (1599716..1601557) [1842 bp, 613 aa] {ON} similar...   224   1e-64
AGL365C Chr7 complement(13929..15728) [1800 bp, 599 aa] {ON} NOH...   219   7e-63
AFR228W Chr6 (850893..852623) [1731 bp, 576 aa] {ON} Non-synteni...   197   5e-55
ADL156C Chr4 complement(416054..417505) [1452 bp, 483 aa] {ON} S...    37   0.17 
KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}  ...    35   0.77 
SAKL0G07964g Chr7 complement(668256..671921) [3666 bp, 1221 aa] ...    34   1.3  
KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W      33   2.9  
NDAI0C02460 Chr3 (563500..566217) [2718 bp, 905 aa] {ON} Anc_5.2...    32   5.0  
CAGL0B01859g Chr2 (168976..170844) [1869 bp, 622 aa] {ON} weakly...    32   5.5  
SAKL0A05676g Chr1 (515333..517174) [1842 bp, 613 aa] {ON} simila...    32   6.8  
KAFR0H03170 Chr8 complement(604252..604977) [726 bp, 241 aa] {ON...    31   9.0  

>KNAG0C06570 Chr3 (1273605..1275377) [1773 bp, 590 aa] {ON}
           Anc_5.698 YKR093W
          Length = 590

 Score = 1224 bits (3168), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 590/590 (100%), Positives = 590/590 (100%)

Query: 1   MTLRQVNTFSEDDSLDKKNDLVLTKENSHTIEEDSRIVDDLASQYEDDIPEGYEVPTEEE 60
           MTLRQVNTFSEDDSLDKKNDLVLTKENSHTIEEDSRIVDDLASQYEDDIPEGYEVPTEEE
Sbjct: 1   MTLRQVNTFSEDDSLDKKNDLVLTKENSHTIEEDSRIVDDLASQYEDDIPEGYEVPTEEE 60

Query: 61  LRTLKHVGGHIPMRCWLIAVVELSERFSYYGLSAPFQNYMANGPHDKPPGLLQLNSDGAT 120
           LRTLKHVGGHIPMRCWLIAVVELSERFSYYGLSAPFQNYMANGPHDKPPGLLQLNSDGAT
Sbjct: 61  LRTLKHVGGHIPMRCWLIAVVELSERFSYYGLSAPFQNYMANGPHDKPPGLLQLNSDGAT 120

Query: 121 GLSYFFQFWCYVTPIFGGYMADTHWGKYNTIAVGTGIYICGIFILFMTSIPSITTKNAGL 180
           GLSYFFQFWCYVTPIFGGYMADTHWGKYNTIAVGTGIYICGIFILFMTSIPSITTKNAGL
Sbjct: 121 GLSYFFQFWCYVTPIFGGYMADTHWGKYNTIAVGTGIYICGIFILFMTSIPSITTKNAGL 180

Query: 181 GGFIVAIILIGIATGMIKSNLSVLIADQLPKRKPLVKTKKNGERVIEDTNLTLQNVFMFF 240
           GGFIVAIILIGIATGMIKSNLSVLIADQLPKRKPLVKTKKNGERVIEDTNLTLQNVFMFF
Sbjct: 181 GGFIVAIILIGIATGMIKSNLSVLIADQLPKRKPLVKTKKNGERVIEDTNLTLQNVFMFF 240

Query: 241 YLMINIGSLSVIATSELELHRGFWAAYLLPFCFFWIAVVVLVLGKNQYVKPPIGDKVISK 300
           YLMINIGSLSVIATSELELHRGFWAAYLLPFCFFWIAVVVLVLGKNQYVKPPIGDKVISK
Sbjct: 241 YLMINIGSLSVIATSELELHRGFWAAYLLPFCFFWIAVVVLVLGKNQYVKPPIGDKVISK 300

Query: 301 CFKVLWILTKNRFNFDAPKPSLNPTKNYPWSDKFVDEIQRALGACKVFLFYPIYWTCYGQ 360
           CFKVLWILTKNRFNFDAPKPSLNPTKNYPWSDKFVDEIQRALGACKVFLFYPIYWTCYGQ
Sbjct: 301 CFKVLWILTKNRFNFDAPKPSLNPTKNYPWSDKFVDEIQRALGACKVFLFYPIYWTCYGQ 360

Query: 361 MMSGFVTQGSMMELHGLPNDFFQCIDSIAIIVFIPVCEHLLYPFIRKYTPFRPITKIYFG 420
           MMSGFVTQGSMMELHGLPNDFFQCIDSIAIIVFIPVCEHLLYPFIRKYTPFRPITKIYFG
Sbjct: 361 MMSGFVTQGSMMELHGLPNDFFQCIDSIAIIVFIPVCEHLLYPFIRKYTPFRPITKIYFG 420

Query: 421 FMFASGCMIWAAVLQSYIYKAGPHYKWPLEHDGPNRIHVALQVPAYVLLAFSEIFASITG 480
           FMFASGCMIWAAVLQSYIYKAGPHYKWPLEHDGPNRIHVALQVPAYVLLAFSEIFASITG
Sbjct: 421 FMFASGCMIWAAVLQSYIYKAGPHYKWPLEHDGPNRIHVALQVPAYVLLAFSEIFASITG 480

Query: 481 LEYAYSKAPASMKSFIMSIFLVTNAFGSAIGCALSPVSKDPDWTWLYTGLAVACFISGCL 540
           LEYAYSKAPASMKSFIMSIFLVTNAFGSAIGCALSPVSKDPDWTWLYTGLAVACFISGCL
Sbjct: 481 LEYAYSKAPASMKSFIMSIFLVTNAFGSAIGCALSPVSKDPDWTWLYTGLAVACFISGCL 540

Query: 541 FWVCFRKYNDIEEEMNAMDYEVDATMLKKVPIETDTVALEKGSSESVVSL 590
           FWVCFRKYNDIEEEMNAMDYEVDATMLKKVPIETDTVALEKGSSESVVSL
Sbjct: 541 FWVCFRKYNDIEEEMNAMDYEVDATMLKKVPIETDTVALEKGSSESVVSL 590

>Suva_11.329 Chr11 (600372..602177) [1806 bp, 601 aa] {ON} YKR093W
           (REAL)
          Length = 601

 Score =  860 bits (2222), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/567 (71%), Positives = 479/567 (84%), Gaps = 8/567 (1%)

Query: 3   LRQVNTFSEDDSLDKKNDL-VLTKENSHTIE-EDSRIVDDLASQYE----DDIPEG--YE 54
           L  ++  S+D   +K+ +  V+ +E + T+  +DS + DD A+  E       PE   +E
Sbjct: 2   LNHLSQGSDDIQDEKQGEFPVVEEEKNQTVTLKDSYVSDDAANSTERFNLSPSPEDNEFE 61

Query: 55  VPTEEELRTLKHVGGHIPMRCWLIAVVELSERFSYYGLSAPFQNYMANGPHDKPPGLLQL 114
            PT+EELR+L+HVGG IPMRCWLIA+VELSERFSYYGLSAPFQNYM  GP+D P G+L L
Sbjct: 62  APTDEELRSLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDTPKGMLSL 121

Query: 115 NSDGATGLSYFFQFWCYVTPIFGGYMADTHWGKYNTIAVGTGIYICGIFILFMTSIPSIT 174
           NS GATGLSYFFQFWCYVTP+FGGY+ADT WGKYNTI  GT IYI GIFILF+TSIPS+ 
Sbjct: 122 NSSGATGLSYFFQFWCYVTPVFGGYIADTFWGKYNTICCGTAIYIAGIFILFITSIPSVG 181

Query: 175 TKNAGLGGFIVAIILIGIATGMIKSNLSVLIADQLPKRKPLVKTKKNGERVIEDTNLTLQ 234
            +++ LGGFI +IILIGIATGMIK+NLSVLIADQLPKRKP +K  K+GERVIED N+TLQ
Sbjct: 182 NRDSALGGFIASIILIGIATGMIKANLSVLIADQLPKRKPFIKVLKSGERVIEDGNITLQ 241

Query: 235 NVFMFFYLMINIGSLSVIATSELELHRGFWAAYLLPFCFFWIAVVVLVLGKNQYVKPPIG 294
           NVFMFFY MIN+GSLS++AT+ELE H+GFWAAYLLPFCFFW+AVV LV GK QY++ PIG
Sbjct: 242 NVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWVAVVTLVFGKKQYIQRPIG 301

Query: 295 DKVISKCFKVLWILTKNRFNFDAPKPSLNPTKNYPWSDKFVDEIQRALGACKVFLFYPIY 354
           DKVI+K FKV WILTKN+F+F+A KPS++P K+YPW+DKFVDEI+RAL ACKVF+FYPIY
Sbjct: 302 DKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKDYPWNDKFVDEIKRALAACKVFVFYPIY 361

Query: 355 WTCYGQMMSGFVTQGSMMELHGLPNDFFQCIDSIAIIVFIPVCEHLLYPFIRKYTPFRPI 414
           WT YG M+S F+TQ SMMELHG+PNDF Q  DSIA+I+FIP+ E   YPFIR+YTPF+PI
Sbjct: 362 WTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFGYPFIRRYTPFKPI 421

Query: 415 TKIYFGFMFASGCMIWAAVLQSYIYKAGPHYKWPLEHDGPNRIHVALQVPAYVLLAFSEI 474
           TKI+FGFMF S  M WAAVLQS++YKAGP Y  PL H+ PN +HV  Q+PAYVL++FSEI
Sbjct: 422 TKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYSEPLGHNTPNHVHVCWQIPAYVLISFSEI 481

Query: 475 FASITGLEYAYSKAPASMKSFIMSIFLVTNAFGSAIGCALSPVSKDPDWTWLYTGLAVAC 534
           FASITGLEYAYSKAPA+MKSFIMSIFL+TNAFGSAIGCALSPV+ DP +TWL+TGLAVAC
Sbjct: 482 FASITGLEYAYSKAPANMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVAC 541

Query: 535 FISGCLFWVCFRKYNDIEEEMNAMDYE 561
           FISGCLFW+CFRKYND EEEMNAMDYE
Sbjct: 542 FISGCLFWLCFRKYNDTEEEMNAMDYE 568

>Smik_11.356 Chr11 (605836..607644) [1809 bp, 602 aa] {ON} YKR093W
           (REAL)
          Length = 602

 Score =  842 bits (2175), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/562 (71%), Positives = 476/562 (84%), Gaps = 8/562 (1%)

Query: 10  SEDDSLDKKNDL-VLTKENSHTIE-EDSRIVDDLASQYED------DIPEGYEVPTEEEL 61
           S++   +K+ D  V+ +E +H +  +DS + DD+A+  E          E +E PTEEE 
Sbjct: 9   SDEVQDEKQGDFPVIEEEKTHAVTLKDSYVSDDVANSTEQYNLSHSPEDEDFEAPTEEET 68

Query: 62  RTLKHVGGHIPMRCWLIAVVELSERFSYYGLSAPFQNYMANGPHDKPPGLLQLNSDGATG 121
           +TL+HVGG IPMRCWLIA+VELSERFSYYGLSAPFQNYM  GP+D P G+L LNS GATG
Sbjct: 69  KTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLGLNSQGATG 128

Query: 122 LSYFFQFWCYVTPIFGGYMADTHWGKYNTIAVGTGIYICGIFILFMTSIPSITTKNAGLG 181
           LSYFFQFWCYVTP+FGGY+ADT WGKYNTI  GT IYI GIFILF+TSIPS+  +++ +G
Sbjct: 129 LSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSAIG 188

Query: 182 GFIVAIILIGIATGMIKSNLSVLIADQLPKRKPLVKTKKNGERVIEDTNLTLQNVFMFFY 241
           GFI AIILIGIATGMIK+N+SVLIADQLPKRKP +K  K+GERVI D+N+TLQNVFMFFY
Sbjct: 189 GFIAAIILIGIATGMIKANISVLIADQLPKRKPFIKVLKSGERVIVDSNITLQNVFMFFY 248

Query: 242 LMINIGSLSVIATSELELHRGFWAAYLLPFCFFWIAVVVLVLGKNQYVKPPIGDKVISKC 301
            MIN+GSLS++AT+ELE H+GFWAAYLLPFCFFWIAVV L+ GK QY++ PIGDKV++K 
Sbjct: 249 FMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVVAKS 308

Query: 302 FKVLWILTKNRFNFDAPKPSLNPTKNYPWSDKFVDEIQRALGACKVFLFYPIYWTCYGQM 361
           F+V WILTKN+F+F+A KPS++P +NYPW+DKFVDEI+RAL ACKVF+FYPIYWT YG M
Sbjct: 309 FRVCWILTKNKFDFNAAKPSVHPEENYPWNDKFVDEIKRALAACKVFVFYPIYWTQYGTM 368

Query: 362 MSGFVTQGSMMELHGLPNDFFQCIDSIAIIVFIPVCEHLLYPFIRKYTPFRPITKIYFGF 421
           +S F+TQ SMMELHG+PNDF Q  DSIA+IVFIP+ E  +YPFIR+YTP +PITKI+FGF
Sbjct: 369 ISSFITQASMMELHGIPNDFLQAFDSIALIVFIPIFEKFVYPFIRRYTPLKPITKIFFGF 428

Query: 422 MFASGCMIWAAVLQSYIYKAGPHYKWPLEHDGPNRIHVALQVPAYVLLAFSEIFASITGL 481
           MF S  M WAAVLQS++YKAGP Y  PL H+ PN IHV  Q+PAYVL++FSEIFASITGL
Sbjct: 429 MFGSFAMTWAAVLQSFVYKAGPWYNEPLGHNTPNHIHVCWQIPAYVLISFSEIFASITGL 488

Query: 482 EYAYSKAPASMKSFIMSIFLVTNAFGSAIGCALSPVSKDPDWTWLYTGLAVACFISGCLF 541
           EYAYSKAPASMKSFIMSIFL+TNAFGSAIGCALSPV+ DP +TWL+TGLAVACFISGCLF
Sbjct: 489 EYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLF 548

Query: 542 WVCFRKYNDIEEEMNAMDYEVD 563
           W+CFRKYND EEEMNAMDYE D
Sbjct: 549 WLCFRKYNDTEEEMNAMDYEED 570

>YKR093W Chr11 (615730..617535) [1806 bp, 601 aa] {ON}  PTR2Integral
           membrane peptide transporter, mediates transport of di-
           and tri-peptides; conserved protein that contains 12
           transmembrane domains; PTR2 expression is regulated by
           the N-end rule pathway via repression by Cup9p
          Length = 601

 Score =  841 bits (2173), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/560 (72%), Positives = 475/560 (84%), Gaps = 8/560 (1%)

