Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0C058102.533ON55455421630.0
KAFR0A018602.533ON4901344016e-42
Smik_13.2492.533ON4731423962e-41
TDEL0A030702.533ON2391493759e-41
YMR070W (MOT3)2.533ON4901523892e-40
Skud_13.2262.533ON4751543856e-40
NCAS0F009002.533ON5251363842e-39
CAGL0K03003g2.533ON6471243777e-38
NDAI0H014002.533ON5411583684e-37
ZYRO0B02002g2.533ON2941193511e-36
Kpol_1018.332.533ON5891223624e-36
SAKL0A09482g2.533ON3881273473e-35
NCAS0A048002.533ON5111203524e-35
TBLA0G022302.533ON2161163264e-34
Suva_13.2462.533ON419743396e-34
NDAI0K018602.533ON7301383318e-32
TPHA0G035102.533ON3871333033e-29
Ecym_72552.533ON5441533083e-29
Kwal_26.80212.533ON5071193056e-29
KLLA0E18547g2.533ON4311243018e-29
AGL071C2.533ON3961192999e-29
KLTH0D06842g2.533ON5061262932e-27
TBLA0I014802.533ON513632739e-25
KAFR0J003402.533ON2181232385e-22
KNAG0A070402.533ON3521202271e-19
TPHA0C041902.533ON417531864e-14
NCAS0A129102.598ON822581546e-10
YKL062W (MSN4)2.598ON630931511e-09
NDAI0C005602.598ON972571521e-09
Kpol_185.32.598ON647571474e-09
Smik_11.1862.598ON641571465e-09
ZYRO0F01012g2.598ON584841456e-09
Skud_11.1672.598ON628571448e-09
Suva_13.2062.598ON709481431e-08
TPHA0C025802.598ON365491411e-08
Skud_13.1932.598ON704481422e-08
YMR037C (MSN2)2.598ON704481422e-08
TBLA0G019202.598ON523571412e-08
Suva_11.1642.598ON639561412e-08
CAGL0L06072g8.144ON300561382e-08
Smik_13.2072.598ON703481412e-08
TBLA0H028302.598ON746491412e-08
SAKL0B11330g2.598ON499571393e-08
KAFR0F020702.598ON370571374e-08
TPHA0N014602.598ON519571384e-08
CAGL0F05995g2.598ON597481375e-08
NCAS0H030802.598ON730571376e-08
Kwal_26.83512.598ON698571368e-08
KNAG0M023102.598ON660751369e-08
TDEL0B069102.598ON437571341e-07
Kpol_1013.212.598ON494571351e-07
KNAG0H005502.598ON620571351e-07
KLLA0F26961g2.598ON694601351e-07
KLTH0D08734g2.598ON677571351e-07
NDAI0B013402.598ON769491342e-07
ABR089C2.598ON571491322e-07
KAFR0A023202.598ON443491322e-07
KNAG0G012808.144ON472531303e-07
TBLA0G032403.298ON511591303e-07
CAGL0M13189g2.598ON541571304e-07
Ecym_23012.598ON767491304e-07
KAFR0F012106.256ON311631241e-06
SAKL0H24816g8.144ON410541251e-06
NCAS0B046008.144ON547481251e-06
ACL057W8.144ON520531242e-06
TPHA0B003804.351ON1310751252e-06
Ecym_84038.144ON573581233e-06
SAKL0F01980g3.518ON385561214e-06
KNAG0H011803.281ON254621185e-06
KLLA0B04477g4.351ON1332631225e-06
KLLA0C17072g8.144ON474481215e-06
NCAS0C040708.144ON289601195e-06
Suva_13.704.351ON777571215e-06
CAGL0K02145g8.144ON317481196e-06
NDAI0C06260na 1ON582611206e-06
KAFR0A067205.586ON235781166e-06
Smik_13.3876.256ON212831157e-06
KLTH0H08800g8.117ON168591138e-06
KLTH0E06688g8.144ON397481188e-06
Kpol_1031.428.144ON359541188e-06
ACR264W2.162ON769681199e-06
CAGL0M00594g4.351ON1020581199e-06
TPHA0D010508.144ON439481189e-06
KNAG0M003504.351ON1076631199e-06
KAFR0B063608.425ON6271531181e-05
Skud_13.3486.256ON216831141e-05
YMR182C (RGM1)6.256ON211781141e-05
AGR172W8.425ON1057611191e-05
TBLA0B061604.351ON1384611191e-05
Kpol_541.398.116ON291961161e-05
NDAI0G034208.144ON484541171e-05
Smik_5.2768.144ON442481171e-05
Suva_16.766.256ON392521161e-05
Skud_13.614.351ON1253611181e-05
Smik_13.584.351ON1253611181e-05
YPL230W (USV1)6.256ON391481161e-05
NCAS0A018204.80ON455951161e-05
KNAG0D021208.144ON402561162e-05
Kwal_26.80112.531ON190511122e-05
NDAI0D037504.80ON493561162e-05
Skud_5.2488.144ON442481162e-05
YML081W (TDA9)4.351ON1251611172e-05
ZYRO0G19140g8.144ON557481162e-05
Suva_5.2518.144ON449481162e-05
TDEL0F026904.80ON350561152e-05
NCAS0F009202.531ON354521152e-05
KAFR0B021608.144ON453531162e-05
Kwal_47.172418.144ON403481152e-05
TBLA0F038308.234ON967531162e-05
KLLA0F13046g8.425ON1379501162e-05
Smik_6.4356.256ON386481152e-05
YER130C8.144ON443481152e-05
ADL051Wna 2ON173791093e-05
NDAI0B019308.144ON436481143e-05
Skud_16.486.256ON398491143e-05
SAKL0H12958g8.425ON1129451153e-05
NDAI0D032404.351ON13621491153e-05
KNAG0E016003.518ON338571133e-05
KAFR0B025508.234ON890531143e-05
AGR117C8.234ON7991271143e-05
TBLA0H006608.425ON1311501154e-05
Kpol_1001.14.351ON1341451144e-05
KAFR0B068104.351ON1155541144e-05
TPHA0A019408.234ON9121011144e-05
Suva_8.625.586ON5451051134e-05
TDEL0B046708.144ON312481124e-05
SAKL0G18062g4.351ON1238591144e-05
Ecym_54242.162ON775681144e-05
TPHA0C021608.425ON1375501144e-05
TBLA0I032803.518ON330511115e-05
AER159C4.351ON1191641135e-05
KNAG0G018708.234ON875531135e-05
KAFR0C029808.144ON225481095e-05
NDAI0J028504.351ON1537541135e-05
Kpol_529.138.425ON1410451136e-05
CAGL0E04884g8.425ON1489501136e-05
TBLA0F003708.144ON687511126e-05
TDEL0A013008.234ON837711126e-05
ZYRO0A09416g8.425ON1346671136e-05
Kpol_1032.528.234ON824531126e-05
CAGL0A01628g4.80ON424581117e-05
NDAI0C048608.425ON1350561127e-05
NCAS0A062504.351ON1341591127e-05
Suva_7.2404.80ON515561117e-05
NCAS0G012706.256ON274581097e-05
Kpol_472.104.214ON830651127e-05
KLTH0D18062g4.351ON1128521127e-05
Kwal_47.166214.351ON1178511128e-05
CAGL0E06116g6.256ON613571118e-05
CAGL0L11880g8.234ON980581128e-05
Skud_4.3548.234ON916681118e-05
KAFR0F036004.80ON335561108e-05
ZYRO0B11770g8.234ON867531119e-05
Suva_13.3636.256ON211561069e-05
NCAS0B028408.425ON1152501111e-04
Ecym_35208.234ON8191121101e-04
KLLA0F10109g5.586ON6231251101e-04
Skud_5.3088.234ON8021101101e-04
KAFR0A008001.326ON753541101e-04
TBLA0E04210singletonON454501091e-04
KLTH0G01826g3.518ON307501081e-04
KNAG0B067104.351ON1053541101e-04
Smik_7.2514.80ON505561091e-04
KLLA0F20636gsingletonON285501071e-04
KNAG0B005903.518ON439931081e-04
CAGL0L05786g8.116ON348701081e-04
Suva_2.3838.425ON1319511091e-04
