Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0C06560singletonON1961969851e-137
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0C06560
         (196 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0C06560 Chr3 complement(1272798..1273388) [591 bp, 196 aa] {...   384   e-137

>KNAG0C06560 Chr3 complement(1272798..1273388) [591 bp, 196 aa] {ON}
           
          Length = 196

 Score =  384 bits (985), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 187/196 (95%), Positives = 187/196 (95%)

Query: 1   MAPTTRLRKLNLVPCYIPKKLRYPKTGWGKSVRLNTSHFXXXXXXXXXHNHQRDATLSGC 60
           MAPTTRLRKLNLVPCYIPKKLRYPKTGWGKSVRLNTSHF         HNHQRDATLSGC
Sbjct: 1   MAPTTRLRKLNLVPCYIPKKLRYPKTGWGKSVRLNTSHFPPPKKTKKTHNHQRDATLSGC 60

Query: 61  TSVHFGVTPYRDKNSENSNKTRTVFPLETQSQLTNAQRGLRCREELVTQFLLLLFSYPER 120
           TSVHFGVTPYRDKNSENSNKTRTVFPLETQSQLTNAQRGLRCREELVTQFLLLLFSYPER
Sbjct: 61  TSVHFGVTPYRDKNSENSNKTRTVFPLETQSQLTNAQRGLRCREELVTQFLLLLFSYPER 120

Query: 121 ERVRKNNAVRRADLSRYLHCNPVSMQSRFLCQCCNGESPQRQSVRYCAGGCGRYRNRGTL 180
           ERVRKNNAVRRADLSRYLHCNPVSMQSRFLCQCCNGESPQRQSVRYCAGGCGRYRNRGTL
Sbjct: 121 ERVRKNNAVRRADLSRYLHCNPVSMQSRFLCQCCNGESPQRQSVRYCAGGCGRYRNRGTL 180

Query: 181 PLAYCQGRKEKNCDTL 196
           PLAYCQGRKEKNCDTL
Sbjct: 181 PLAYCQGRKEKNCDTL 196

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.135    0.428 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 19,396,626
Number of extensions: 698180
Number of successful extensions: 1297
Number of sequences better than 10.0: 1
Number of HSP's gapped: 1315
Number of HSP's successfully gapped: 1
Length of query: 196
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 92
Effective length of database: 41,556,135
Effective search space: 3823164420
Effective search space used: 3823164420
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 63 (28.9 bits)