Query: 10  SEDDSLDKKNDL-VLTKENSHTIE-EDSRIVDDLASQYE------DDIPEGYEVPTEEEL 61
           S+D   +K+ D  V+ +E +  +  +DS + DD+A+  E          E +E PTEEE+
Sbjct: 9   SDDAQDEKQGDFPVIEEEKTQAVTLKDSYVSDDVANSTERYNLSPSPEDEDFEGPTEEEM 68

Query: 62  RTLKHVGGHIPMRCWLIAVVELSERFSYYGLSAPFQNYMANGPHDKPPGLLQLNSDGATG 121
           +TL+HVGG IPMRCWLIA+VELSERFSYYGLSAPFQNYM  GP+D P G+L LNS GATG
Sbjct: 69  QTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLSLNSQGATG 128

Query: 122 LSYFFQFWCYVTPIFGGYMADTHWGKYNTIAVGTGIYICGIFILFMTSIPSITTKNAGLG 181
           LSYFFQFWCYVTP+FGGY+ADT WGKYNTI  GT IYI GIFILF+TSIPS+  +++ +G
Sbjct: 129 LSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSAIG 188

Query: 182 GFIVAIILIGIATGMIKSNLSVLIADQLPKRKPLVKTKKNGERVIEDTNLTLQNVFMFFY 241
           GFI AIILIGIATGMIK+NLSVLIADQLPKRKP +K  K+GERVI D+N+TLQNVFMFFY
Sbjct: 189 GFIAAIILIGIATGMIKANLSVLIADQLPKRKPSIKVLKSGERVIVDSNITLQNVFMFFY 248

Query: 242 LMINIGSLSVIATSELELHRGFWAAYLLPFCFFWIAVVVLVLGKNQYVKPPIGDKVISKC 301
            MIN+GSLS++AT+ELE H+GFWAAYLLPFCFFWIAVV L+ GK QY++ PIGDKVI+K 
Sbjct: 249 FMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVIAKS 308

Query: 302 FKVLWILTKNRFNFDAPKPSLNPTKNYPWSDKFVDEIQRALGACKVFLFYPIYWTCYGQM 361
           FKV WILTKN+F+F+A KPS++P KNYPW+DKFVDEI+RAL ACKVF+FYPIYWT YG M
Sbjct: 309 FKVCWILTKNKFDFNAAKPSVHPEKNYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTM 368

Query: 362 MSGFVTQGSMMELHGLPNDFFQCIDSIAIIVFIPVCEHLLYPFIRKYTPFRPITKIYFGF 421
           +S F+TQ SMMELHG+PNDF Q  DSIA+I+FIP+ E  +YPFIR+YTP +PITKI+FGF
Sbjct: 369 ISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFVYPFIRRYTPLKPITKIFFGF 428

Query: 422 MFASGCMIWAAVLQSYIYKAGPHYKWPLEHDGPNRIHVALQVPAYVLLAFSEIFASITGL 481
           MF S  M WAAVLQS++YKAGP Y  PL H+ PN +HV  Q+PAYVL++FSEIFASITGL
Sbjct: 429 MFGSFAMTWAAVLQSFVYKAGPWYNEPLGHNTPNHVHVCWQIPAYVLISFSEIFASITGL 488

Query: 482 EYAYSKAPASMKSFIMSIFLVTNAFGSAIGCALSPVSKDPDWTWLYTGLAVACFISGCLF 541
           EYAYSKAPASMKSFIMSIFL+TNAFGSAIGCALSPV+ DP +TWL+TGLAVACFISGCLF
Sbjct: 489 EYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLF 548

Query: 542 WVCFRKYNDIEEEMNAMDYE 561
           W+CFRKYND EEEMNAMDYE
Sbjct: 549 WLCFRKYNDTEEEMNAMDYE 568

>KAFR0H00230 Chr8 complement(33231..35021) [1791 bp, 596 aa] {ON} 
          Length = 596

 Score =  831 bits (2146), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/556 (71%), Positives = 457/556 (82%), Gaps = 14/556 (2%)

Query: 16  DKKNDLVLTKENSHTIEEDSRIVDDLASQYEDD----------IPEGYEVPTEEELRTLK 65
           D+KN++ L K    T+  + +I+D  + + ++D            EGYE+PTEEELRTL+
Sbjct: 18  DEKNNIDLKKT---TVSSEDQILDTESYKLQNDNEFDPEHPDYQEEGYEMPTEEELRTLR 74

Query: 66  HVGGHIPMRCWLIAVVELSERFSYYGLSAPFQNYMANGPHDKPPGLLQLNSDGATGLSYF 125
           HV G IP RC+LIAVVELSERFSYYGLSAPFQNYMAN P D PPG+LQLNSDGATGLSYF
Sbjct: 75  HVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGVLQLNSDGATGLSYF 134

Query: 126 FQFWCYVTPIFGGYMADTHWGKYNTIAVGTGIYICGIFILFMTSIPSITTKNAGLGGFIV 185
           FQFWCY+TP+ GGY+ADT+WG+YNTIAVGTGIYI GIF+LF+TS  SI  KN  LGGFIV
Sbjct: 135 FQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKSIAGKNGALGGFIV 194

Query: 186 AIILIGIATGMIKSNLSVLIADQLPKRKPLVKTKKNGERVIEDTNLTLQNVFMFFYLMIN 245
           A+ILIGI TG IK+NLSVLIADQ+P ++P VKT K+GERVIED ++T+QNVFMFFYLMIN
Sbjct: 195 ALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDITIQNVFMFFYLMIN 254

Query: 246 IGSLSVIATSELELHRGFWAAYLLPFCFFWIAVVVLVLGKNQYVKPPIGDKVISKCFKVL 305
           IGSLSVIAT+ELE H GFWAAYLLPFCFFWIAV+VLVLG+  Y   P  D+VI K FK  
Sbjct: 255 IGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKPTSDRVIEKSFKFC 314

Query: 306 WILTKNRFNFDAPKPSLNPTKNYPWSDKFVDEIQRALGACKVFLFYPIYWTCYGQMMSGF 365
           W LTKN+FN+ A  P+ NP   + W DKFV+EI+ AL ACKVFLFYPIYWTCYGQM + F
Sbjct: 315 WALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFYPIYWTCYGQMTNNF 374

Query: 366 VTQGSMMELHGLPNDFFQCIDSIAIIVFIPVCEHLLYPFIRKYTPFRPITKIYFGFMFAS 425
           VT GSM++LHGLPND FQ IDSIA+IVFIP+CE   YPFIR++TPFRPITKI +GF  AS
Sbjct: 375 VTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPFRPITKITYGFWLAS 434

Query: 426 GCMIWAAVLQSYIYKAGPHYKWPLEHDGPNRIHVALQVPAYVLLAFSEIFASITGLEYAY 485
             M+WA VLQ +IYK GP+YK PL  DGPN +HVA QVPAYVL+AFSEIFASITGLEYAY
Sbjct: 435 ASMVWACVLQYFIYKTGPNYKHPLA-DGPNNVHVAWQVPAYVLIAFSEIFASITGLEYAY 493

Query: 486 SKAPASMKSFIMSIFLVTNAFGSAIGCALSPVSKDPDWTWLYTGLAVACFISGCLFWVCF 545
           SKAPASMKSFIM++FL  NAFGSAIGCALSPVSKDPD+TWLY GLAV  FI+GC FW CF
Sbjct: 494 SKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAVTAFITGCAFWFCF 553

Query: 546 RKYNDIEEEMNAMDYE 561
           R YNDIE+EMNA++YE
Sbjct: 554 RHYNDIEDEMNALNYE 569

>TBLA0A09120 Chr1 complement(2259486..2261387) [1902 bp, 633 aa]
           {ON} Anc_5.698 YKR093W
          Length = 633

 Score =  830 bits (2144), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/554 (72%), Positives = 465/554 (83%), Gaps = 10/554 (1%)

Query: 16  DKKNDLVLTKENSHTIEEDSRIVDDLASQYEDDIPEGYEVPTEEELRTLKHVGGHIPMRC 75
           D+K D     +   T +EDS I++D      + I E +E PTEEELRTLKHVGG IP+RC
Sbjct: 52  DEKRD-----QKFETFQEDSSIIND----ENEVITEDFEEPTEEELRTLKHVGGKIPLRC 102

Query: 76  WLIAVVELSERFSYYGLSAPFQNYMANGPHDKPPGLLQLNSDGATGLSYFFQFWCYVTPI 135
           WL+AV+EL+ERFSYYGLSAPFQNYM NGP+D PPG L L+S GATGLSYFFQFWCY+TP+
Sbjct: 103 WLMAVIELAERFSYYGLSAPFQNYMQNGPNDSPPGALSLDSSGATGLSYFFQFWCYLTPV 162

Query: 136 FGGYMADTHWGKYNTIAVGTGIYICGIFILFMTSIPSITTKNAGLGGFIVAIILIGIATG 195
           F GYMADT+WGK+ TI +GTGIYI GIFILF+TS+PSIT+ N  +GGFIV +IL+GIATG
Sbjct: 163 FAGYMADTYWGKFTTICIGTGIYIVGIFILFITSLPSITSHNTAMGGFIVTLILVGIATG 222

Query: 196 MIKSNLSVLIADQLPKRKPLVKTKKNGERVIEDTNLTLQNVFMFFYLMINIGSLSVIATS 255
           MIK+NLSV+IA+Q+PKRK  V TKKNG RVIED ++T+QNVFM FY MINIGSLSVIAT+
Sbjct: 223 MIKANLSVMIAEQIPKRKRRVITKKNGTRVIEDPDITIQNVFMTFYFMINIGSLSVIATT 282

Query: 256 ELELHRGFWAAYLLPFCFFWIAVVVLVLGKNQYVKPPIGDKVISKCFKVLWILTKNRFNF 315
           ELE H+GFWAAYLLPFCFFW+AV+VL++G   Y+K P+GDKVISKCFKVL IL +NRFN 
Sbjct: 283 ELEAHKGFWAAYLLPFCFFWVAVIVLIVGNKTYIKTPVGDKVISKCFKVLRILMRNRFNP 342

Query: 316 DAPKPSLNPTKNYPWSDKFVDEIQRALGACKVFLFYPIYWTCYGQMMSGFVTQGSMMELH 375
           D+ KP+ NP KNYPWSDKFVDEI RAL ACKVF+FYPIYW CYGQM++ FV+QG  MELH
Sbjct: 343 DSAKPAFNPDKNYPWSDKFVDEIMRALQACKVFVFYPIYWVCYGQMLNNFVSQGGTMELH 402

Query: 376 GLPNDFFQCIDSIAIIVFIPVCEHLLYPFIRKYTPFRPITKIYFGFMFASGCMIWAAVLQ 435
           GLPNDFFQ IDSIA+IVFIP+CE  +YPFIRKYTPF+PITKI++GF F +  M WA VLQ
Sbjct: 403 GLPNDFFQAIDSIALIVFIPICERFVYPFIRKYTPFKPITKIFWGFTFGALSMTWACVLQ 462

Query: 436 SYIYKAGPHYKWPLEHD-GPNRIHVALQVPAYVLLAFSEIFASITGLEYAYSKAPASMKS 494
            +IYKA P Y  P + D GPN IHVALQVPAY LLA SEIFASITGLEYAYSKAPASMK+
Sbjct: 463 HFIYKAAPCYDHPSKCDNGPNHIHVALQVPAYCLLALSEIFASITGLEYAYSKAPASMKA 522

Query: 495 FIMSIFLVTNAFGSAIGCALSPVSKDPDWTWLYTGLAVACFISGCLFWVCFRKYNDIEEE 554
           FIMSIFLVTNAFG+AIGCALSPVSKDP + WLY GLAVACF+ GCLFW+ F+KYND+EEE
Sbjct: 523 FIMSIFLVTNAFGAAIGCALSPVSKDPKYVWLYGGLAVACFVGGCLFWIIFKKYNDMEEE 582

Query: 555 MNAMDYEVDATMLK 568
           +N +D+E    ML+
Sbjct: 583 LNNLDFEEGDDMLE 596

>ZYRO0G06688g Chr7 complement(535282..537123) [1842 bp, 613 aa] {ON}
           similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 613

 Score =  824 bits (2129), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/567 (69%), Positives = 466/567 (82%), Gaps = 15/567 (2%)

Query: 25  KENSHTIEEDSRIVDDLASQYEDDIPEGYEVP-----TEEELRTLKHVGGHIPMRCWLIA 79
           ++N   IE+ S  V     + E D  E YEVP     TEEELR+L+HVGGHIP RCWLIA
Sbjct: 12  EKNKVIIEDKSLEVSGSHERGELDFDE-YEVPNDDEPTEEELRSLRHVGGHIPFRCWLIA 70

Query: 80  VVELSERFSYYGLSAPFQNYMANGPHDKPPGLLQLNSDGATGLSYFFQFWCYVTPIFGGY 139
           +VELSERFSYYGLSAPFQNYM NG HD P G+L L S GATGL+YFFQFWCYVTP+FGG+
Sbjct: 71  IVELSERFSYYGLSAPFQNYMQNGKHDNPAGVLDLKSQGATGLAYFFQFWCYVTPVFGGW 130

Query: 140 MADTHWGKYNTIAVGTGIYICGIFILFMTSIPSITTKNAGLGGFIVAIILIGIATGMIKS 199
           +ADT+WGKY TI VGTG+Y+ GIFILF+TS+PS+ +KN  LGGFI AI+LIGIATGMIK+
Sbjct: 131 LADTYWGKYETICVGTGVYVVGIFILFITSLPSVDSKNTALGGFITAIVLIGIATGMIKA 190

Query: 200 NLSVLIADQLPKRKPLVKTKKNGERVIEDTNLTLQNVFMFFYLMINIGSLSVIATSELEL 259
           NLSVLIADQ PKRKP +KT K GERVIED N+T+QNVFMFFYLMINIGSLSVIAT+ELE 
Sbjct: 191 NLSVLIADQFPKRKPRIKTTKRGERVIEDPNITIQNVFMFFYLMINIGSLSVIATTELEE 250

Query: 260 HRGFWAAYLLPFCFFWIAVVVLVLGKNQYVKPPIGDKVISKCFKVLWILTKNRFNFDAPK 319
           H+GFWAAYLLPFCFFWIAV+VL +G+  YV+PP+GDKVI+K F+VL  L K+RF+++A K
Sbjct: 251 HKGFWAAYLLPFCFFWIAVIVLFVGRKSYVRPPVGDKVIAKSFRVLGQLIKHRFDYEAVK 310

Query: 320 PSLNPTKNYPWSDKFVDEIQRALGACKVFLFYPIYWTCYGQMMSGFVTQGSMMELHGLPN 379
           PS++P ++YPW+D FV+EI+RAL ACKVF+FYPIYW  YGQM S FV+ G  M+LHGLPN
Sbjct: 311 PSVHPERDYPWNDHFVEEIKRALKACKVFMFYPIYWVPYGQMTSTFVSVGGEMQLHGLPN 370