CAGL0M01870g3.298ON315831071e-04
TBLA0B060502.303ON762511091e-04
Kwal_47.190453.518ON266501062e-04
YDR216W (ADR1)8.425ON1323511092e-04
Skud_10.3514.351ON1327511092e-04
KAFR0E042704.351ON1255511092e-04
Smik_4.3378.234ON894531092e-04
YDR096W (GIS1)8.234ON894531092e-04
Smik_4.4638.425ON1324511092e-04
Kpol_1052.83.298ON386861072e-04
YER169W (RPH1)8.234ON796551082e-04
Kpol_1023.635.586ON556811082e-04
KLTH0H09196g4.80ON460831072e-04
YGL035C (MIG1)4.80ON504561072e-04
KLTH0G10802g2.303ON526971082e-04
Skud_4.4788.425ON1323511082e-04
Kpol_1026.84.80ON412561072e-04
CAGL0K12078g3.281ON463701072e-04
Suva_12.2184.351ON1270511082e-04
Suva_2.2558.234ON894531082e-04
TBLA0E047704.351ON1655501082e-04
YJR127C (RSF2)4.351ON1380511082e-04
CAGL0H04213g4.351ON1321471082e-04
Smik_10.4204.351ON1348511082e-04
YDR463W (STP1)5.586ON519751072e-04
Suva_5.3038.234ON797551072e-04
Smik_5.3418.234ON798581072e-04
KNAG0D037104.80ON459561062e-04
NDAI0B042902.162ON1064681073e-04
KNAG0I020702.162ON572501063e-04
Skud_7.2494.80ON502561063e-04
CAGL0E04312g5.586ON688651063e-04
NDAI0B022508.234ON1156531073e-04
SAKL0H20988g4.80ON548671063e-04
ZYRO0B14894g4.351ON1119511073e-04
NCAS0H028905.586ON532651063e-04
Smik_4.7425.586ON528651053e-04
TPHA0D034003.518ON338501044e-04
Skud_4.7395.586ON514651054e-04
TPHA0G008202.303ON532781054e-04
CAGL0L00583g6.256ON388881044e-04
TBLA0E028205.586ON312801044e-04
YGL209W (MIG2)3.518ON382661044e-04
KLLA0C16005g6.256ON331591044e-04
SAKL0E10714g2.162ON819531054e-04
TBLA0E042208.234ON519501054e-04
KNAG0B033505.586ON600651054e-04
KNAG0A044608.425ON1290571064e-04
TPHA0K017704.80ON518901054e-04
KAFR0C004903.281ON224511024e-04
TPHA0B029102.162ON717701054e-04
KNAG0F017106.256ON413691045e-04
TDEL0D006704.351ON1199541055e-04
Kpol_423.153.518ON392561045e-04
Kpol_1023.1004.351ON916541055e-04
TDEL0F055008.425ON1207501055e-04
TPHA0A04530singletonON501771046e-04
Kpol_1072.582.162ON794701046e-04
NDAI0I009906.256ON409471036e-04
SAKL0H17842g8.234ON814531046e-04
NCAS0F00910singletonON350521026e-04
KAFR0F041503.518ON416501036e-04
KLLA0F23782g2.162ON782671046e-04
KNAG0H030108.234ON784581046e-04
CAGL0K06413g5.586ON359921026e-04
SAKL0H20416g8.116ON3171041027e-04
TBLA0B012802.162ON823711047e-04
Kwal_56.234538.234ON828531047e-04
Ecym_4128na 3ON312531027e-04
KLTH0G14454g8.234ON832791037e-04
Suva_2.2003.281ON232491007e-04
KLLA0E08713g2.303ON596741037e-04
SAKL0E07216g2.303ON548681037e-04
KNAG0C060305.586ON314771027e-04
ZYRO0D13992g5.586ON587651038e-04
CAGL0G08107g8.234ON625881038e-04
Kpol_505.152.162ON510771029e-04
NDAI0A075403.298ON370501019e-04
Skud_8.555.586ON5351051029e-04
ZYRO0C13508g3.281ON18963989e-04
TPHA0A039103.298ON351521019e-04
TBLA0C048803.518ON339941010.001
KNAG0H034802.162ON796681020.001
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0C05810
         (554 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa] ...   837   0.0  
KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.5...   159   6e-42
Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 ...   157   2e-41
TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.53...   149   9e-41
YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}  MOT3Trans...   154   2e-40
Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)...   152   6e-40
NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {O...   152   2e-39
CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakl...   149   7e-38
NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {O...   146   4e-37
ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some si...   139   1e-36
Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {O...   144   4e-36
SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some s...   138   3e-35
NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {O...   140   4e-35
TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.53...   130   4e-34
Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070...   135   6e-34
NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {...   132   8e-32
TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.5...   121   3e-29
Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}...   123   3e-29
Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W...   122   6e-29
KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]...   120   8e-29
AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON} S...   119   9e-29
KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some s...   117   2e-27
TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.5...   109   9e-25
KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON}       96   5e-22
KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON} Anc_2...    92   1e-19
TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.5...    76   4e-14
NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa] ...    64   6e-10
YKL062W Chr11 (323228..325120) [1893 bp, 630 aa] {ON}  MSN4Trans...    63   1e-09
NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598     63   1e-09
Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON} co...    61   4e-09
Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062...    61   5e-09
ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar ...    60   6e-09
Skud_11.167 Chr11 (302970..304856) [1887 bp, 628 aa] {ON} YKL062...    60   8e-09
Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {...    60   1e-08
TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.5...    59   1e-08
Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {...    59   2e-08
YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON} ...    59   2e-08
TBLA0G01920 Chr7 complement(502783..504354) [1572 bp, 523 aa] {O...    59   2e-08
Suva_11.164 Chr11 (305916..307835) [1920 bp, 639 aa] {ON} YKL062...    59   2e-08
CAGL0L06072g Chr12 complement(681921..682823) [903 bp, 300 aa] {...    58   2e-08
Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {...    59   2e-08
TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {O...    59   2e-08
SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {...    58   3e-08
KAFR0F02070 Chr6 (409867..410979) [1113 bp, 370 aa] {ON} Anc_2.5...    57   4e-08
TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {...    58   4e-08
CAGL0F05995g Chr6 complement(598819..600612) [1794 bp, 597 aa] {...    57   5e-08
NCAS0H03080 Chr8 complement(592814..595006) [2193 bp, 730 aa] {O...    57   6e-08
Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {O...    57   8e-08
KNAG0M02310 Chr13 complement(426937..428919) [1983 bp, 660 aa] {...    57   9e-08
TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa] ...    56   1e-07
Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {O...    57   1e-07
KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598...    57   1e-07
KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weak...    57   1e-07
KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {...    57   1e-07
NDAI0B01340 Chr2 (309326..311635) [2310 bp, 769 aa] {ON} Anc_2.598     56   2e-07
ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON} S...    55   2e-07
KAFR0A02320 Chr1 complement(482194..483525) [1332 bp, 443 aa] {O...    55   2e-07
KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {O...    55   3e-07
TBLA0G03240 Chr7 (859142..860677) [1536 bp, 511 aa] {ON} Anc_3.298     55   3e-07
CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa...    55   4e-07
Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar t...    55   4e-07
KAFR0F01210 Chr6 (232343..233278) [936 bp, 311 aa] {ON} Anc_6.25...    52   1e-06
SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]...    53   1e-06
NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {O...    53   1e-06
ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic ho...    52   2e-06
TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.35...    53   2e-06
Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}...    52   3e-06
SAKL0F01980g Chr6 (165916..167073) [1158 bp, 385 aa] {ON} some s...    51   4e-06
KNAG0H01180 Chr8 (200503..201267) [765 bp, 254 aa] {ON} Anc_3.28...    50   5e-06
KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} simil...    52   5e-06
KLLA0C17072g Chr3 (1494101..1495525) [1425 bp, 474 aa] {ON} weak...    51   5e-06
NCAS0C04070 Chr3 (831321..832190) [870 bp, 289 aa] {ON} Anc_8.144      50   5e-06
Suva_13.70 Chr13 (106147..108480) [2334 bp, 777 aa] {ON} YML081W...    51   5e-06
CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some s...    50   6e-06
NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON}             51   6e-06
KAFR0A06720 Chr1 (1361355..1362062) [708 bp, 235 aa] {ON} Anc_5....    49   6e-06
Smik_13.387 Chr13 complement(609003..609641) [639 bp, 212 aa] {O...    49   7e-06
KLTH0H08800g Chr8 (762417..762923) [507 bp, 168 aa] {ON} some si...    48   8e-06
KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly...    50   8e-06
Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa] ...    50   8e-06
ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic ho...    50   9e-06
CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} simila...    50   9e-06
TPHA0D01050 Chr4 complement(216444..217763) [1320 bp, 439 aa] {O...    50   9e-06
KNAG0M00350 Chr13 (51209..54439) [3231 bp, 1076 aa] {ON} Anc_4.3...    50   9e-06
KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON} Anc_8...    50   1e-05
Skud_13.348 Chr13 complement(598668..599318) [651 bp, 216 aa] {O...    49   1e-05
YMR182C Chr13 complement(624532..625167) [636 bp, 211 aa] {ON}  ...    49   1e-05
AGR172W Chr7 (1071485..1074658) [3174 bp, 1057 aa] {ON} Syntenic...    50   1e-05
TBLA0B06160 Chr2 (1454045..1458199) [4155 bp, 1384 aa] {ON} Anc_...    50   1e-05
Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON...    49   1e-05
NDAI0G03420 Chr7 (817362..818816) [1455 bp, 484 aa] {ON} Anc_8.1...    50   1e-05
Smik_5.276 Chr5 complement(429983..431311) [1329 bp, 442 aa] {ON...    50   1e-05
Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W...    49   1e-05
Skud_13.61 Chr13 (104114..107875) [3762 bp, 1253 aa] {ON} YML081...    50   1e-05
Smik_13.58 Chr13 (102509..106270) [3762 bp, 1253 aa] {ON} YML081...    50   1e-05
YPL230W Chr16 (115312..116487) [1176 bp, 391 aa] {ON}  USV1Putat...    49   1e-05
NCAS0A01820 Chr1 (351123..352490) [1368 bp, 455 aa] {ON} Anc_4.80      49   1e-05
KNAG0D02120 Chr4 (359406..360614) [1209 bp, 402 aa] {ON} Anc_8.1...    49   2e-05
Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON...    48   2e-05
NDAI0D03750 Chr4 (888448..889929) [1482 bp, 493 aa] {ON} Anc_4.80      49   2e-05
Skud_5.248 Chr5 (399138..400466) [1329 bp, 442 aa] {ON} YER130C ...    49   2e-05
YML081W Chr13 (104777..108532) [3756 bp, 1251 aa] {ON}  TDA9DNA-...    50   2e-05
ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]...    49   2e-05
Suva_5.251 Chr5 complement(396841..398190) [1350 bp, 449 aa] {ON...    49   2e-05