Query: 380 DFFQCIDSIAIIVFIPVCEHLLYPFIRKYTPFRPITKIYFGFMFASGCMIWAAVLQSYIY 439
           DFFQ IDSIA+IVFIP+CE+ LYPFIR+YTPF+PITKI+FGFM+ S  MIWAAVLQ +IY
Sbjct: 371 DFFQAIDSIALIVFIPICEYWLYPFIRRYTPFKPITKIFFGFMWCSASMIWAAVLQHFIY 430

Query: 440 KAGPHYKWPLE-HDGPNRIHVALQVPAYVLLAFSEIFASITGLEYAYSKAPASMKSFIMS 498
           K GP Y  P++  +GPN IH+  QVPAYVL+AFSEIFASITGLEYAYSKAP SMKSFIMS
Sbjct: 431 KTGPCYDHPMDCPNGPNNIHIGWQVPAYVLIAFSEIFASITGLEYAYSKAPTSMKSFIMS 490

Query: 499 IFLVTNAFGSAIGCALSPVSKDPDWTWLYTGLAVACFISGCLFWVCFRKYNDIEEEMNAM 558
           IFL+TNAFGSAIGCALSPV  DP + W++TGLAVA FISGCLFW+ F   ND EEEMNAM
Sbjct: 491 IFLLTNAFGSAIGCALSPVDTDPKYLWMFTGLAVASFISGCLFWLTFHHLNDTEEEMNAM 550

Query: 559 DYEVDATMLKKVPIETDTVALEKGSSE 585
           DYE +   +           L+KG+S+
Sbjct: 551 DYEENQEKIDD--------GLQKGTSD 569

>NCAS0A03220 Chr1 complement(635016..636851) [1836 bp, 611 aa] {ON}
           Anc_5.698
          Length = 611

 Score =  824 bits (2128), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/549 (71%), Positives = 461/549 (83%)

Query: 13  DSLDKKNDLVLTKENSHTIEEDSRIVDDLASQYEDDIPEGYEVPTEEELRTLKHVGGHIP 72
           +   +K   +  KE + + EE    ++     ++++   GYE+PTEE++ TL+HV G IP
Sbjct: 25  EKAQEKTQEITLKETTGSSEEVHDELETYHIHHDEECEPGYEIPTEEDMETLRHVSGKIP 84

Query: 73  MRCWLIAVVELSERFSYYGLSAPFQNYMANGPHDKPPGLLQLNSDGATGLSYFFQFWCYV 132
           +RCWLIA+VEL+ERFSYYGLSAPFQNYM NGP+D P G+L+LNS GATGLSYFFQFWCYV
Sbjct: 85  LRCWLIALVELAERFSYYGLSAPFQNYMENGPNDTPAGVLELNSSGATGLSYFFQFWCYV 144

Query: 133 TPIFGGYMADTHWGKYNTIAVGTGIYICGIFILFMTSIPSITTKNAGLGGFIVAIILIGI 192
           TP+FGG+MADT+WGKYNTI VGTGIY+ GIFILF+TSIPSI +K+  LGGFI AIILIGI
Sbjct: 145 TPVFGGFMADTYWGKYNTICVGTGIYLAGIFILFITSIPSIASKDTSLGGFIAAIILIGI 204

Query: 193 ATGMIKSNLSVLIADQLPKRKPLVKTKKNGERVIEDTNLTLQNVFMFFYLMINIGSLSVI 252
           ATGMIK+NLSVLIADQLPKRKP VKT K+GERV+ED N+TLQNVFM+FYLM+N+GSLSVI
Sbjct: 205 ATGMIKANLSVLIADQLPKRKPRVKTLKSGERVVEDPNITLQNVFMWFYLMVNVGSLSVI 264

Query: 253 ATSELELHRGFWAAYLLPFCFFWIAVVVLVLGKNQYVKPPIGDKVISKCFKVLWILTKNR 312
           AT+ELE H+ FWAA+LLPFCFFWIAVVVLV G+NQYVK    +K I K FK+LWI++KN+
Sbjct: 265 ATTELEEHKNFWAAFLLPFCFFWIAVVVLVGGRNQYVKEGKREKSIQKSFKILWIVSKNK 324

Query: 313 FNFDAPKPSLNPTKNYPWSDKFVDEIQRALGACKVFLFYPIYWTCYGQMMSGFVTQGSMM 372
           F+  + KPS +P KNYPW+DKFVDE  RAL ACKVFLFYPIYW  YG M+S FVTQGSMM
Sbjct: 325 FDLTSAKPSYHPEKNYPWTDKFVDECSRALSACKVFLFYPIYWVIYGTMISTFVTQGSMM 384

Query: 373 ELHGLPNDFFQCIDSIAIIVFIPVCEHLLYPFIRKYTPFRPITKIYFGFMFASGCMIWAA 432
           ELHGLPND FQ IDS A+I+FIP+CE  +YPFIR++TPF+PITKI+FGFMFA+G M+W+ 
Sbjct: 385 ELHGLPNDIFQAIDSFALIIFIPICERFIYPFIRRFTPFKPITKIFFGFMFATGAMVWSC 444

Query: 433 VLQSYIYKAGPHYKWPLEHDGPNRIHVALQVPAYVLLAFSEIFASITGLEYAYSKAPASM 492
           VLQS+IYKAGP+Y  PL   GPNRIHV  QVPAYVL+AFSEI ASITGLEYAYSKAP SM
Sbjct: 445 VLQSFIYKAGPYYDHPLNGGGPNRIHVGWQVPAYVLIAFSEILASITGLEYAYSKAPMSM 504

Query: 493 KSFIMSIFLVTNAFGSAIGCALSPVSKDPDWTWLYTGLAVACFISGCLFWVCFRKYNDIE 552
           KSFIMS+FL +NA GS +G ALSPVS DP +TWL+ GL VACFI GC+FW+ FRKYND E
Sbjct: 505 KSFIMSLFLFSNAGGSILGIALSPVSVDPKFTWLFGGLGVACFIGGCIFWIIFRKYNDTE 564

Query: 553 EEMNAMDYE 561
           EEMNAMDYE
Sbjct: 565 EEMNAMDYE 573

>Kpol_529.28 s529 complement(82303..84135) [1833 bp, 610 aa] {ON}
           complement(82303..84135) [1833 nt, 611 aa]
          Length = 610

 Score =  822 bits (2124), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/569 (67%), Positives = 471/569 (82%), Gaps = 18/569 (3%)

Query: 4   RQVNTFSEDDS----LDKKND---LVLTKENSHTIEEDSRI----VDDLASQYEDDIPEG 52
           R+ +   EDDS    +D K D    +++K +S +++   ++    V D   +Y+D+  + 
Sbjct: 7   RRTSGELEDDSFASHIDSKQDHEVKIVSKFDSTSLQNSDQLEITKVGDDDIEYDDN--QD 64

Query: 53  YEVPTEEELRTLKHVGGHIPMRCWLIAVVELSERFSYYGLSAPFQNYMANGPHDKPPGLL 112
           +  PTEEE++TLKHV G IPMRCWLIAVVELSERFSYYGL+APFQNYMANGP+D P G+L
Sbjct: 65  FVEPTEEEMKTLKHVSGKIPMRCWLIAVVELSERFSYYGLAAPFQNYMANGPNDTPKGVL 124

Query: 113 QLNSDGATGLSYFFQFWCYVTPIFGGYMADTHWGKYNTIAVGTGIYICGIFILFMTSIPS 172
            L++ GA+ LSYFFQFWCY+TPIFGGYMADT+WGKYNTI  GTGIY+ GIF+LF+TS+PS
Sbjct: 125 MLDTQGASALSYFFQFWCYITPIFGGYMADTYWGKYNTICAGTGIYVVGIFLLFITSLPS 184

Query: 173 ITTKNAGLGGFIVAIILIGIATGMIKSNLSVLIADQLPKRKPLVKTKKNGERVIEDTNLT 232
           I T+   LGG++ AIILIGIATGMIK+N+SVLIA+Q+P+ KP V T+K G+RVIED N+T
Sbjct: 185 IDTRETALGGYVTAIILIGIATGMIKANISVLIAEQIPRTKPRVITQKGGKRVIEDPNIT 244

Query: 233 LQNVFMFFYLMINIGSLSVIATSELELHRGFWAAYLLPFCFFWIAVVVLVLGKNQYVKPP 292
            QNVFMFFY+MIN+GSLS++AT+ELE H+GFWAAYLLPFCFFWIAVVVLV+G+NQY+  P
Sbjct: 245 TQNVFMFFYMMINVGSLSLMATTELESHKGFWAAYLLPFCFFWIAVVVLVIGRNQYIMVP 304

Query: 293 IGDKVISKCFKVLWILTKNRFNFDAPKPSLNPTKNYPWSDKFVDEIQRALGACKVFLFYP 352
           +GDK+ISK FKV+WIL KN+ NFDA KPS+NP KNYPW+DKFV+EI+RAL ACKVF+FYP
Sbjct: 305 VGDKMISKSFKVMWILVKNKLNFDAAKPSMNPEKNYPWNDKFVEEIRRALRACKVFVFYP 364

Query: 353 IYWTCYGQMMSGFVTQGSMMELHGLPNDFFQCIDSIAIIVFIPVCEHLLYPFIRKYTPFR 412
           IYW  YGQM++ FVTQ   MELH LPNDF Q  DSIAIIVFIP+ E  +YPF+R++TPFR
Sbjct: 365 IYWCVYGQMINNFVTQAGTMELHNLPNDFLQAFDSIAIIVFIPIFERFIYPFVRRFTPFR 424

Query: 413 PITKIYFGFMFASGCMIWAAVLQSYIYKAGPHYKWPLE-----HDGPNRIHVALQVPAYV 467
           PITKI++GFMF SG MIWAAVLQS+IYKAGP Y  P++      + PN++HVA QVPAYV
Sbjct: 425 PITKIFWGFMFGSGAMIWAAVLQSFIYKAGPCYNMPMKCAPEYANTPNQVHVAWQVPAYV 484

Query: 468 LLAFSEIFASITGLEYAYSKAPASMKSFIMSIFLVTNAFGSAIGCALSPVSKDPDWTWLY 527
           L+A SEI AS+TGLEYAYS APASMKSFIMSIFLVTNAFGSAIG A+SP ++DP +TW +
Sbjct: 485 LIAISEILASVTGLEYAYSNAPASMKSFIMSIFLVTNAFGSAIGIAISPTAQDPKYTWTF 544

Query: 528 TGLAVACFISGCLFWVCFRKYNDIEEEMN 556
           TGLAVACFI+GCLFW+CFR YN+ E+ MN
Sbjct: 545 TGLAVACFIAGCLFWICFRSYNNTEDAMN 573

>KAFR0H00240 Chr8 complement(36393..38168) [1776 bp, 591 aa] {ON}
           Anc_5.698 YKR093W
          Length = 591

 Score =  822 bits (2122), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/587 (65%), Positives = 471/587 (80%), Gaps = 11/587 (1%)

Query: 5   QVNTFSEDDSLDKKNDLVLTKENSHTIEEDSRIVD-DLASQYEDDIPEGYEVPTEEELRT 63
            +NT  E + ++ KN  V + +  H   E   + D  +   +ED   EGYE+PT++E++T
Sbjct: 13  SINTSMEKNYIELKNTKVSSSDGEHKDTEAYTLQDGSIEPDHEDYQEEGYEIPTQDEMKT 72

Query: 64  LKHVGGHIPMRCWLIAVVELSERFSYYGLSAPFQNYMANGPHDKPPGLLQLNSDGATGLS 123
           L+ VGG IP RC+L+A+VEL+ERFSYYGLSAPFQNYM NGP D PPG+LQLNS GATGLS
Sbjct: 73  LRRVGGRIPFRCFLVALVELAERFSYYGLSAPFQNYMQNGPTDSPPGVLQLNSSGATGLS 132

Query: 124 YFFQFWCYVTPIFGGYMADTHWGKYNTIAVGTGIYICGIFILFMTSIPSITTKNAGLGGF 183
           YFFQFWCY+TPIFGGY+ADT WG+YNTI VGT IYI GIFILF+TS  ++  ++  L GF
Sbjct: 133 YFFQFWCYITPIFGGYLADTKWGRYNTIGVGTVIYIIGIFILFITSFKTVAGRDGALAGF 192

Query: 184 IVAIILIGIATGMIKSNLSVLIADQLPKRKPLVKTKKNGERVIEDTNLTLQNVFMFFYLM 243
           I+A+ILIG ATG+IKSNLSVLIADQ+P ++P VKT K+GERVIED ++T+QNVFMFFYLM
Sbjct: 193 ILALILIGFATGLIKSNLSVLIADQIPAKRPRVKTLKSGERVIEDHDVTIQNVFMFFYLM 252

Query: 244 INIGSLSVIATSELELHRGFWAAYLLPFCFFWIAVVVLVLGKNQYVKPPIGDKVISKCFK 303
           INIGSLSVIAT+ELEL+ GFWAAYLLPFCFFWIAV+V+V GK QY+  P GD+VI+K FK
Sbjct: 253 INIGSLSVIATTELELNVGFWAAYLLPFCFFWIAVIVIVAGKRQYIIKPTGDRVIAKSFK 312

Query: 304 VLWILTKNRFNFDAPKPSLNPTKNYPWSDKFVDEIQRALGACKVFLFYPIYWTCYGQMMS 363
           V WIL KN+F+  + KPS +P   +PW DKFVDEIQRAL ACKVFLFYPIYWTCYGQM++
Sbjct: 313 VCWILCKNKFDITSAKPSYHPESEFPWEDKFVDEIQRALAACKVFLFYPIYWTCYGQMVN 372

Query: 364 GFVTQGSMMELHGLPNDFFQCIDSIAIIVFIPVCEHLLYPFIRKYTPFRPITKIYFGFMF 423
            F+T GSMM+LHGLPND FQ I+SI++I+FIP+CE  LYPFIR++TP RP+T+I+ GF+F
Sbjct: 373 NFITMGSMMQLHGLPNDIFQAINSISLIIFIPICEKFLYPFIRRFTPLRPVTRIFCGFIF 432

Query: 424 ASGCMIWAAVLQSYIYKAGPHYKWPLEHDGPNRIHVALQVPAYVLLAFSEIFASITGLEY 483
           A+  M+W+ VLQ +IY  GP+Y  PLE  G N IHV  QVPAYV +AFSEIFASITGLEY
Sbjct: 433 AAMAMVWSCVLQHFIYSTGPNYNRPLEL-GANDIHVGWQVPAYVFIAFSEIFASITGLEY 491