TDEL0F02690 Chr6 (493944..494996) [1053 bp, 350 aa] {ON} Anc_4.8...    49   2e-05
NCAS0F00920 Chr6 (185346..186410) [1065 bp, 354 aa] {ON} Anc_2.531     49   2e-05
KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {O...    49   2e-05
Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130...    49   2e-05
TBLA0F03830 Chr6 (947034..949937) [2904 bp, 967 aa] {ON} Anc_8.2...    49   2e-05
KLLA0F13046g Chr6 (1201353..1205492) [4140 bp, 1379 aa] {ON} wea...    49   2e-05
Smik_6.435 Chr6 complement(707873..709033) [1161 bp, 386 aa] {ON...    49   2e-05
YER130C Chr5 complement(421115..422446) [1332 bp, 443 aa] {ON} P...    49   2e-05
ADL051W Chr4 (595493..596014) [522 bp, 173 aa] {ON} NOHBY404; No...    47   3e-05
NDAI0B01930 Chr2 (468399..469709) [1311 bp, 436 aa] {ON} Anc_8.144     49   3e-05
Skud_16.48 Chr16 (88821..90017) [1197 bp, 398 aa] {ON} YPL230W (...    49   3e-05
SAKL0H12958g Chr8 complement(1112324..1115713) [3390 bp, 1129 aa...    49   3e-05
NDAI0D03240 Chr4 complement(769306..773394) [4089 bp, 1362 aa] {...    49   3e-05
KNAG0E01600 Chr5 complement(319141..320157) [1017 bp, 338 aa] {O...    48   3e-05
KAFR0B02550 Chr2 (507752..510424) [2673 bp, 890 aa] {ON} Anc_8.2...    49   3e-05
AGR117C Chr7 complement(964411..966810) [2400 bp, 799 aa] {ON} S...    49   3e-05
TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {...    49   4e-05
Kpol_1001.1 s1001 (3077..7102) [4026 bp, 1341 aa] {ON} (3077..71...    49   4e-05
KAFR0B06810 Chr2 complement(1416866..1420333) [3468 bp, 1155 aa]...    49   4e-05
TPHA0A01940 Chr1 complement(391362..394100) [2739 bp, 912 aa] {O...    49   4e-05
Suva_8.62 Chr8 (113740..115377) [1638 bp, 545 aa] {ON} YHR006W (...    48   4e-05
TDEL0B04670 Chr2 (830511..831449) [939 bp, 312 aa] {ON} Anc_8.14...    48   4e-05
SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa...    49   4e-05
Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar t...    49   4e-05
TPHA0C02160 Chr3 complement(486620..490747) [4128 bp, 1375 aa] {...    49   4e-05
TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON...    47   5e-05
AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON} ...    48   5e-05
KNAG0G01870 Chr7 (417774..420401) [2628 bp, 875 aa] {ON} Anc_8.2...    48   5e-05
KAFR0C02980 Chr3 (595202..595879) [678 bp, 225 aa] {ON} Anc_8.14...    47   5e-05
NDAI0J02850 Chr10 complement(707859..712472) [4614 bp, 1537 aa] ...    48   5e-05
Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON...    48   6e-05
CAGL0E04884g Chr5 complement(469532..474001) [4470 bp, 1489 aa] ...    48   6e-05
TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144...    48   6e-05
TDEL0A01300 Chr1 complement(225813..228326) [2514 bp, 837 aa] {O...    48   6e-05
ZYRO0A09416g Chr1 (756859..760899) [4041 bp, 1346 aa] {ON} simil...    48   6e-05
Kpol_1032.52 s1032 (118186..120660) [2475 bp, 824 aa] {ON} (1181...    48   6e-05
CAGL0A01628g Chr1 (161327..162601) [1275 bp, 424 aa] {ON} simila...    47   7e-05
NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON} Anc_...    48   7e-05
NCAS0A06250 Chr1 complement(1234566..1238591) [4026 bp, 1341 aa]...    48   7e-05
Suva_7.240 Chr7 complement(423254..423364,423482..424918) [1548 ...    47   7e-05
NCAS0G01270 Chr7 (228699..229523) [825 bp, 274 aa] {ON} Anc_6.256      47   7e-05
Kpol_472.10 s472 (31069..33561) [2493 bp, 830 aa] {ON} (31069..3...    48   7e-05
KLTH0D18062g Chr4 (1493355..1496741) [3387 bp, 1128 aa] {ON} sim...    48   7e-05
Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {O...    48   8e-05
CAGL0E06116g Chr5 complement(604945..606786) [1842 bp, 613 aa] {...    47   8e-05
CAGL0L11880g Chr12 (1274920..1277862) [2943 bp, 980 aa] {ON} som...    48   8e-05
Skud_4.354 Chr4 (614004..616754) [2751 bp, 916 aa] {ON} YDR096W ...    47   8e-05
KAFR0F03600 Chr6 (714010..715017) [1008 bp, 335 aa] {ON} Anc_4.8...    47   8e-05
ZYRO0B11770g Chr2 (932841..935444) [2604 bp, 867 aa] {ON} simila...    47   9e-05
Suva_13.363 Chr13 complement(604738..605373) [636 bp, 211 aa] {O...    45   9e-05
NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {...    47   1e-04
Ecym_3520 Chr3 complement(980315..982774) [2460 bp, 819 aa] {ON}...    47   1e-04
KLLA0F10109g Chr6 complement(939195..941066) [1872 bp, 623 aa] {...    47   1e-04
Skud_5.308 Chr5 (508459..510867) [2409 bp, 802 aa] {ON} YER169W ...    47   1e-04
KAFR0A00800 Chr1 complement(144493..146754) [2262 bp, 753 aa] {O...    47   1e-04
TBLA0E04210 Chr5 (1066141..1067505) [1365 bp, 454 aa] {ON}             47   1e-04
KLTH0G01826g Chr7 (135376..136299) [924 bp, 307 aa] {ON} some si...    46   1e-04
KNAG0B06710 Chr2 complement(1325084..1328245) [3162 bp, 1053 aa]...    47   1e-04
Smik_7.251 Chr7 complement(423105..424622) [1518 bp, 505 aa] {ON...    47   1e-04
KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa] ...    46   1e-04
KNAG0B00590 Chr2 (96235..97554) [1320 bp, 439 aa] {ON} Anc_3.518...    46   1e-04
CAGL0L05786g Chr12 complement(638173..639219) [1047 bp, 348 aa] ...    46   1e-04
Suva_2.383 Chr2 (674568..678527) [3960 bp, 1319 aa] {ON} YDR216W...    47   1e-04
CAGL0M01870g Chr13 complement(219813..220760) [948 bp, 315 aa] {...    46   1e-04
TBLA0B06050 Chr2 (1425041..1427329) [2289 bp, 762 aa] {ON} Anc_2...    47   1e-04
Kwal_47.19045 s47 complement(1074829..1075629) [801 bp, 266 aa] ...    45   2e-04
YDR216W Chr4 (895035..899006) [3972 bp, 1323 aa] {ON}  ADR1Carbo...    47   2e-04
Skud_10.351 Chr10 complement(617553..621332,621389..621469,62146...    47   2e-04
KAFR0E04270 Chr5 complement(859635..863402) [3768 bp, 1255 aa] {...    47   2e-04
Smik_4.337 Chr4 (603613..606297) [2685 bp, 894 aa] {ON} YDR096W ...    47   2e-04
YDR096W Chr4 (637139..639823) [2685 bp, 894 aa] {ON}  GIS1JmjC d...    47   2e-04
Smik_4.463 Chr4 (838900..842874) [3975 bp, 1324 aa] {ON} YDR216W...    47   2e-04
Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON...    46   2e-04
YER169W Chr5 (523369..525759) [2391 bp, 796 aa] {ON}  RPH1JmjC d...    46   2e-04
Kpol_1023.63 s1023 complement(144388..146058) [1671 bp, 556 aa] ...    46   2e-04
KLTH0H09196g Chr8 complement(789919..791301) [1383 bp, 460 aa] {...    46   2e-04
YGL035C Chr7 complement(431548..433062) [1515 bp, 504 aa] {ON}  ...    46   2e-04
KLTH0G10802g Chr7 (908386..909966) [1581 bp, 526 aa] {ON} some s...    46   2e-04
Skud_4.478 Chr4 (849367..853338) [3972 bp, 1323 aa] {ON} YDR216W...    46   2e-04
Kpol_1026.8 s1026 (16151..16525,16527..17390) [1239 bp, 412 aa] ...    46   2e-04
CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa...    46   2e-04
Suva_12.218 Chr12 complement(338418..342230) [3813 bp, 1270 aa] ...    46   2e-04
Suva_2.255 Chr2 (436524..439208) [2685 bp, 894 aa] {ON} YDR096W ...    46   2e-04
TBLA0E04770 Chr5 complement(1228439..1233406) [4968 bp, 1655 aa]...    46   2e-04
YJR127C Chr10 complement(658917..663059) [4143 bp, 1380 aa] {ON}...    46   2e-04
CAGL0H04213g Chr8 (398544..402509) [3966 bp, 1321 aa] {ON} simil...    46   2e-04
Smik_10.420 Chr10 complement(647997..651776,651798..651836,65184...    46   2e-04
YDR463W Chr4 (1386816..1388375) [1560 bp, 519 aa] {ON}  STP1Tran...    46   2e-04
Suva_5.303 Chr5 (491206..492999,493030..493629) [2394 bp, 797 aa...    46   2e-04
Smik_5.341 Chr5 (522964..525360) [2397 bp, 798 aa] {ON} YER169W ...    46   2e-04
KNAG0D03710 Chr4 (675160..676539) [1380 bp, 459 aa] {ON} Anc_4.8...    45   2e-04
NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON} Anc_...    46   3e-04
KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.1...    45   3e-04
Skud_7.249 Chr7 complement(434181..435689) [1509 bp, 502 aa] {ON...    45   3e-04
CAGL0E04312g Chr5 (412800..414866) [2067 bp, 688 aa] {ON} some s...    45   3e-04
NDAI0B02250 Chr2 (559530..563000) [3471 bp, 1156 aa] {ON} Anc_8....    46   3e-04
SAKL0H20988g Chr8 complement(1832478..1834124) [1647 bp, 548 aa]...    45   3e-04
ZYRO0B14894g Chr2 complement(1212853..1216212) [3360 bp, 1119 aa...    46   3e-04
NCAS0H02890 Chr8 complement(564830..566428) [1599 bp, 532 aa] {O...    45   3e-04
Smik_4.742 Chr4 (1308041..1309627) [1587 bp, 528 aa] {ON} YDR463...    45   3e-04
TPHA0D03400 Chr4 complement(714580..715596) [1017 bp, 338 aa] {O...    45   4e-04
Skud_4.739 Chr4 (1306825..1308369) [1545 bp, 514 aa] {ON} YDR463...    45   4e-04
TPHA0G00820 Chr7 (153365..154963) [1599 bp, 532 aa] {ON} Anc_2.3...    45   4e-04
CAGL0L00583g Chr12 (71544..72710) [1167 bp, 388 aa] {ON} similar...    45   4e-04
TBLA0E02820 Chr5 complement(699189..700127) [939 bp, 312 aa] {ON...    45   4e-04
YGL209W Chr7 (95858..97006) [1149 bp, 382 aa] {ON}  MIG2Zinc fin...    45   4e-04
KLLA0C16005g Chr3 (1397274..1398269) [996 bp, 331 aa] {ON} some ...    45   4e-04
SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly...    45   4e-04
TBLA0E04220 Chr5 (1069230..1070789) [1560 bp, 519 aa] {ON} Anc_8...    45   4e-04
KNAG0B03350 Chr2 complement(647618..649420) [1803 bp, 600 aa] {O...    45   4e-04
KNAG0A04460 Chr1 complement(619911..623783) [3873 bp, 1290 aa] {...    45   4e-04
TPHA0K01770 Chr11 (374701..376257) [1557 bp, 518 aa] {ON} Anc_4....    45   4e-04
KAFR0C00490 Chr3 complement(97556..98230) [675 bp, 224 aa] {ON} ...    44   4e-04
TPHA0B02910 Chr2 complement(662998..665151) [2154 bp, 717 aa] {O...    45   4e-04
KNAG0F01710 Chr6 (320407..321648) [1242 bp, 413 aa] {ON} Anc_6.2...    45   5e-04
TDEL0D00670 Chr4 (117923..121522) [3600 bp, 1199 aa] {ON} Anc_4....    45   5e-04
Kpol_423.15 s423 (33422..34600) [1179 bp, 392 aa] {ON} (33422..3...    45   5e-04
Kpol_1023.100 s1023 (235260..238010) [2751 bp, 916 aa] {ON} (235...    45   5e-04
TDEL0F05500 Chr6 (1024045..1027668) [3624 bp, 1207 aa] {ON} Anc_...    45   5e-04
TPHA0A04530 Chr1 (1027935..1029440) [1506 bp, 501 aa] {ON}             45   6e-04
Kpol_1072.58 s1072 complement(131384..133768) [2385 bp, 794 aa] ...    45   6e-04
NDAI0I00990 Chr9 complement(236716..237945) [1230 bp, 409 aa] {O...    44   6e-04
SAKL0H17842g Chr8 complement(1584215..1586659) [2445 bp, 814 aa]...    45   6e-04
NCAS0F00910 Chr6 (183289..184341) [1053 bp, 350 aa] {ON}               44   6e-04
KAFR0F04150 Chr6 complement(816551..817801) [1251 bp, 416 aa] {O...    44   6e-04
KLLA0F23782g Chr6 (2219920..2222268) [2349 bp, 782 aa] {ON} weak...    45   6e-04
KNAG0H03010 Chr8 (560630..562984) [2355 bp, 784 aa] {ON} Anc_8.2...    45   6e-04
CAGL0K06413g Chr11 (628640..629719) [1080 bp, 359 aa] {ON} some ...    44   6e-04
SAKL0H20416g Chr8 (1789596..1790549) [954 bp, 317 aa] {ON} weakl...    44   7e-04
TBLA0B01280 Chr2 complement(271520..273991) [2472 bp, 823 aa] {O...    45   7e-04
Kwal_56.23453 s56 complement(545262..547748) [2487 bp, 828 aa] {...    45   7e-04
Ecym_4128 Chr4 (270876..271814) [939 bp, 312 aa] {ON} similar to...    44   7e-04
KLTH0G14454g Chr7 (1263253..1265751) [2499 bp, 832 aa] {ON} some...    44   7e-04
Suva_2.200 Chr2 complement(341892..342590) [699 bp, 232 aa] {ON}...    43   7e-04
KLLA0E08713g Chr5 (777005..778795) [1791 bp, 596 aa] {ON} some s...    44   7e-04