Query: 484 AYSKAPASMKSFIMSIFLVTNAFGSAIGCALSPVSKDPDWTWLYTGLAVACFISGCLFWV 543
           AYSKAPA+MKSFIM++FL  NAFGSAIGCALSPVSKDPD+TWLY  LAVACF+SG +FW+
Sbjct: 492 AYSKAPANMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYGSLAVACFLSGLIFWL 551

Query: 544 CFRKYNDIEEEMNAMDYEVDATMLKKVPIETDTVALEKGSSESVVSL 590
           CFRKYN IE+EMNA+D+  D+        E D + + +   E V SL
Sbjct: 552 CFRKYNKIEDEMNALDF-TDS--------EEDEILIRRAEDEDVASL 589

>TDEL0B02230 Chr2 complement(402022..403746) [1725 bp, 574 aa] {ON}
           Anc_5.698 YKR093W
          Length = 574

 Score =  820 bits (2119), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/568 (69%), Positives = 471/568 (82%), Gaps = 11/568 (1%)

Query: 3   LRQVNTFSED--DSLDKKNDLVLTKENSHTIEEDSRIVDDLASQYEDDIPEGYEVPTEEE 60
           +++  T S D  DS++K+  + +          D ++V+ ++S    ++    + PTEEE
Sbjct: 1   MKRTETSSTDGVDSVEKQKAVEVV---------DDKLVEVISSHNGLEVESYDDEPTEEE 51

Query: 61  LRTLKHVGGHIPMRCWLIAVVELSERFSYYGLSAPFQNYMANGPHDKPPGLLQLNSDGAT 120
           ++TLKHV G IP RCWLIAVVELSERF+YYGLS PFQNYM NGP D P GLL L S GAT
Sbjct: 52  MKTLKHVAGTIPFRCWLIAVVELSERFAYYGLSTPFQNYMQNGPDDTPAGLLNLKSQGAT 111

Query: 121 GLSYFFQFWCYVTPIFGGYMADTHWGKYNTIAVGTGIYICGIFILFMTSIPSITTKNAGL 180
           GLSYFFQFWCYVTPIFGG+++DT+ GKYNTI  GTG+Y+ GI ILF+TSIPSITT+NA  
Sbjct: 112 GLSYFFQFWCYVTPIFGGWLSDTYIGKYNTICWGTGVYVIGILILFVTSIPSITTQNAAT 171

Query: 181 GGFIVAIILIGIATGMIKSNLSVLIADQLPKRKPLVKTKKNGERVIEDTNLTLQNVFMFF 240
           GGFI AIILIGIATGMIKSN+SVLIADQ PK++  V TKK+G RVIED N+TLQNVFM F
Sbjct: 172 GGFIAAIILIGIATGMIKSNISVLIADQFPKQRHRVITKKDGTRVIEDPNITLQNVFMIF 231

Query: 241 YLMINIGSLSVIATSELELHRGFWAAYLLPFCFFWIAVVVLVLGKNQYVKPPIGDKVISK 300
           YLMINIGSLSVIAT+ELE H GFWAAYLLPFCFFWIAV+VL +GKN YVKPP+GDKVISK
Sbjct: 232 YLMINIGSLSVIATTELEAHVGFWAAYLLPFCFFWIAVIVLAVGKNSYVKPPVGDKVISK 291

Query: 301 CFKVLWILTKNRFNFDAPKPSLNPTKNYPWSDKFVDEIQRALGACKVFLFYPIYWTCYGQ 360
           CFKV+ I  KN+FNF+A KPS++P + +PW+DKFVDEI R+L ACKVFLFYP+YW CYGQ
Sbjct: 292 CFKVVGIAIKNKFNFEAAKPSVSPDRAFPWTDKFVDEIVRSLSACKVFLFYPVYWVCYGQ 351

Query: 361 MMSGFVTQGSMMELHGLPNDFFQCIDSIAIIVFIPVCEHLLYPFIRKYTPFRPITKIYFG 420
           M++ FV+ G  MELHGLPNDFFQ IDSIA+IVFIP+CE+ LYP+IRK+TPFRPITKI++G
Sbjct: 352 MLNTFVSVGGTMELHGLPNDFFQAIDSIALIVFIPICEYFLYPYIRKFTPFRPITKIFWG 411

Query: 421 FMFASGCMIWAAVLQSYIYKAGPHYKWPLEHDGPNRIHVALQVPAYVLLAFSEIFASITG 480
           FMF +  M+WAAVLQ +IYK+GP YK+P+  + PN IH+A QVPAYVL+AFSEIFASITG
Sbjct: 412 FMFGAAAMVWAAVLQHFIYKSGPWYKYPMAENTPNHIHIAWQVPAYVLIAFSEIFASITG 471

Query: 481 LEYAYSKAPASMKSFIMSIFLVTNAFGSAIGCALSPVSKDPDWTWLYTGLAVACFISGCL 540
           LEYAYSKAP +MKSFIM+IFL+TNAFGSAIGCALSPV+KDPD+ WLY GL VACF +G L
Sbjct: 472 LEYAYSKAPVTMKSFIMAIFLLTNAFGSAIGCALSPVTKDPDYVWLYVGLGVACFAAGWL 531

Query: 541 FWVCFRKYNDIEEEMNAMDYEVDATMLK 568
           FW CF+ YND EE MNA+DY+ D TMLK
Sbjct: 532 FWFCFKHYNDTEEAMNALDYDEDPTMLK 559

>CAGL0G02453g Chr7 (218003..219796) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093w PTR2
          Length = 597

 Score =  820 bits (2118), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/564 (70%), Positives = 457/564 (81%), Gaps = 4/564 (0%)

Query: 5   QVNTFSEDDSLDKKNDLVLTKENSHTIEEDSRIVDDLASQYEDDIPEGYEVPTEEELRTL 64
           Q +  S DD+  K+   +  +E  H   + S    + A   +DD    +E PTEEEL+TL
Sbjct: 18  QKDVSSIDDNSSKEVYEIEDQEIHHLDRDKSNAESNFALGEDDD----FEAPTEEELKTL 73

Query: 65  KHVGGHIPMRCWLIAVVELSERFSYYGLSAPFQNYMANGPHDKPPGLLQLNSDGATGLSY 124
           +HV GHIP+RCWLIA+VELSERFSYYGLSAPFQNYM NGP+D P GLL L S GATGLSY
Sbjct: 74  RHVAGHIPLRCWLIAIVELSERFSYYGLSAPFQNYMQNGPNDNPKGLLGLKSQGATGLSY 133

Query: 125 FFQFWCYVTPIFGGYMADTHWGKYNTIAVGTGIYICGIFILFMTSIPSITTKNAGLGGFI 184
           FFQFWCYVTP+FGG+++DT+WGKYNTI VGT IY+CGIFILF+TSIP +T  +  LGGFI
Sbjct: 134 FFQFWCYVTPVFGGWVSDTYWGKYNTICVGTFIYVCGIFILFITSIPGVTNSDGALGGFI 193

Query: 185 VAIILIGIATGMIKSNLSVLIADQLPKRKPLVKTKKNGERVIEDTNLTLQNVFMFFYLMI 244
            AIILIGIATGMIKSNLSVLIADQLP +KP V   K GERVIED NLTLQNVFMFFY  I
Sbjct: 194 AAIILIGIATGMIKSNLSVLIADQLPNKKPRVVITKKGERVIEDPNLTLQNVFMFFYFTI 253

Query: 245 NIGSLSVIATSELELHRGFWAAYLLPFCFFWIAVVVLVLGKNQYVKPPIGDKVISKCFKV 304
           N+GSLSV+AT+ELE H+GFWAAYLLPFCFFW+AV VLV G+NQY+KPP+GDKVISK FKV
Sbjct: 254 NVGSLSVMATTELEYHKGFWAAYLLPFCFFWVAVAVLVFGRNQYIKPPVGDKVISKSFKV 313

Query: 305 LWILTKNRFNFDAPKPSLNPTKNYPWSDKFVDEIQRALGACKVFLFYPIYWTCYGQMMSG 364
           L+IL+KN+FN +A KPS NP KN+PWSDKFVDEI+RAL ACKVF+FYP+YW CYG M++ 
Sbjct: 314 LYILSKNKFNAEAAKPSFNPDKNFPWSDKFVDEIKRALQACKVFVFYPVYWVCYGTMLNN 373

Query: 365 FVTQGSMMELHGLPNDFFQCIDSIAIIVFIPVCEHLLYPFIRKYTPFRPITKIYFGFMFA 424
           FVTQG  MELH LPNDF Q  DSIA+I+FIP+ E  +YPFIR+YTP RPITKI+FGFM  
Sbjct: 374 FVTQGGTMELHNLPNDFLQAFDSIALIIFIPIFERFVYPFIRRYTPLRPITKIFFGFMVG 433

Query: 425 SGCMIWAAVLQSYIYKAGPHYKWPLEHDGPNRIHVALQVPAYVLLAFSEIFASITGLEYA 484
           SG M+WAAVLQ +IY  GP Y  PL+HD PN IHVA Q+PAYVL+A SEIFASITGLEYA
Sbjct: 434 SGAMVWAAVLQHFIYTKGPWYDHPLDHDTPNHIHVAWQIPAYVLIAISEIFASITGLEYA 493

Query: 485 YSKAPASMKSFIMSIFLVTNAFGSAIGCALSPVSKDPDWTWLYTGLAVACFISGCLFWVC 544
           YSKAP SMKSFIMSIFL+TNAFGSAIGCALSPVS DP + W YTGLA ACFI+G +FW  
Sbjct: 494 YSKAPESMKSFIMSIFLLTNAFGSAIGCALSPVSVDPKFVWFYTGLACACFIAGWVFWFI 553

Query: 545 FRKYNDIEEEMNAMDYEVDATMLK 568
           +   ND EE MNA+DYE D  M K
Sbjct: 554 YSGLNDEEEAMNALDYEHDEFMYK 577

>TPHA0N01960 Chr14 complement(418505..420280) [1776 bp, 591 aa] {ON}
           
          Length = 591

 Score =  809 bits (2089), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/571 (69%), Positives = 466/571 (81%), Gaps = 16/571 (2%)

Query: 1   MTLRQVNTFSEDD-----SLDKKNDLVLTKENSHTIEEDSRI-VDDLASQYEDDIPEGYE 54
           M+L ++ T S  D      LD K+ + +     H +  +++I V  L  +  ++  E Y 
Sbjct: 1   MSLTKLETHSNSDLSLSSQLDNKDKIEV-----HVVSTENQIDVHSLDDEDYEEEDEDYV 55

Query: 55  VPTEEELRTLKHVGGHIPMRCWLIAVVELSERFSYYGLSAPFQNYMANGPHDKPPGLLQL 114
            PTEEEL+TL+HV G+IP+RCWLIA+VEL+ERFSYYGLSAPFQNYMANGP+D P GLLQL
Sbjct: 56  APTEEELKTLRHVSGYIPLRCWLIAIVELAERFSYYGLSAPFQNYMANGPNDTPKGLLQL 115

Query: 115 NSDGATGLSYFFQFWCYVTPIFGGYMADTHWGKYNTIAVGTGIYICGIFILFMTSIPSIT 174
           NS GAT +SYFFQFWCYVTPIFGGYMADTHWGKYNTI  GTGIY+ GIFILFMTSI SIT
Sbjct: 116 NSSGATAISYFFQFWCYVTPIFGGYMADTHWGKYNTICTGTGIYVSGIFILFMTSIESIT 175

Query: 175 TKNAGLGGFIVAIILIGIATGMIKSNLSVLIADQLPKRKPLVKTKKNGERVIEDTNLTLQ 234
           T+NA  GG+I AIILIGIATGMIKSN+SVLIA+Q+PKRK  V T   GERVIED  LT+Q
Sbjct: 176 TQNAARGGYIAAIILIGIATGMIKSNISVLIAEQVPKRKIRVITTSKGERVIEDPKLTVQ 235

Query: 235 NVFMFFYLMINIGSLSVIATSELELHRGFWAAYLLPFCFFWIAVVVLVLGKNQYVKPPIG 294
           N+FMFFYLMINIGSLSVIAT+ELE H+GFWAAYLLPFCFFWIAVVVL++GK QYV+ P+G
Sbjct: 236 NIFMFFYLMINIGSLSVIATTELEAHKGFWAAYLLPFCFFWIAVVVLIVGKKQYVRKPVG 295

Query: 295 DKVISKCFKVLWILTKNRFNFDAPKPSLNPTKNYPWSDKFVDEIQRALGACKVFLFYPIY 354
           DKVISKCF + WI  KN+ +FD+ KPS +P  NYPW+DKFV+E++RA+ ACKVFLFYPIY
Sbjct: 296 DKVISKCFTITWIAFKNKLDFDSAKPSCHPEANYPWTDKFVEEVRRAIRACKVFLFYPIY 355

Query: 355 WTCYGQMMSGFVTQGSMMELHGLPNDFFQCIDSIAIIVFIPVCEHLLYPFIRKYTPFRPI 414
           W  YGQM++ FVTQ   MELHGLPNDF Q IDSIAIIVFIP+CE  LYPFIRK+TPFR I
Sbjct: 356 WCVYGQMLNNFVTQAGTMELHGLPNDFLQAIDSIAIIVFIPICEKFLYPFIRKFTPFRSI 415

Query: 415 TKIYFGFMFASGCMIWAAVLQSYIYKAGPHYKWPLE-----HDGPNRIHVALQVPAYVLL 469
           TKI++GFMF S  MIWAAVLQS+IYKAGP +  PL         PN++H+A QVPAYVL+
Sbjct: 416 TKIFWGFMFGSAAMIWAAVLQSFIYKAGPCFDKPLACAAQYAHTPNQVHIAWQVPAYVLI 475

Query: 470 AFSEIFASITGLEYAYSKAPASMKSFIMSIFLVTNAFGSAIGCALSPVSKDPDWTWLYTG 529
           AFSEIFASITGLEYAYS AP SMKSFIMSIFL+T AFGSA+G A+SP S DP +TW +TG
Sbjct: 476 AFSEIFASITGLEYAYSNAPESMKSFIMSIFLLTTAFGSALGIAISPTSVDPKFTWAFTG 535

Query: 530 LAVACFISGCLFWVCFRKYNDIEEEMNAMDY 560
           LAV+CFI+GCLFW+CFRKYN+ E+ M+ +D+
Sbjct: 536 LAVSCFIAGCLFWICFRKYNNTEDSMDEIDF 566

>TPHA0O02000 Chr15 complement(404570..406432) [1863 bp, 620 aa] {ON}
           
          Length = 620

 Score =  803 bits (2074), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/565 (67%), Positives = 455/565 (80%), Gaps = 12/565 (2%)