SAKL0E07216g Chr5 complement(592229..593875) [1647 bp, 548 aa] {...    44   7e-04
KNAG0C06030 Chr3 (1176811..1177755) [945 bp, 314 aa] {ON} Anc_5....    44   7e-04
ZYRO0D13992g Chr4 (1178918..1180681) [1764 bp, 587 aa] {ON} simi...    44   8e-04
CAGL0G08107g Chr7 (768772..770649) [1878 bp, 625 aa] {ON} weakly...    44   8e-04
Kpol_505.15 s505 (42259..43791) [1533 bp, 510 aa] {ON} (42259..4...    44   9e-04
NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON} Anc_3...    44   9e-04
Skud_8.55 Chr8 (100188..101795) [1608 bp, 535 aa] {ON} YHR006W (...    44   9e-04
ZYRO0C13508g Chr3 complement(1068164..1068733) [570 bp, 189 aa] ...    42   9e-04
TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {O...    44   9e-04
TBLA0C04880 Chr3 complement(1187913..1188932) [1020 bp, 339 aa] ...    44   0.001
KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.1...    44   0.001
KAFR0B04580 Chr2 (951625..953814) [2190 bp, 729 aa] {ON} Anc_2.1...    44   0.001
TBLA0I02700 Chr9 complement(630467..632680) [2214 bp, 737 aa] {O...    44   0.001
ZYRO0G20526g Chr7 (1691182..1693731) [2550 bp, 849 aa] {ON} weak...    44   0.001
Kwal_47.17888 s47 (593447..595807) [2361 bp, 786 aa] {ON} YOR113...    44   0.001
NCAS0B04840 Chr2 (882270..884864) [2595 bp, 864 aa] {ON} Anc_8.234     44   0.001
CAGL0C02519g Chr3 (253051..254007) [957 bp, 318 aa] {ON} some si...    43   0.001
ZYRO0G09438g Chr7 complement(752797..753786) [990 bp, 329 aa] {O...    43   0.001
KLTH0E09922g Chr5 (894838..898197) [3360 bp, 1119 aa] {ON} weakl...    44   0.001
KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}...    44   0.001
KAFR0A02380 Chr1 complement(493691..496393) [2703 bp, 900 aa] {O...    44   0.001
NDAI0C00690 Chr3 complement(134897..136849) [1953 bp, 650 aa] {O...    44   0.001
Ecym_6295 Chr6 complement(553427..555418) [1992 bp, 663 aa] {ON}...    44   0.001
AGR186C Chr7 complement(1099507..1100370) [864 bp, 287 aa] {ON} ...    43   0.001
KLLA0E11023g Chr5 (966805..968229) [1425 bp, 474 aa] {ON} unipro...    44   0.001
Smik_7.54 Chr7 (90713..91861) [1149 bp, 382 aa] {ON} YGL209W (REAL)    43   0.001
KLLA0C17710g Chr3 (1569331..1571796) [2466 bp, 821 aa] {ON} simi...    44   0.001
KNAG0H01930 Chr8 (340772..342628) [1857 bp, 618 aa] {ON} Anc_2.3...    44   0.001
KLTH0E09724g Chr5 (876916..879222) [2307 bp, 768 aa] {ON} weakly...    44   0.001
NCAS0D02520 Chr4 (478610..479341) [732 bp, 243 aa] {ON}                43   0.001
AGR031W Chr7 (769920..770342) [423 bp, 140 aa] {ON} Syntenic hom...    41   0.001
SAKL0G06292g Chr7 (522850..524403) [1554 bp, 517 aa] {ON} unipro...    43   0.001
AEL174W Chr5 (310950..312935) [1986 bp, 661 aa] {ON} Syntenic ho...    44   0.001
KAFR0C05710 Chr3 (1136694..1138022) [1329 bp, 442 aa] {ON} Anc_5...    43   0.001
Suva_7.52 Chr7 (92333..93535) [1203 bp, 400 aa] {ON} YGL209W (REAL)    43   0.002
Skud_4.297 Chr4 complement(519166..519861) [696 bp, 231 aa] {ON}...    42   0.002
KAFR0I02370 Chr9 (480591..481766) [1176 bp, 391 aa] {ON} Anc_3.5...    43   0.002
YDR043C Chr4 complement(542674..543369) [696 bp, 231 aa] {ON}  N...    42   0.002
NDAI0B06020 Chr2 complement(1462374..1463654) [1281 bp, 426 aa] ...    43   0.002
Ecym_2654 Chr2 (1266751..1267524) [774 bp, 257 aa] {ON} similar ...    42   0.002
Kwal_27.11460 s27 complement(810736..812331) [1596 bp, 531 aa] {...    43   0.002
AFR461C Chr6 complement(1270007..1271641) [1635 bp, 544 aa] {ON}...    43   0.002
Ecym_8379 Chr8 complement(768914..769831) [918 bp, 305 aa] {ON} ...    42   0.002
NDAI0I02900 Chr9 complement(684980..686554) [1575 bp, 524 aa] {O...    43   0.002
NCAS0C04230 Chr3 (869169..870185) [1017 bp, 338 aa] {ON}               43   0.002
Kpol_1052.18 s1052 (58087..59160) [1074 bp, 357 aa] {ON} (58087....    43   0.002
ADL198W Chr4 (349068..350711) [1644 bp, 547 aa] {ON} Syntenic ho...    43   0.002
Kwal_14.2278 s14 complement(686159..687550) [1392 bp, 463 aa] {O...    43   0.002
Kwal_14.2206 s14 (656346..657110) [765 bp, 254 aa] {ON} YPR015C ...    42   0.002
KAFR0A07120 Chr1 complement(1435398..1436345) [948 bp, 315 aa] {...    42   0.002
CAGL0L07480g Chr12 complement(824237..825181) [945 bp, 314 aa] {...    42   0.002
Smik_14.303 Chr14 (542116..544137) [2022 bp, 673 aa] {ON} YNL027...    43   0.002
Kpol_1050.19 s1050 complement(48007..48672) [666 bp, 221 aa] {ON...    42   0.002
TBLA0A08910 Chr1 complement(2188408..2189580) [1173 bp, 390 aa] ...    42   0.002
Skud_7.59 Chr7 (101253..102404) [1152 bp, 383 aa] {ON} YGL209W (...    42   0.002
TPHA0J00670 Chr10 complement(148901..150883) [1983 bp, 660 aa] {...    43   0.002
KAFR0C04550 Chr3 (911728..913131) [1404 bp, 467 aa] {ON}               42   0.002
KLLA0F01463g Chr6 (140343..142688) [2346 bp, 781 aa] {ON} some s...    43   0.002
Suva_2.639 Chr2 (1139039..1140589) [1551 bp, 516 aa] {ON} YDR463...    42   0.002
TDEL0D05860 Chr4 complement(1064492..1065484) [993 bp, 330 aa] {...    42   0.002
Kpol_1060.35 s1060 (84889..85725) [837 bp, 278 aa] {ON} (84889.....    42   0.003
TPHA0G00270 Chr7 (43982..45400) [1419 bp, 472 aa] {ON} Anc_7.543...    42   0.003
Ecym_3341 Chr3 (647938..649620) [1683 bp, 560 aa] {ON} similar t...    42   0.003
ADR308C Chr4 complement(1241867..1242703) [837 bp, 278 aa] {ON} ...    42   0.003
Suva_16.335 Chr16 complement(588678..589631) [954 bp, 317 aa] {O...    42   0.003
NCAS0B06960 Chr2 (1324315..1326834) [2520 bp, 839 aa] {ON} Anc_2...    43   0.003
TDEL0A04530 Chr1 (805574..807028) [1455 bp, 484 aa] {ON} Anc_5.5...    42   0.003
Ecym_1383 Chr1 complement(791514..792659) [1146 bp, 381 aa] {ON}...    42   0.003
KNAG0G01140 Chr7 complement(251500..253059) [1560 bp, 519 aa] {O...    42   0.003
Kpol_1065.15 s1065 (43237..43899) [663 bp, 220 aa] {ON} (43237.....    41   0.003
Ecym_8011 Chr8 complement(26472..27302) [831 bp, 276 aa] {ON} si...    42   0.003
Skud_14.301 Chr14 (550283..552331) [2049 bp, 682 aa] {ON} YNL027...    42   0.003
NDAI0F01400 Chr6 (347938..349122) [1185 bp, 394 aa] {ON} Anc_6.256     42   0.003
TBLA0F01300 Chr6 (326311..329268) [2958 bp, 985 aa] {ON} Anc_1.3...    42   0.003
NCAS0G03730 Chr7 (688768..690483) [1716 bp, 571 aa] {ON} Anc_2.303     42   0.003
SAKL0A10582g Chr1 complement(930343..931209) [867 bp, 288 aa] {O...    42   0.003
KLLA0D16456g Chr4 complement(1387846..1390410) [2565 bp, 854 aa]...    42   0.003
KAFR0C03140 Chr3 (629556..630668) [1113 bp, 370 aa] {ON}               42   0.003
Suva_14.318 Chr14 (561697..562047,562519..564213) [2046 bp, 681 ...    42   0.003
Suva_6.132 Chr6 (219016..221652) [2637 bp, 878 aa] {ON} YJL056C ...    42   0.004
NDAI0G00720 Chr7 complement(155060..157186) [2127 bp, 708 aa] {O...    42   0.004
Ecym_1475 Chr1 (978578..979627) [1050 bp, 349 aa] {ON} similar t...    42   0.004
TDEL0D03430 Chr4 (635293..635820) [528 bp, 175 aa] {ON} Anc_3.28...    40   0.004
Kwal_27.10925 s27 complement(559077..559871) [795 bp, 264 aa] {O...    41   0.004
Smik_4.281 Chr4 complement(509413..510108) [696 bp, 231 aa] {ON}...    41   0.004
YNL027W Chr14 (579580..581616) [2037 bp, 678 aa] {ON}  CRZ1Trans...    42   0.004
Ecym_2159 Chr2 (304191..305573) [1383 bp, 460 aa] {ON} similar t...    42   0.004
NCAS0B04020 Chr2 complement(726291..727118) [828 bp, 275 aa] {ON}      41   0.004
ADL042W Chr4 (615815..616660) [846 bp, 281 aa] {ON} Syntenic hom...    41   0.004
Ecym_1404 Chr1 complement(840220..841908) [1689 bp, 562 aa] {ON}...    42   0.004
YOR113W Chr15 (534075..536819) [2745 bp, 914 aa] {ON}  AZF1Zinc-...    42   0.004
CAGL0J01595g Chr10 (151584..152618) [1035 bp, 344 aa] {ON} some ...    41   0.004
TPHA0A05820 Chr1 complement(1319614..1320444) [831 bp, 276 aa] {...    41   0.005
ZYRO0B16148g Chr2 (1308101..1310893) [2793 bp, 930 aa] {ON} weak...    42   0.005
TPHA0K00210 Chr11 complement(34961..36406) [1446 bp, 481 aa] {ON...    42   0.005
KLLA0F18524g Chr6 complement(1701498..1702571) [1074 bp, 357 aa]...    41   0.005
TPHA0F01810 Chr6 (416859..418136) [1278 bp, 425 aa] {ON} Anc_2.1...    41   0.005
YJL056C Chr10 complement(330431..333073) [2643 bp, 880 aa] {ON} ...    42   0.005
KAFR0A01090 Chr1 complement(209790..210539) [750 bp, 249 aa] {ON...    41   0.005
KLTH0G05104g Chr7 (412304..413920) [1617 bp, 538 aa] {ON} simila...    42   0.005
KNAG0J02250 Chr10 (421560..422450) [891 bp, 296 aa] {ON}               41   0.005
NCAS0B05750 Chr2 complement(1093346..1094863) [1518 bp, 505 aa] ...    41   0.005
NCAS0E00610 Chr5 (105009..106214) [1206 bp, 401 aa] {ON} Anc_3.518     41   0.005
KAFR0A01840 Chr1 complement(379714..380958) [1245 bp, 414 aa] {O...    41   0.006
TBLA0E03930 Chr5 complement(990944..992332) [1389 bp, 462 aa] {O...    41   0.006
Skud_15.276 Chr15 (490511..493264) [2754 bp, 917 aa] {ON} YOR113...    42   0.006
YHR006W Chr8 (117814..119439) [1626 bp, 541 aa] {ON}  STP2Transc...    41   0.006
KLLA0A04609g Chr1 complement(411494..412765) [1272 bp, 423 aa] {...    41   0.006
SAKL0H04070g Chr8 (379179..381878) [2700 bp, 899 aa] {ON} some s...    41   0.006
CAGL0K04631g Chr11 complement(441550..444591) [3042 bp, 1013 aa]...    42   0.006
TBLA0I02060 Chr9 (465675..468176) [2502 bp, 833 aa] {ON} Anc_3.298     41   0.007
YPR013C Chr16 complement(584632..585585) [954 bp, 317 aa] {ON} P...    41   0.007
NCAS0I01460 Chr9 complement(268223..269215) [993 bp, 330 aa] {ON...    41   0.007
Smik_16.253 Chr16 complement(460778..461731) [954 bp, 317 aa] {O...    41   0.007
KLTH0C07172g Chr3 complement(620315..621112) [798 bp, 265 aa] {O...    40   0.007
ZYRO0E08426g Chr5 complement(673465..673980) [516 bp, 171 aa] {O...    40   0.007
TPHA0H01850 Chr8 complement(425548..426633) [1086 bp, 361 aa] {O...    41   0.007
SAKL0H20394g Chr8 (1787390..1788469) [1080 bp, 359 aa] {ON} weak...    41   0.007
Smik_15.291 Chr15 (495292..498021) [2730 bp, 909 aa] {ON} YOR113...    41   0.007
SAKL0D03146g Chr4 complement(256292..256765) [474 bp, 157 aa] {O...    39   0.007
CAGL0K09372g Chr11 complement(925647..926837) [1191 bp, 396 aa] ...    41   0.007
Suva_5.124 Chr5 complement(186591..187811) [1221 bp, 406 aa] {ON...    41   0.007
TPHA0A01540 Chr1 (306674..308914) [2241 bp, 746 aa] {ON} Anc_8.3...    41   0.008
SAKL0A03476g Chr1 (319246..320214) [969 bp, 322 aa] {ON} some si...    40   0.008
NCAS0D03910 Chr4 (729305..730255) [951 bp, 316 aa] {ON} Anc_6.256      40   0.008
Skud_10.152 Chr10 (285800..288439) [2640 bp, 879 aa] {ON} YJL056...    41   0.008
TDEL0G02330 Chr7 (449585..451105) [1521 bp, 506 aa] {ON} Anc_2.3...    41   0.008
TDEL0B05250 Chr2 complement(922332..924476) [2145 bp, 714 aa] {O...    41   0.009
Smik_8.63 Chr8 (97366..98994) [1629 bp, 542 aa] {ON} YHR006W (REAL)    41   0.009
SAKL0A10648g Chr1 (934819..935604) [786 bp, 261 aa] {ON} some si...    40   0.009
NDAI0H01110 Chr8 (247915..249279) [1365 bp, 454 aa] {ON} Anc_5.586     40   0.010
AGL207W Chr7 (310750..311583) [834 bp, 277 aa] {ON} NOHBY712; No...    40   0.010
KLLA0F11682g Chr6 complement(1068992..1070116) [1125 bp, 374 aa]...    40   0.010