Query: 9   FSEDDSLDKKNDLVLT----KENSHTIEE-DSRIVDDLASQYEDDIPEGYEVPTEEELRT 63
           +S +  LD  +D+        EN    EE D   VDD A  Y D+   GY  PTEEE+ T
Sbjct: 26  YSGEKELDSSHDVTFNIDDKVENDTNEEELDEFAVDDEADPYNDEW--GYVEPTEEEMAT 83

Query: 64  LKHVGGHIPMRCWLIAVVELSERFSYYGLSAPFQNYMANGPHDKPPGLLQLNSDGATGLS 123
           LKHV GHIP RCWLIAVVELSERFSYYGLSAPFQNYMANGP+D P G+LQLN++GATGLS
Sbjct: 84  LKHVAGHIPYRCWLIAVVELSERFSYYGLSAPFQNYMANGPNDTPKGILQLNTNGATGLS 143

Query: 124 YFFQFWCYVTPIFGGYMADTHWGKYNTIAVGTGIYICGIFILFMTSIPSITTKNAGLGGF 183
           YFFQFWCY+TPIFGGYMADT+W KYNTIAVGT IYI GIFILF+T+IPSI TK    GGF
Sbjct: 144 YFFQFWCYITPIFGGYMADTYWNKYNTIAVGTVIYIIGIFILFITAIPSIATKETATGGF 203

Query: 184 IVAIILIGIATGMIKSNLSVLIADQLPKRKPLVKTKKNGERVIEDTNLTLQNVFMFFYLM 243
           + AIILIGI TGMIK+NLSVL+A+Q+PKRK  V T K GERVIED ++T+QNVFMFFYLM
Sbjct: 204 VTAIILIGIGTGMIKANLSVLVAEQIPKRKHRVITTKKGERVIEDPDITMQNVFMFFYLM 263

Query: 244 INIGSLSVIATSELELHRGFWAAYLLPFCFFWIAVVVLVLGKNQYVKPPIGDKVISKCFK 303
           INIG+LSV+AT+ELE H+GFWAAYLLPFCFFWIAVV+LV+G+N Y+  P+GDKVISKCFK
Sbjct: 264 INIGALSVLATTELESHKGFWAAYLLPFCFFWIAVVILVMGRNSYIIKPVGDKVISKCFK 323

Query: 304 VLWILTKNRFNFDAPKPSLNPTKNYPWSDKFVDEIQRALGACKVFLFYPIYWTCYGQMMS 363
           V +I+ KN+FNFD+ KPSLNP   YPWSDKFVDEI R++ ACKVF+FYPIYW  YGQM++
Sbjct: 324 VTFIVCKNKFNFDSAKPSLNPEMQYPWSDKFVDEINRSIKACKVFIFYPIYWCVYGQMIN 383

Query: 364 GFVTQGSMMELHGLPNDFFQCIDSIAIIVFIPVCEHLLYPFIRKYTPFRPITKIYFGFMF 423
            F+TQ   MELH +PNDF Q  DSI IIVFIP+ E  +YP IR++TP +PITKI+ GFM 
Sbjct: 384 NFITQAGTMELHNIPNDFLQVFDSIGIIVFIPIFERFVYPTIRRFTPLKPITKIFLGFMC 443

Query: 424 ASGCMIWAAVLQSYIYKAGPHYKWPLE-----HDGPNRIHVALQVPAYVLLAFSEIFASI 478
            S  M+WAAVLQS+IYKAGP Y  P+       + PNR+HVA Q+PAYV++A+SEIFAS+
Sbjct: 444 GSCAMVWAAVLQSFIYKAGPCYDHPMACGPEYTNIPNRVHVAWQIPAYVIIAWSEIFASV 503

Query: 479 TGLEYAYSKAPASMKSFIMSIFLVTNAFGSAIGCALSPVSKDPDWTWLYTGLAVACFISG 538
           TGLE+AYS AP SMK+FIMSIFL TNA G+A+G A+SP S DP +TW++TGLAV+CF++G
Sbjct: 504 TGLEFAYSNAPDSMKAFIMSIFLFTNAIGAALGVAISPTSVDPKYTWVFTGLAVSCFVAG 563

Query: 539 CLFWVCFRKYNDIEEEMNAMDYEVD 563
           CLFW+CF  YNDI+ +M A+D+  D
Sbjct: 564 CLFWICFHHYNDIDADMKAIDFVED 588

>NDAI0E05020 Chr5 (1146336..1148195) [1860 bp, 619 aa] {ON}
           Anc_5.698
          Length = 619

 Score =  797 bits (2059), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/561 (67%), Positives = 453/561 (80%), Gaps = 5/561 (0%)

Query: 24  TKENSHTIE--EDSRIVDDLASQYEDD-IPEGYEVPTEEELRTLKHVGGHIPMRCWLIAV 80
           T+E  H +E    S   +D  + ++DD + EGYE PT+EEL TLK VGG IP+RCWLI V
Sbjct: 40  TEEKLHDVETYNLSNSANDSTNDFDDDEMEEGYEEPTDEELNTLKRVGGKIPLRCWLIGV 99

Query: 81  VELSERFSYYGLSAPFQNYMANGPHDKPPGLLQLNSDGATGLSYFFQFWCYVTPIFGGYM 140
           VEL+ERFSYYGLSAPFQNYM NGP+D P G+L LNS GATGLSYFFQFWCYVTP+FGG++
Sbjct: 100 VELAERFSYYGLSAPFQNYMQNGPNDSPKGVLMLNSSGATGLSYFFQFWCYVTPVFGGFV 159

Query: 141 ADTHWGKYNTIAVGTGIYICGIFILFMTSIPSITTKNAGLGGFIVAIILIGIATGMIKSN 200
           ADT+WGKYN+I+VGTG YI GIFILF+T+IPSI ++NA LGGFIV+IILIGI TG IK+N
Sbjct: 160 ADTYWGKYNSISVGTGFYIVGIFILFITAIPSIASQNASLGGFIVSIILIGIGTGFIKAN 219

Query: 201 LSVLIADQLPKRKPLVKTKKNGERVIEDTNLTLQNVFMFFYLMINIGSLSVIATSELELH 260
           LSVLIADQLPKRKP VK  K+GERVIED N+TLQNVFM FYLMINIGS+SV+AT+ELE H
Sbjct: 220 LSVLIADQLPKRKPRVKILKSGERVIEDPNITLQNVFMVFYLMINIGSMSVMATTELESH 279

Query: 261 RGFWAAYLLPFCFFWIAVVVLVLGKNQYVKPPIGDKVISKCFKVLWILTKNRFNFDAPKP 320
           +GFWAAYLLPFCFFWIAVV+LV G+  YVK  +GD V+ K FKV WI+ KN+ +++A KP
Sbjct: 280 KGFWAAYLLPFCFFWIAVVILVFGRKYYVKEKMGDNVVQKSFKVCWIVAKNKLDYNAAKP 339

Query: 321 SLNPTKNYPWSDKFVDEIQRALGACKVFLFYPIYWTCYGQMMSGFVTQGSMMELHGLPND 380
           S +P +NYPW+D+FVDE++R + ACKVF+FYPIYW  YG M+S FVTQGS MELHG+PND
Sbjct: 340 SYHPERNYPWNDRFVDEMKRTIAACKVFVFYPIYWVQYGSMISTFVTQGSTMELHGIPND 399

Query: 381 FFQCIDSIAIIVFIPVCEHLLYPFIRKYTPFRPITKIYFGFMFASGC-MIWAAVLQSYIY 439
           F Q  DSIA+I+FIP+ E+ +YPFIR++TP RPITKI  GF F  GC M WAAVLQ +IY
Sbjct: 400 FLQVFDSIALIIFIPIFENFVYPFIRRFTPIRPITKITIGF-FVGGCAMTWAAVLQHFIY 458

Query: 440 KAGPHYKWPLEHDGPNRIHVALQVPAYVLLAFSEIFASITGLEYAYSKAPASMKSFIMSI 499
             GP Y  PL  D PN+IHVA Q+PAYVL+AFSEIFASITGLEYAYSKAP SMKSF+MSI
Sbjct: 459 NTGPCYDHPLSCDTPNKIHVAWQIPAYVLIAFSEIFASITGLEYAYSKAPPSMKSFVMSI 518

Query: 500 FLVTNAFGSAIGCALSPVSKDPDWTWLYTGLAVACFISGCLFWVCFRKYNDIEEEMNAMD 559
           FL+TNAFGS +G ALS V+ DP + WL+ GLAV+C ++G LFW+CFR  N  EEEMNAMD
Sbjct: 519 FLLTNAFGSILGIALSSVTVDPKFVWLFGGLAVSCGVTGILFWLCFRGLNATEEEMNAMD 578

Query: 560 YEVDATMLKKVPIETDTVALE 580
           Y+ +     K  + +    LE
Sbjct: 579 YDAEIDEQSKRHLSSGADDLE 599

>SAKL0E14828g Chr5 (1226652..1228430) [1779 bp, 592 aa] {ON} similar
           to uniprot|P32901 Saccharomyces cerevisiae YKR093W PTR2
           Functions in transport of small peptides into the cell
           Peptide transporter
          Length = 592

 Score =  789 bits (2038), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/581 (65%), Positives = 470/581 (80%), Gaps = 9/581 (1%)

Query: 18  KNDLVLTKENSHTIEEDSR---IVDDL-ASQYEDDIPEGYEVPTEEELRTLKHVGGHIPM 73
           + ++V+T    +++E+ +R    VD L  +QY +   +    PT+EE++TL+HV   IP+
Sbjct: 12  ETEVVVTSSPENSVEKIARPESFVDVLDKNQYINADSDHGREPTDEEMKTLRHVSEQIPV 71

Query: 74  RCWLIAVVELSERFSYYGLSAPFQNYMANGPHDKPPGLLQLNSDGATGLSYFFQFWCYVT 133
           RCWL+AVVEL+ERFSYYGLSAPFQNYM NGP+D P G+L L + GAT LSYFFQFWCYV+
Sbjct: 72  RCWLVAVVELAERFSYYGLSAPFQNYMQNGPNDTPKGILNLKNQGATALSYFFQFWCYVS 131

Query: 134 PIFGGYMADTHWGKYNTIAVGTGIYICGIFILFMTSIPSITTKNAGLGGFIVAIILIGIA 193
           P+ GG++ADT+WGKY TI VGTGIY+ GIFILF+TS+PSIT  +A LGGFI ++ILIG+A
Sbjct: 132 PLLGGFVADTYWGKYKTICVGTGIYVVGIFILFITSVPSITYYSASLGGFITSLILIGLA 191

Query: 194 TGMIKSNLSVLIADQLPKRKPLVKTKKNGERVIEDTNLTLQNVFMFFYLMINIGSLSVIA 253
           TGMIK+N+SVLIADQ+PK +P VK  K+GERVIED N+T+QN+FMFFYLMINIGSLSVIA
Sbjct: 192 TGMIKANISVLIADQIPKSRPTVKVLKSGERVIEDPNITVQNIFMFFYLMINIGSLSVIA 251

Query: 254 TSELELHRGFWAAYLLPFCFFWIAVVVLVLGKNQYVKPPIGDKVISKCFKVLWILTKNRF 313
           T+E+E H GFWAAYLLPFCFF++AV VL+LG+NQYVK P+GDKVISK FKV WI+ +N+F
Sbjct: 252 TTEMEAHIGFWAAYLLPFCFFFVAVFVLILGRNQYVKLPVGDKVISKSFKVCWIVMRNKF 311

Query: 314 NFDAPKPSLNPTKNYPWSDKFVDEIQRALGACKVFLFYPIYWTCYGQMMSGFVTQGSMME 373
            FDA +PSLNP   YPWSDKF+DEI+RA+ ACKVF+FYPIYW CYGQM+S FV+Q  MME
Sbjct: 312 RFDAARPSLNPELGYPWSDKFIDEIKRAIAACKVFVFYPIYWVCYGQMLSNFVSQAGMME 371

Query: 374 LHGLPNDFFQCIDSIAIIVFIPVCEHLLYPFIRKYTPFRPITKIYFGFMFASGCMIWAAV 433
           LHGLPNDF Q IDSIA+IVFIP+CE  LYPFIR++TPFRPITKI++GF+F +  M WAAV
Sbjct: 372 LHGLPNDFLQAIDSIALIVFIPICERFLYPFIRRFTPFRPITKIFYGFIFGALAMAWAAV 431

Query: 434 LQSYIYKAGPHYKWPLE-----HDGPNRIHVALQVPAYVLLAFSEIFASITGLEYAYSKA 488
           LQ +IYKAGP Y +P+       + PNRIH+A QVPAYVL+AFSEIFASITGLEYAYSKA
Sbjct: 432 LQHFIYKAGPCYYYPMACAPEYKNTPNRIHIAWQVPAYVLIAFSEIFASITGLEYAYSKA 491

Query: 489 PASMKSFIMSIFLVTNAFGSAIGCALSPVSKDPDWTWLYTGLAVACFISGCLFWVCFRKY 548
           P SM+SFIMSIFL+T AFGSA+G ALS VS +P + W ++GLAV+CFI+GCLFW  F KY
Sbjct: 492 PVSMRSFIMSIFLLTTAFGSALGIALSSVSVNPKFVWTFSGLAVSCFIAGCLFWAFFHKY 551

Query: 549 NDIEEEMNAMDYEVDATMLKKVPIETDTVALEKGSSESVVS 589
           ND EE MNA+DYE D  +   V I  D   +   +S+  ++
Sbjct: 552 NDTEEAMNAIDYEEDDVLNYGVSIHYDLEPIASVNSDKRIT 592

>TBLA0E01140 Chr5 complement(250628..252463) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  770 bits (1989), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/588 (63%), Positives = 457/588 (77%), Gaps = 6/588 (1%)

Query: 7   NTFSEDDSLDKKNDLVLTKEN----SHTIEEDSRIVDDLASQYEDDIPEGYEVPTEEELR 62
           N     D+ D KN   +T++     + TI E +   ++     +DD  E +  PTEEE+R
Sbjct: 18  NNILMSDNKDDKNYNFITEDEPNSIASTIIEGNSNEENYNRSTDDDDDEDFIEPTEEEMR 77

Query: 63  TLKHVGGHIPMRCWLIAVVELSERFSYYGLSAPFQNYMANGPHDKPPGLLQLNSDGATGL 122
           TLK VGG+IP RCWL+AV+ELSERFSYYGLSAPFQNYM NGP+D PPG L LN+ GATGL
Sbjct: 78  TLKRVGGYIPARCWLMAVIELSERFSYYGLSAPFQNYMQNGPYDTPPGALSLNTQGATGL 137

Query: 123 SYFFQFWCYVTPIFGGYMADTHWGKYNTIAVGTGIYICGIFILFMTSIPSITTKNAGLGG 182
           SYFFQFWCY+TPIFGGYMADT+WGKYNTI VG   YICGIFILFMTS+P +T+ +A +GG
Sbjct: 138 SYFFQFWCYITPIFGGYMADTYWGKYNTIWVGVISYICGIFILFMTSLPKLTSYSAAMGG 197

Query: 183 FIVAIILIGIATGMIKSNLSVLIADQLPKRKPLVKTKKNGERVIEDTNLTLQNVFMFFYL 242
           FIV+II+IG+ TGMIK+NLSV+IA+Q+PKRK  + T+K+G RVIED ++TLQNVFM FY 
Sbjct: 198 FIVSIIIIGLGTGMIKANLSVMIAEQVPKRKRRIITRKDGTRVIEDPDITLQNVFMAFYF 257

Query: 243 MINIGSLSVIATSELELHRGFWAAYLLPFCFFWIAVVVLVLGKNQYVKPPIGDKVISKCF 302
           MIN+GSLSV+AT+ELE  +GFWAAYLLPFCFFW+AVVVL++G  +++K PIGDK ISK F
Sbjct: 258 MINVGSLSVMATTELEARKGFWAAYLLPFCFFWVAVVVLMIGNKRFIKVPIGDKTISKSF 317

Query: 303 KVLWILTKNRFNFDAPKPSLNPTKNYPWSDKFVDEIQRALGACKVFLFYPIYWTCYGQMM 362
           KV+ IL KN+FN+++ KPS++P  NYPW+DKFV+EI+RA+ AC VF FYPIYW CYGQM+
Sbjct: 318 KVVGILIKNKFNYESAKPSIHPECNYPWTDKFVEEIRRAIKACNVFYFYPIYWVCYGQML 377

Query: 363 SGFVTQGSMMELHGLPNDFFQCIDSIAIIVFIPVCEHLLYPFIRKYTPFRPITKIYFGFM 422
           + FVTQG  MELH LPNDF Q IDSIA+IVFIP+CE L+YPF+R++TP RPITKI  GF 
Sbjct: 378 NNFVTQGGQMELHDLPNDFLQVIDSIALIVFIPICERLIYPFVRRFTPLRPITKITIGFF 437

Query: 423 FASGCMIWAAVLQSYIYKAGPHYKWPLE-HDGPNRIHVALQVPAYVLLAFSEIFASITGL 481
           F S  M+WAAVLQ ++Y+  P Y  P    +GPN IHV  QVPAY L+A SEIFASITGL
Sbjct: 438 FGSFSMVWAAVLQWFVYQKPPCYYHPTNCPNGPNHIHVCWQVPAYCLIALSEIFASITGL 497

Query: 482 EYAYSKAPASMKSFIMSIFLVTNAFGSAIGCALSPVSKDPDWTWLYTGLAVACFISGCLF 541
           EYAYSKAPASMKSFIMSIFL T A GSA+G ALSPVS DP +TW Y GLAV+CFI+G  F
Sbjct: 498 EYAYSKAPASMKSFIMSIFLFTTAIGSALGAALSPVSIDPKFTWQYVGLAVSCFIAGIAF 557

Query: 542 WVCFRKYNDIEEEMNAMDYEVDATMLKKVPIETDTVALEKGSSESVVS 589
           W+CF +YND E+E+N +D + D   +     E D +  +      V+S
Sbjct: 558 WLCFSRYNDEEDELNNIDDQPDVIQISSEN-ENDDLEAKNSIRSRVIS 604

>TBLA0B04710 Chr2 (1104183..1106030) [1848 bp, 615 aa] {ON} 
          Length = 615

 Score =  756 bits (1953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/559 (67%), Positives = 450/559 (80%), Gaps = 3/559 (0%)

Query: 7   NTFSEDDSLDKKNDLVLTKENSHTIEEDSRIVDDLASQYEDDIPEGYEVPTEEELRTLKH 66
           N+  ++ S++K +    + EN+ T    ++ + + +   + D  +  E PTEEEL+TL  
Sbjct: 19  NSIKKESSVEKNHIKFDSIENTSTTSTINKQLTNDSDYDDMDDGDDIE-PTEEELKTLPR 77

Query: 67  VGGHIPMRCWLIAVVELSERFSYYGLSAPFQNYMANGPHDKPPGLLQLNSDGATGLSYFF 126
             GHIP  CWL+A++EL+ERFSYYGLSAPFQNYM N P D PPG L LNS GATGLSYFF
Sbjct: 78  EAGHIPFNCWLLAIIELAERFSYYGLSAPFQNYMQNNPSDNPPGALSLNSTGATGLSYFF 137

Query: 127 QFWCYVTPIFGGYMADTHWGKYNTIAVGTGIYICGIFILFMTSIPSITTKNAGLGGFIVA 186
           QFWCYVTPIF G+MADT+WGK+NT+ +GT IYI GIFILF+TS+P+IT+ N  LGGFIVA
Sbjct: 138 QFWCYVTPIFAGFMADTYWGKFNTLCIGTIIYIIGIFILFITSLPAITSYNTALGGFIVA 197

Query: 187 IILIGIATGMIKSNLSVLIADQLPKRK-PLVKTKKNGERVIEDTNLTLQNVFMFFYLMIN 245
           IILIGIATGMIK+NLSV+IADQLPK+K  +V  KK+G+RVIED  LT+QNVFM FY MIN
Sbjct: 198 IILIGIATGMIKANLSVMIADQLPKKKLRVVTKKKSGKRVIEDPQLTIQNVFMAFYFMIN 257

Query: 246 IGSLSVIATSELELHRGFWAAYLLPFCFFWIAVVVLVLGKNQYVKPPIGDKVISKCFKVL 305
           +GSLSVIAT+ELELH GFWAAYLLPFCFFWIAV+VL  G  ++VK PIGD+VISKCF ++
Sbjct: 258 VGSLSVIATTELELHVGFWAAYLLPFCFFWIAVLVLAFGNRKFVKKPIGDRVISKCFTII 317

Query: 306 WILTKNRFNFDAPKPSLNPTKNYPWSDKFVDEIQRALGACKVFLFYPIYWTCYGQMMSGF 365
            IL KN FNF   KP+ NP KNYPWSDKFVDEIQR+L ACKVFLFYPIYW CYGQM++ F
Sbjct: 318 GILIKNNFNFQKAKPTYNPEKNYPWSDKFVDEIQRSLKACKVFLFYPIYWVCYGQMLNNF 377

Query: 366 VTQGSMMELHGLPNDFFQCIDSIAIIVFIPVCEHLLYPFIRKYTPFRPITKIYFGFMFAS 425
           VTQGS M+LHGLPNDFFQ I+SIA+IVFIP+ E  +YPFIRK+TP +PITK+  GF+F S
Sbjct: 378 VTQGSTMQLHGLPNDFFQAINSIALIVFIPIVEKFVYPFIRKFTPLKPITKVTIGFVFGS 437

Query: 426 GCMIWAAVLQSYIYKAGPHYKWPLE-HDGPNRIHVALQVPAYVLLAFSEIFASITGLEYA 484
             M+WAAVLQ +IY+AGP Y  P++  +GPN +HVA QVPAY L++ SEIFASITGLE A
Sbjct: 438 LAMVWAAVLQHFIYQAGPCYDHPVKCPNGPNHVHVAWQVPAYCLISLSEIFASITGLEIA 497

Query: 485 YSKAPASMKSFIMSIFLVTNAFGSAIGCALSPVSKDPDWTWLYTGLAVACFISGCLFWVC 544
           YSKAP SMKSFIMS+FLVTNAFG+AIGCALS VS+DP + WLYTGLAV CF +G  FW  
Sbjct: 498 YSKAPESMKSFIMSMFLVTNAFGAAIGCALSSVSEDPKYVWLYTGLAVTCFCAGIAFWFT 557

Query: 545 FRKYNDIEEEMNAMDYEVD 563
           F+ YND E+ MN +D+E D
Sbjct: 558 FKHYNDEEDAMNNIDFESD 576

>KLLA0E12915g Chr5 complement(1142167..1144131) [1965 bp, 654 aa]
           {ON} similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 654

 Score =  749 bits (1933), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/582 (62%), Positives = 440/582 (75%), Gaps = 10/582 (1%)

Query: 11  EDDSLDKKNDLVLTKENSHTIEEDSRIVDDLASQYEDDIP-EGYEVPTEEELRTLKHVGG 69
           +D+      D+ +     H    D   +D + +  EDD   E    PTEEEL TL+HV  
Sbjct: 53  KDEKFKNNTDIKVYISKDHHASSDK--IDFIGAVDEDDNQNENGREPTEEELSTLRHVSE 110

Query: 70  HIPMRCWLIAVVELSERFSYYGLSAPFQNYMANGPHDKPPGLLQLNSDGATGLSYFFQFW 129
            IP  CWLIA+VEL+ERFSYYGLSAPFQNYM NGP+D P G+LQL S GAT LSYFFQFW
Sbjct: 111 RIPFTCWLIAIVELAERFSYYGLSAPFQNYMQNGPNDTPKGVLQLKSQGATALSYFFQFW 170

Query: 130 CYVTPIFGGYMADTHWGKYNTIAVGTGIYICGIFILFMTSIPSITTKNAGLGGFIVAIIL 189
           CYVTP+ GGY+ADT WGKYNTI VG   Y+ GI ILFMT+IPSI  KN+ LGGFIV++I+
Sbjct: 171 CYVTPLLGGYLADTFWGKYNTICVGASFYVVGILILFMTAIPSINDKNSSLGGFIVSLII 230

Query: 190 IGIATGMIKSNLSVLIADQLPKRKPLVKTKKNGERVIEDTNLTLQNVFMFFYLMINIGSL 249
           IGI TG IK+NLSVLIADQ+PK +P +K  KNGE+VIED N+T+QNVFMFFYLMINIGSL
Sbjct: 231 IGIGTGFIKANLSVLIADQIPKTRPRIKVLKNGEKVIEDPNVTMQNVFMFFYLMINIGSL 290

Query: 250 SVIATSELELHRGFWAAYLLPFCFFWIAVVVLVLGKNQYVKPPIGDKVISKCFKVLWILT 309
           SV+AT+ LE   GFWAAYLL FCFFW+ +VVLV G+ +YV+ PIGD VI++CFK+ WI  
Sbjct: 291 SVMATTHLEASYGFWAAYLLTFCFFWVGIVVLVFGRKKYVRRPIGDHVIARCFKICWIGL 350

Query: 310 KNRFNFDAPKPSLNPTKNYPWSDKFVDEIQRALGACKVFLFYPIYWTCYGQMMSGFVTQG 369
            N FN +   PSLNP K YPW+D F+DEI+RA  ACKVF FYPIYW  YGQM++ FVTQ 
Sbjct: 351 CNGFNLNRAVPSLNPEKEYPWNDLFIDEIRRAFKACKVFAFYPIYWVVYGQMLNNFVTQA 410

Query: 370 SMMELHGLPNDFFQCIDSIAIIVFIPVCEHLLYPFIRKYTPFRPITKIYFGFMFASGCMI 429
             MELHGLPNDF Q I+SIA+IVFIP+ E  +YPFIR++TPFRP+TKI+ GF F S  M+
Sbjct: 411 GTMELHGLPNDFLQAINSIALIVFIPIMEQFIYPFIRRFTPFRPVTKIFIGFCFGSSAMV 470

Query: 430 WAAVLQSYIYKAGPHYKWPLE-----HDGPNRIHVALQVPAYVLLAFSEIFASITGLEYA 484
           +AAVLQ +IYKAGP Y +P+       + PNR+H+  QVPAYVL++ SEIFASITGLEYA
Sbjct: 471 YAAVLQHFIYKAGPCYDFPMSCAPEYANTPNRVHIGWQVPAYVLISLSEIFASITGLEYA 530

Query: 485 YSKAPASMKSFIMSIFLVTNAFGSAIGCALSPVSKDPDWTWLYTGLAVACFISGCLFWVC 544
           YSKAPA+MK+FIMSIFLVTNA GSA+G ALSP +++P + W ++GLAVACFI+GCLFW+C
Sbjct: 531 YSKAPATMKAFIMSIFLVTNAVGSALGIALSPTAENPKYVWTFSGLAVACFIAGCLFWLC 590

Query: 545 FRKYNDIEEEMNAMDY--EVDATMLKKVPIETDTVALEKGSS 584
           F  YN  EE +NA+DY  E    ML  V +  +  AL   SS
Sbjct: 591 FHHYNKDEEALNALDYKTEEQEQMLSGVGVTGEGAALYSVSS 632

>Skud_11.331 Chr11 (597847..599046) [1200 bp, 399 aa] {ON} YKR093W
           (REAL)
          Length = 399

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/366 (76%), Positives = 324/366 (88%)

Query: 196 MIKSNLSVLIADQLPKRKPLVKTKKNGERVIEDTNLTLQNVFMFFYLMINIGSLSVIATS 255
           MIK+NLSVLIADQLPKRKP +K  K+GERV+ D N+TLQNVFMFFY MIN+GSLS++AT+
Sbjct: 1   MIKANLSVLIADQLPKRKPSIKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATT 60

Query: 256 ELELHRGFWAAYLLPFCFFWIAVVVLVLGKNQYVKPPIGDKVISKCFKVLWILTKNRFNF 315
           ELE H+GFWAAYLLPFCFFWIAVV L+LGK QY++ PIGDKVI+K F+V WIL KN+F+F
Sbjct: 61  ELEYHKGFWAAYLLPFCFFWIAVVTLILGKKQYIQRPIGDKVIAKSFRVCWILAKNKFDF 120

Query: 316 DAPKPSLNPTKNYPWSDKFVDEIQRALGACKVFLFYPIYWTCYGQMMSGFVTQGSMMELH 375
           +A KPS++P ++YPW+DKFVDEI+RAL ACKVF+FYPIYWT YG M+S F+TQ SMMELH
Sbjct: 121 NAAKPSIHPERDYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELH 180

Query: 376 GLPNDFFQCIDSIAIIVFIPVCEHLLYPFIRKYTPFRPITKIYFGFMFASGCMIWAAVLQ 435
           G+PNDF Q  DSIA+I+FIP+ E  +YPFIR+YTPF+PITKI+FGFMF S  M WAAVLQ
Sbjct: 181 GIPNDFLQAFDSIALIIFIPIFEKFIYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQ 240

Query: 436 SYIYKAGPHYKWPLEHDGPNRIHVALQVPAYVLLAFSEIFASITGLEYAYSKAPASMKSF 495
           S+IYKAGP Y  PL H+ PNR+HV  Q+PAYVL++FSEIFASITGLEYAYSKAPASMKSF
Sbjct: 241 SFIYKAGPWYDEPLGHNTPNRVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSF 300

Query: 496 IMSIFLVTNAFGSAIGCALSPVSKDPDWTWLYTGLAVACFISGCLFWVCFRKYNDIEEEM 555
           IMSIFL+T AFGSAIGCALSPV+ DP +TWL+TGLAVACFISGCLFW CFRKYND EEEM
Sbjct: 301 IMSIFLLTTAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWFCFRKYNDTEEEM 360

Query: 556 NAMDYE 561
           NAMDYE
Sbjct: 361 NAMDYE 366

>Kwal_47.16930 s47 (176926..178761) [1836 bp, 611 aa] {ON} YKR093W
           (PTR2) - Peptide transporter [contig 219] FULL
          Length = 611

 Score =  247 bits (630), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 183/616 (29%), Positives = 288/616 (46%), Gaps = 55/616 (8%)

Query: 14  SLDKKNDLVLTKENSHTIEEDSRIVDDLASQYEDDIPEGYEVPTEEELRTLKHVGGHIPM 73
           S +KKN   + + + H+  ED    D+L +Q     PE    PTE E   L+ V GH   
Sbjct: 2   SSEKKNQYAVAEIDGHS--ED---FDELDTQ---TFPE----PTERERSELRRVLGHPKW 49

Query: 74  RCWLIAVVELSERFSYYGLSAPFQNYMAN-------------GPHDKPPGLLQLNSDGAT 120
             + I ++E SER SYYG      N++                  +   G L +    AT
Sbjct: 50  YVYFICLIEFSERASYYGTGDRLNNFIQKPLPAGGNGAGAPAPGSEATAGALGMGLQVAT 109

Query: 121 GLSYFFQFWCYVTPIFGGYMADTHWGKYNTIAVGTGIYICGIFILFMTSIPSITTK-NAG 179
            L+    F  Y  P+  GY+AD +WG+   + +G  + I    +  + S+P +    +A 
Sbjct: 110 ALNLLLTFLAYCFPLITGYVADRYWGRMRMLWIGVFVGIVSHVVFIIGSLPVVLGHGSAA 169

Query: 180 LGGFIVAIILIGIATGMIKSNLSVLIADQLPKRKPLVKTKKNGERVIEDTNLTLQNVFMF 239
           L   I+ II + IAT  +K  L   +  Q P    +VKT  +GERVI D + +LQ + M 
Sbjct: 170 LAPCIIGIITLAIATAFVKPILLPTLLSQYPHATDVVKTLPSGERVIIDRDASLQRMTMT 229

Query: 240 FYLMINIGSLSVIATSELELHRGFWAAYLLPFCFFWIA-VVVLVLGKNQYVKPPIGDKVI 298
           FY  IN+GS   +ATS      G+W A+L+P   F I   V+LVL +    +PP G  +I
Sbjct: 230 FYWSINVGSFLSVATSYSARDVGYWLAFLIPLALFMIMPAVLLVLRRYIKDEPPSGRSLI 289

Query: 299 SKCFKVL--------WILTKNRFNFDAPKPS-LNPTKNYPWS--------DKFVDEIQRA 341
           + C KVL        W   +    +D  KPS L       W         +  V + +  
Sbjct: 290 ADCLKVLKVCFERNWWSRYRAGTFWDYAKPSNLRSLGRQGWRKSKPGFYPESLVQDARVT 349

Query: 342 LGACKVFLFYPIYWTCYGQMMSGFVTQGSMMELHGLPNDFFQCIDSIAIIVFIPVCEHLL 401
           + AC +FL+Y IY    G + S   +Q + +   G+PND     + + IIVF+P+ + ++
Sbjct: 350 ISACTIFLYYVIYNINDGGIGSIMNSQTASLTSKGVPNDLMSNFNPLCIIVFMPILDRVV 409

Query: 402 YPFIRKYT-PFRPITKIYFGFMFASGCMIWAAVLQSYIYKAGPHYKWPLE-HDGPNRIHV 459
           YP +RK    FRP+ +I+ GFM A+      A++Q  IY+  P   +  E   G + I +
Sbjct: 410 YPLLRKLRWNFRPVFRIFAGFMVAALASAVGAIIQHAIYQTSPCGNYATECEKGVSPISM 469

Query: 460 ALQVPAYVLLAFSEIFASITGLEYAYSKAPASMKSFIMSIFLVTNAFGSAIGCALSPVSK 519
            +    Y L  FSE  A  TG E A+ ++P  MK+F+M++FL  +A  +A+G  ++P   
Sbjct: 470 WVVAIEYALTGFSECLAMTTGYEIAFERSPPHMKTFVMALFLFMSALSAALGEIVTPSLV 529

Query: 520 DPDWTWLYTGLA-VACFISGCLFWVCFRKYNDIEEEMNAMDYEVDATMLKKVP----IET 574
           DP     +  LA +   ++    W    +Y ++   M     E +A   ++ P    I +
Sbjct: 530 DPHLVIPFGVLAGLGAAVAFAFLW----RYWNLHHVMEQERIEREALAKQEEPALNTIRS 585

Query: 575 DTVALEKGSSESVVSL 590
                + G  E V+S+
Sbjct: 586 YISGADLGDEEHVLSV 601

>KLTH0D16544g Chr4 complement(1366262..1368142) [1881 bp, 626 aa]
           {ON} similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 626

 Score =  241 bits (614), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 168/564 (29%), Positives = 265/564 (46%), Gaps = 43/564 (7%)

Query: 40  DLASQYEDDIPEGYEVPTEEELRTLKHVGGHIPMRCWLIAVVELSERFSYYGLSAPFQNY 99
           D  S+     P     PTE E  TL+ V  H     + I ++E SER SYYG      N+
Sbjct: 21  DTYSEGGSGTPLSLPEPTEHERTTLRRVLEHPKWYVYFICLIEFSERASYYGTGDRLNNF 80

Query: 100 MAN----------------GPHDKPPGLLQLNSDGATGLSYFFQFWCYVTPIFGGYMADT 143
           +                         G L +    AT L+    F  Y  P+  GY+AD 
Sbjct: 81  IQQPLPAGGNGAGAPAHGAAGDSATAGALGMGLQTATALNLLLTFLAYCFPLVTGYIADR 140

Query: 144 HWGKYNTIAVGTGIYICGIFILFMTSIPSIT-TKNAGLGGFIVAIILIGIATGMIKSNLS 202
           +W +   + +G  + I    I  + ++P +     A L   ++ II + IAT  +K  L 
Sbjct: 141 YWSRMRMLWIGVFVGIISHVIFIIGALPPVLGNGQAALAPCVIGIITLAIATSFVKPVLL 200

Query: 203 VLIADQLPKRKPLVKTKKNGERVIEDTNLTLQNVFMFFYLMINIGSLSVIATSELELHRG 262
             +  Q P    +V+T  +GERV+ D + +LQ + M FY  INIGS   +ATS      G
Sbjct: 201 PTLLSQYPHETDVVRTLASGERVLVDRDASLQRMTMTFYWSINIGSFLSVATSYAARDIG 260

Query: 263 FWAAYLLPFCFFWIA-VVVLVLGKNQYVKPPIGDKVISKCFKVL--------WILTKNRF 313
           +W A+L+P   + I   V+LVLG+    +PP G  +++ C KVL        W   ++  
Sbjct: 261 YWLAFLIPLILYLIMPAVLLVLGRYLRDEPPSGRSMLADCCKVLRVCFERGWWRRYRSGD 320

Query: 314 NFDAPKPS-LNPTKNYPWSDK---------FVDEIQRALGACKVFLFYPIYWTCYGQMMS 363
            ++  +PS L       W  K          V + +  L A  +FL+Y IY    G + S
Sbjct: 321 FWNYARPSRLRQAGRAGWRRKGAGGFYAESLVQDTRVTLSASAIFLYYVIYNINDGGIGS 380

Query: 364 GFVTQGSMMELHGLPNDFFQCIDSIAIIVFIPVCEHLLYPFIRKYT-PFRPITKIYFGFM 422
              +Q + +  +G+PND     + + IIVF+PV +H+LYP +RK    F+P+ +I+ GFM
Sbjct: 381 IMNSQTASLTSNGVPNDLISNFNPLCIIVFMPVLDHVLYPVLRKMRWNFKPVYRIFCGFM 440

Query: 423 FASGCMIWAAVLQSYIYKAGPHYKWPLEHD-GPNRIHVALQVPAYVLLAFSEIFASITGL 481
            A+      A++Q+ IY   P  ++  E D G + + + +    Y L   SE  A  TG 
Sbjct: 441 IAALASAVGAIIQTVIYNTSPCGRYATECDKGVSPVSMWVVAVEYALTGLSECLAMTTGY 500

Query: 482 EYAYSKAPASMKSFIMSIFLVTNAFGSAIGCALSPVSKDPDWTWLYTGLA-VACFISGCL 540
           E A+ ++PA MKSF+M++FL T+A  +A+G  ++P   DP     +  LA +  F++   
Sbjct: 501 EIAFERSPAHMKSFVMALFLFTSALSAALGEIVTPSLVDPHLVIPFGVLAGLGAFMAFVF 560

Query: 541 FWVCFRKYNDIEEEMNAMDYEVDA 564
            W    +Y  +++ M     E  A
Sbjct: 561 LW----RYWSLDKTMELERAERRA 580

>Ecym_2823 Chr2 (1599716..1601557) [1842 bp, 613 aa] {ON} similar to
           Ashbya gossypii AGL365C
          Length = 613

 Score =  224 bits (570), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 176/603 (29%), Positives = 282/603 (46%), Gaps = 50/603 (8%)

Query: 24  TKENSHTIEEDSRIVDDLASQYEDDIPEGYEVPTEEELRTLKHVGGHIPMRCWLIAVVEL 83
           +  N+ T++E  + V +       DI  G  +PTEEE RTL+ +  H     +LI  +EL
Sbjct: 19  SGSNAATVQEAPQEVKE-----RSDIEIG--LPTEEEERTLRRIVVHPSWYVYLICFIEL 71

Query: 84  SERFSYYGLSAPFQNYM-------ANGP------HDKPPGLLQLNSDGATGLSYFFQFWC 130
           +ER SYYG      NY         NG        +   G L      AT L    +F  
Sbjct: 72  AERASYYGTGDRLNNYYTYPLPEGGNGAGATAHGSEANSGALGKGLATATSLGLLLKFTS 131

Query: 131 YVTPIFGGYMADTHWGKYNTIAVGTGIYICGIFILFMTSIPSITTK-NAGLGGFIVAIIL 189
           Y  P+  GY+ D + G   T+  G    +    I  ++++P +    +A +   ++ +I 
Sbjct: 132 YFFPLVTGYLCDMYMGHVRTLWYGIWTGVASHIIFILSALPVVLKHPDAAMALSLIGLIT 191

Query: 190 IGIATGMIKSNLSVLIADQLPKRKPLVKTKKNGERVIEDTNLTLQNVFMFFYLMINIGSL 249
           + + T  +K  L  L+  Q P    +VKT + GERVI D + +LQ + M FY  INIG+ 
Sbjct: 192 LSVCTAFVKPVLLPLLLQQYPHETNVVKTLETGERVIIDRDASLQRMTMTFYWAINIGAF 251

Query: 250 SVIATSELELHRGFWAAYLLPFCFFWIAVVVLVLGKNQYV-KPPIGDKVISKCFKVLWIL 308
             +ATS      GFW A+L+P   +    VV  L +     + P G  +++ C KVL++ 
Sbjct: 252 MSLATSYAAKEVGFWLAFLIPLIIYMAMPVVFSLVQPHIKDRAPSGYSLLADCMKVLYVA 311

Query: 309 TKNRFN--------FDAPKPS-------LNPTKNYP-WSDKFVDEIQRALGACKVFLFYP 352
               +N        +D   PS       +   K  P + +  V + +  L AC +F +Y 
Sbjct: 312 FGKGWNARRKEGVFWDYALPSNQRQMGKVGWRKKSPFYKESLVQDTKITLSACFIFCYYI 371

Query: 353 IYWTCYGQMMSGFVTQGSMMELHGLPNDFFQCIDSIAIIVFIPVCEHLLYPFIRKYT-PF 411
           IY     Q+ +   +Q   M  +G+PND     + ++IIV IP+ ++ LYP +R+    F
Sbjct: 372 IYNMNDNQLTTIINSQTGSMTKNGVPNDVISNFNPLSIIVLIPILDYGLYPLLRRLRINF 431

Query: 412 RPITKIYFGFMFASGCMIWAAVLQSYIYKA---GPHYKWPLEHD-GPNRIHVALQVPAYV 467
           +P+ +I+ GFM A    +  A++Q  IY+    G H     E   G + +   +    Y 
Sbjct: 432 KPVYRIFTGFMLAVASSVAGALIQWRIYETSSCGYHATTCSEKGLGVSPLSSWIVAVEYT 491

Query: 468 LLAFSEIFASITGLEYAYSKAPASMKSFIMSIFLVTNAFGSAIGCALSPVSKDPDWTWLY 527
           L   SE  A  T  E AY ++P  MKSF++++FL T+A  +AI   ++P+ KDP     +
Sbjct: 492 LSGASECLAMTTAYEIAYDRSPEHMKSFVLALFLFTSAVSAAITQIVNPILKDPLLIVPF 551

Query: 528 TGLAVACFISGCLF-WVCFRKYNDIEEEMNAMDYEVDATMLKKVPIETDTVALE--KGSS 584
              A   FISGC F W    K+ ++++EM     E +         E + V ++  KGS 
Sbjct: 552 ALFAGIGFISGCHFLW----KFRNLDKEMLQEKRERELLQESSESDELEVVEIKDVKGSR 607

Query: 585 ESV 587
            ++
Sbjct: 608 SNI 610

>AGL365C Chr7 complement(13929..15728) [1800 bp, 599 aa] {ON}
           NOHBY725; No homolog in Saccharomyces cerevisiae
          Length = 599

 Score =  219 bits (558), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 157/538 (29%), Positives = 256/538 (47%), Gaps = 45/538 (8%)

Query: 62  RTLKHVGGHIPMRCWLIAVVELSERFSYYGLSAPFQNYM-----------ANGPHDKPPG 110
           + L+HV        ++I ++EL+ER SYYG      N+              GP D+ PG
Sbjct: 44  KRLRHVVAAPKWTVYMICLIELAERASYYGTGDRLYNFFQYPLPQGGNGAGAGPDDQNPG 103

Query: 111 LLQLNSDGATGLSYFFQFWCYVTPIFGGYMADTHWGKYNTIAVGTGIYICGIFILFMTSI 170
            L      AT L+   +F  Y  P+  GY+AD + G+   + +G    +    I  + ++
Sbjct: 104 ALGRGLQVATSLNLVLKFTSYFFPLVTGYVADMYVGELKMLWLGIWTGVVSHVIFVIAAL 163

Query: 171 PS-ITTKNAGLGGFIVAIILIGIATGMIKSNLSVLIADQLPKRKPLVKTKKNGERVIEDT 229
           P+ I   N  +   ++ ++ + + T  +K  L  ++  Q P    +VKT   GERVI + 
Sbjct: 164 PAVIKHNNLCMALAVLGLLTLSLCTAFVKPVLLPMLLRQYPHETNVVKTLPTGERVILNR 223

Query: 230 NLTLQNVFMFFYLMINIGSLSVIATSELELHRGFWAAYLLPFCFFWIAVVVLVLGKNQYV 289
           + +LQ + M FY  IN+GS   +AT       G+W ++L+P   F I   +L+  KN  V
Sbjct: 224 DASLQRMSMTFYWCINVGSFVSLATGYSAQRVGYWLSFLIPLVLFLIMPAILLTLKNVKV 283

Query: 290 KPPIGDKVISKCFKVL-------WILTKNRFNF-DAPKPS---------LNPTKNYPWSD 332
            PP+G+ + ++C KV+       W       +F    KPS            +K   + +
Sbjct: 284 TPPLGESLFAECLKVIKVCFEPGWFKRYRSGSFWRYAKPSNLRALGRTGWRRSKEGFYKE 343

Query: 333 KFVDEIQRALGACKVFLFYPIYWTCYGQMMSGFVTQGSMMELHGLPNDFFQCIDSIAIIV 392
             V++ +  L AC +FL+Y IY     Q+ S    Q   M   G+PND     + +AII+
Sbjct: 344 SLVEDTRITLAACVIFLYYVIYNMNDNQLSSIINNQAGSMTGEGVPNDVISNFNPLAIII 403

Query: 393 FIPVCEHLLYPFIRKYT-PFRPITKIYFGFMFASGCMIWAAVLQSYIYKAGPHYKWP--- 448
            +P+ ++ L P +R+    F+P+ +I+FGFM A    +  A++Q+ IY   P  K     
Sbjct: 404 TMPIIDYGLNPLLRRLRINFKPVYRIFFGFMLAVLASVAGAIIQAAIYNTSPCGKHASTC 463

Query: 449 ---LEHDGP-NRIHVALQVPAYVLLAFSEIFASITGLEYAYSKAPASMKSFIMSIFLVTN 504
              +    P +R  V ++   YVL   SE FA  TG E A+ ++P  MK+F+MS+FLVT 
Sbjct: 464 SETIRQVSPLSRWLVGVE---YVLSGVSECFAMPTGYEIAFERSPKDMKAFVMSLFLVTT 520

Query: 505 AFGSAIGCALSPVSKDPDWTWLYTGLAVACFISGCLFWVCFR-KYNDIEEEMNAMDYE 561
           A  S +    + +  DP     +   AV     G LF + F  +Y ++++ M A   E
Sbjct: 521 ALSSILTQIFNGIMTDPYLVIPFILFAVL----GTLFAILFLYRYWNLDKVMEAERRE 574

>AFR228W Chr6 (850893..852623) [1731 bp, 576 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YKR093W (PTR2)
          Length = 576

 Score =  197 bits (501), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 155/564 (27%), Positives = 266/564 (47%), Gaps = 57/564 (10%)

Query: 38  VDDLASQYEDDIPEGYEVPTEEELRTLKHVGGHIPMRCWLIAVVELSERFSYYGLSAPFQ 97
           V DL  +      E  ++PTE E  TL+ +     +  + I ++E +ER S+YG      
Sbjct: 13  VQDLEKEKYITETETLQIPTEHEELTLRRIVTSPKIHLYFICLIEFAERGSFYGTGNRMG 72

Query: 98  NY------------MANGPHDKPPGLLQLNSDGATGLSYFFQFWCYVTPIFGGYMADTHW 145
           N+             A GP ++ PG L      AT +    +F  Y   I  GY++D + 
Sbjct: 73  NFYQYPLPIGGNGAGAPGPGEQDPGALGKGLAVATAMGLLLKFTSYTFSIITGYISDVYI 132

Query: 146 GKYNTIAVGTGIYICGIFILFMTSIPSITTK-NAGLGGFIVAIILIGIATGMIKSNLSVL 204
           G+   + +G  + +    +  + ++PS+    N      +VA++ + + T  +K  L  L
Sbjct: 133 GQIKMLWIGVWLGVGSHILFIIAALPSVLAHTNVAYALSVVALLSLSLCTSFVKPVLLPL 192

Query: 205 IADQLPKRKPLVKTKKNGERVIEDTNLTLQNVFMFFYLMINIGSLSVIATSELELHRGFW 264
           +  Q P +  +VKT  +GERVI D + +LQ + M FY  IN+G+   +AT+      G+W
Sbjct: 193 LLQQYPYKTNIVKTLLSGERVIVDRDASLQRMTMVFYWAINVGAFLSLATAYSAQRVGYW 252

Query: 265 AAYLLPFCFFWIAVVVL-VLGKNQYVKPPIGDKVISKCFKVL-----WILTKNRFN---F 315
            A+ +P   + +  +VL  L ++     P  + V+++  KVL     W   K  ++   +
Sbjct: 253 LAFTVPLIIYLLMPIVLWKLQEDIKTNEPSRESVLAESLKVLKVCYEWGWIKRYWSGQFW 312

Query: 316 DAPKPS---------LNPTKNYPWSDKFVDEIQRALGACKVFLFYPIYWTCYGQMMSGFV 366
           D  KP+             K   + +K+V + +  + AC +FL+Y IY   +  +     
Sbjct: 313 DYAKPTNLIQQGRIGWRKKKAGFYDEKYVYDTKLTISACTIFLYYVIY-QMHSNLDEPMR 371

Query: 367 TQGSMMELHGLPNDFFQCIDSIAIIVFIPVCEHLLYPFIRKYT-PFRPITKIYFGFMFAS 425
           +Q   ME  G+PND F   + I+IIV +P+ +++LYP +R+Y   F+P+ +I+ GFM   
Sbjct: 372 SQAGSMEGEGVPNDLFSNFNPISIIVVMPILDYVLYPLLRRYRINFKPVYRIFCGFMIGC 431

Query: 426 GCMIWAAVLQSYIYKAGP-------------HYKWPLEHDGPNRIHVALQVPAYVLLAFS 472
                 A++Q  +Y   P             H K PL     +R  VA++   Y L   S
Sbjct: 432 LGSTVGAIIQWRVYNTSPCGYMGATTCPELHHKKSPL-----SRWLVAIE---YALGGTS 483

Query: 473 EIFASITGLEYAYSKAPASMKSFIMSIFLVTNAFGSAIGCALSPVSKDPDWTWLYTGLAV 532
           E  A  TG E A+ ++P  MK F++++F+ T A  SAI   ++P  KDP   +L    AV
Sbjct: 484 ECLAMTTGYEIAFERSPKKMKGFVLALFMFTVAISSAIILPITPFFKDP---YLIQPFAV 540

Query: 533 ACFISGCLFWVCFRKYNDIEEEMN 556
              +      +   +Y D++++M 
Sbjct: 541 CAGVGALTAIIFLWRYWDLDKQMK 564

>ADL156C Chr4 complement(416054..417505) [1452 bp, 483 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL119C
           (MCH4); Tandem gene duplication in this genome
          Length = 483

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 85/195 (43%), Gaps = 33/195 (16%)

Query: 31  IEEDSRIVDDLASQYEDDIPEGYEVPTEEELRTLKHVGGHIPMRCWLIAVVELSERFSYY 90
           + ++    + LA+  +       E+  EEE       GG+   R WL  +      F  +
Sbjct: 41  VADEDGAEEVLAADEKAATEATNELDVEEEYPD----GGY---RAWLTVLGSFVGIFPIW 93

Query: 91  GLS---APFQNYMANGPHDKPPGLLQLNSDGATGLSYFFQFW---CYVTPIFGGYMADTH 144
           G +     ++ Y++N  H       QL S GA  +S+ F      C+V  +F G   D +
Sbjct: 94  GTANALGAYEGYISN--H-------QLASSGAGEVSWIFALHMIACFVGCVFSGSYFDRN 144

Query: 145 WGKYNTIAVGTGIYICGIFILFMTSIPSITTKNAGLGGFIVAIIL-IGIATGMIKSNLSV 203
            G+   I VG+ +Y+ GIF++      S  TK   L  FI+A  L  G+  G++ + L  
Sbjct: 145 GGQ-KAIIVGSVLYVFGIFMM------SECTK---LWHFILAFSLSSGVGAGILTTPLIS 194

Query: 204 LIADQLPKRKPLVKT 218
            +A    +R+ +  +
Sbjct: 195 CVATWFHRRRAVATS 209

>KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}
           YOR378W
          Length = 565

 Score = 34.7 bits (78), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 1/52 (1%)

Query: 486 SKAPASMKSFIMSIFLVTNAFGSAIGCALSPV-SKDPDWTWLYTGLAVACFI 536
           S  P   K+FI S F    +FG  +G   S + ++   W+W Y  +A+AC +
Sbjct: 200 SYPPCKRKNFIFSFFGACGSFGVVLGMVFSALFTQLAHWSWAYWSMAIACVV 251

>SAKL0G07964g Chr7 complement(668256..671921) [3666 bp, 1221 aa]
           {ON} highly similar to uniprot|P52918 Saccharomyces
           cerevisiae YDR335W MSN5 Karyopherin involved in nuclear
           import and export shown to be responsible for nuclear
           import of replication protein A and for export of
           several proteins including Swi6p Far1p and Pho4p cargo
           dissociation involves binding to RanGTP
          Length = 1221

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 39/84 (46%), Gaps = 8/84 (9%)

Query: 477 SITGLEYAYSKAPASMKSFIMSIFLVTNAFG-SAIGCALSPVSKDPDWTWLYTGLAVACF 535
           S   L+YAY    A + S+  S      AFG   +        K+P  + L   + V CF
Sbjct: 460 SCVKLDYAYHWLNARLNSYFSS------AFGHEVLESRFLNHKKEPYLSALSQLMIVECF 513

Query: 536 ISGCLFW-VCFRKYNDIEEEMNAM 558
           I+GC+ W + +   ND  E+++ +
Sbjct: 514 INGCIRWKIWYTNENDYNEKLDVI 537

>KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W
          Length = 534

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 31/70 (44%), Gaps = 1/70 (1%)

Query: 489 PASMKSFIMSIFLVTNAFGSAIGCALSPV-SKDPDWTWLYTGLAVACFISGCLFWVCFRK 547
           P   K+++ S +     FG   G   S + ++   W W Y  +AV C I   L ++   K
Sbjct: 176 PCKRKNYVFSFYGACGPFGIVAGSVFSALFTQLTTWAWTYWSMAVTCLIITILSYIFIPK 235

Query: 548 YNDIEEEMNA 557
            N  + E +A
Sbjct: 236 DNTPKRERSA 245

>NDAI0C02460 Chr3 (563500..566217) [2718 bp, 905 aa] {ON} Anc_5.211
           YLL005C
          Length = 905

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 27/126 (21%), Positives = 54/126 (42%), Gaps = 20/126 (15%)

Query: 82  ELSERFS--YYGLSAPFQNYMANGPHDKPPGLLQLNSDGATGLSYFFQFWCYVTP-IFGG 138
           ++SE++   YY L    QN++ +  H  P   L+           F QF    T  +FG 
Sbjct: 421 KISEKWEKEYYQLETGHQNFITSNRHANPDAYLE---------KVFIQFDTVETAHVFGQ 471

Query: 139 YMADTHWGKYNTIAVG--------TGIYICGIFILFMTSIPSITTKNAGLGGFIVAIILI 190
            +   H  ++N + +G        + I     + +F+ S+ +       + G+I+ + LI
Sbjct: 472 LLLFQHHKEWNNVVIGPNPNDIRWSNITRTNSYAIFLRSVAANILSILTIIGWIIPVGLI 531

Query: 191 GIATGM 196
           G+ + +
Sbjct: 532 GLISQI 537

>CAGL0B01859g Chr2 (168976..170844) [1869 bp, 622 aa] {ON} weakly
           similar to uniprot|Q04601 Saccharomyces cerevisiae
           YDR118w APC4 subunit of the anaphase promoting complex
          Length = 622

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 24/46 (52%)

Query: 356 TCYGQMMSGFVTQGSMMELHGLPNDFFQCIDSIAIIVFIPVCEHLL 401
           T  G      + + ++ +   L N+F+     + IIVF+P+CE L+
Sbjct: 300 TKLGNWFKETINEKNLKKWSRLGNEFYSNFKQVLIIVFVPICERLM 345

>SAKL0A05676g Chr1 (515333..517174) [1842 bp, 613 aa] {ON} similar
           to uniprot|P53048 Saccharomyces cerevisiae YGR289C MAL11
           Maltose permease inducible high-affinity maltose
           transporter (alpha-glucoside transporter) encoded in the
           MAL1 complex locus member of the 12 transmembrane domain
           superfamily of sugar transporters
          Length = 613

 Score = 31.6 bits (70), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 460 ALQVPAYVLLAFSEIFASITGLEYAYSKAPASMKSFIMSIFLVTNAFGSAIGCALSPVSK 519
           AL    Y L AF++ F S       Y  + A      M IF+     G  IG  L+ V+ 
Sbjct: 113 ALLASLYALPAFAKKFGSFNAASGIYEISAAWQTGLSMCIFV-----GEIIGLQLAGVAA 167

Query: 520 DP---DWTWLYTGLAVACFI 536
           D     WT + + LA+ CFI
Sbjct: 168 DRVGYRWTLITSLLALFCFI 187

>KAFR0H03170 Chr8 complement(604252..604977) [726 bp, 241 aa] {ON}
           Anc_1.395 YNL010W
          Length = 241

 Score = 30.8 bits (68), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 1/56 (1%)

Query: 3   LRQVNTFSEDDSLDKKNDLVLTKENSHTIEED-SRIVDDLASQYEDDIPEGYEVPT 57
           ++ +   + D  LD  N + +T  +      D S+ +D+  + YE  +PEG E PT
Sbjct: 118 IKNLEIVANDVELDANNKMTVTYRDETPFGHDKSKSIDNFKAHYEAQLPEGAEKPT 173

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.140    0.445 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 64,765,335
Number of extensions: 2952246
Number of successful extensions: 10915
Number of sequences better than 10.0: 53
Number of HSP's gapped: 11159
Number of HSP's successfully gapped: 53
Length of query: 590
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 475
Effective length of database: 40,294,809
Effective search space: 19140034275
Effective search space used: 19140034275
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)