NCAS0I01560 Chr9 (291561..292361) [801 bp, 266 aa] {ON} Anc_3.281      40   0.010
Kpol_1002.25 s1002 (79397..80281) [885 bp, 294 aa] {ON} (79397.....    40   0.011
TPHA0E02650 Chr5 (554820..555743) [924 bp, 307 aa] {ON} Anc_6.25...    40   0.012
KAFR0H03240 Chr8 (619580..621139) [1560 bp, 519 aa] {ON} Anc_2.3...    40   0.013
Ecym_8388 Chr8 complement(794615..795286) [672 bp, 223 aa] {ON} ...    39   0.013
Skud_5.137 Chr5 complement(208578..209762) [1185 bp, 394 aa] {ON...    40   0.013
NDAI0A07470 Chr1 complement(1702035..1702826) [792 bp, 263 aa] {...    40   0.013
KAFR0B02000 Chr2 complement(392263..393174) [912 bp, 303 aa] {ON...    40   0.013
ZYRO0B07568g Chr2 (595114..596964) [1851 bp, 616 aa] {ON} some s...    40   0.013
SAKL0A09438g Chr1 complement(823711..825036) [1326 bp, 441 aa] {...    40   0.013
TBLA0A01605 Chr1 (376599..377273) [675 bp, 224 aa] {ON}                39   0.014
ADL050W Chr4 (597226..597666) [441 bp, 146 aa] {ON} NOHBY403; No...    38   0.014
NDAI0B01940 Chr2 complement(472594..473604) [1011 bp, 336 aa] {O...    40   0.015
TPHA0A03980 Chr1 (885841..886785) [945 bp, 314 aa] {ON} Anc_3.28...    40   0.015
TDEL0F01170 Chr6 (209707..210195) [489 bp, 162 aa] {ON} Anc_8.11...    39   0.015
Ecym_1415 Chr1 complement(863049..864563) [1515 bp, 504 aa] {ON}...    40   0.015
Kpol_495.20 s495 (65876..67336) [1461 bp, 486 aa] {ON} (65876..6...    40   0.015
CAGL0L03916g Chr12 complement(450952..452880) [1929 bp, 642 aa] ...    40   0.016
Skud_16.298 Chr16 complement(548954..549907) [954 bp, 317 aa] {O...    40   0.016
KNAG0D02290 Chr4 complement(397174..398481) [1308 bp, 435 aa] {O...    40   0.017
TBLA0B04960 Chr2 complement(1167778..1169124) [1347 bp, 448 aa] ...    40   0.017
Suva_8.166 Chr8 (291812..294658) [2847 bp, 948 aa] {ON} YOR113W ...    40   0.018
KNAG0J00870 Chr10 complement(148421..149263) [843 bp, 280 aa] {O...    39   0.019
Suva_10.224 Chr10 complement(413051..415345) [2295 bp, 764 aa] {...    40   0.019
YER028C Chr5 complement(210692..211876) [1185 bp, 394 aa] {ON}  ...    39   0.019
AFL136W Chr6 (178780..180009) [1230 bp, 409 aa] {ON} Syntenic ho...    39   0.020
TPHA0M01180 Chr13 complement(237368..238420) [1053 bp, 350 aa] {...    39   0.020
NCAS0B04360 Chr2 (791449..792276) [828 bp, 275 aa] {ON}                39   0.022
NCAS0A07900 Chr1 complement(1570244..1571347) [1104 bp, 367 aa] ...    39   0.023
SAKL0D06776g Chr4 (561887..564190) [2304 bp, 767 aa] {ON} weakly...    40   0.023
KNAG0D02280 Chr4 (393332..394639) [1308 bp, 435 aa] {ON}               39   0.024
Smik_5.151 Chr5 complement(215590..216756) [1167 bp, 388 aa] {ON...    39   0.024
Kpol_1065.48 s1065 complement(127243..128337) [1095 bp, 364 aa] ...    39   0.024
CAGL0M06831g Chr13 (695162..697099) [1938 bp, 645 aa] {ON} weakl...    39   0.024
Kpol_1036.70 s1036 complement(192400..194424) [2025 bp, 674 aa] ...    39   0.025
AEL077W Chr5 (483028..484038) [1011 bp, 336 aa] {ON} NOHBY506; N...    39   0.026
Klac_YGOB_Anc_3.518 Chr2 complement(46736..47455) [720 bp, 239 a...    39   0.026
YLR131C Chr12 complement(404510..406822) [2313 bp, 770 aa] {ON} ...    39   0.027
YPL038W Chr16 (480535..481068) [534 bp, 177 aa] {ON}  MET31Zinc-...    38   0.027
NDAI0B02080 Chr2 (520660..521481) [822 bp, 273 aa] {ON}                39   0.027
Kwal_47.18337 s47 complement(787992..789602) [1611 bp, 536 aa] {...    39   0.029
AFR531W Chr6 (1389929..1390753) [825 bp, 274 aa] {ON} Unclear if...    39   0.029
TBLA0C01990 Chr3 complement(466321..467190) [870 bp, 289 aa] {ON...    39   0.029
NDAI0G05800 Chr7 complement(1436085..1438595) [2511 bp, 836 aa] ...    39   0.030
NDAI0A05650 Chr1 (1275925..1276917) [993 bp, 330 aa] {ON} Anc_3....    39   0.031
KNAG0G02470 Chr7 complement(562235..564445) [2211 bp, 736 aa] {O...    39   0.031
Kpol_1018.35 s1018 (118605..120158) [1554 bp, 517 aa] {ON} (1186...    39   0.032
SAKL0F16170g Chr6 complement(1310627..1311940) [1314 bp, 437 aa]...    39   0.033
CAGL0G10021g Chr7 complement(959154..960338) [1185 bp, 394 aa] {...    39   0.033
Smik_12.194 Chr12 complement(385837..388146) [2310 bp, 769 aa] {...    39   0.036
Ecym_2673 Chr2 complement(1297046..1297951) [906 bp, 301 aa] {ON...    39   0.036
Kpol_1003.50 s1003 (114648..116492) [1845 bp, 614 aa] {ON} (1146...    39   0.036
CAGL0I02816g Chr9 complement(247817..248692) [876 bp, 291 aa] {O...    38   0.036
KLLA0B07909g Chr2 (697885..700653) [2769 bp, 922 aa] {ON} some s...    39   0.038
ZYRO0E02684g Chr5 (208420..208821) [402 bp, 133 aa] {ON} weakly ...    37   0.038
KAFR0B01990 Chr2 complement(386456..387688) [1233 bp, 410 aa] {O...    39   0.040
KNAG0D04190 Chr4 complement(754846..757878) [3033 bp, 1010 aa] {...    39   0.040
Smik_4.500 Chr4 complement(908879..909460) [582 bp, 193 aa] {ON}...    37   0.043
Kpol_1050.116 s1050 complement(264361..265350) [990 bp, 329 aa] ...    38   0.043
KLTH0D06798g Chr4 complement(594639..594974) [336 bp, 111 aa] {O...    36   0.047
NDAI0G02560 Chr7 (585170..587554) [2385 bp, 794 aa] {ON} Anc_8.326     39   0.048
Skud_12.200 Chr12 complement(387195..389498) [2304 bp, 767 aa] {...    39   0.048
KAFR0H01290 Chr8 complement(243463..244455) [993 bp, 330 aa] {ON...    38   0.051
SAKL0D02618g Chr4 complement(208093..209058) [966 bp, 321 aa] {O...    38   0.055
Smik_6.150 Chr6 complement(248356..250776) [2421 bp, 806 aa] {ON...    38   0.056
KLLA0B03454g Chr2 complement(314015..315433) [1419 bp, 472 aa] {...    38   0.056
SAKL0H15488g Chr8 (1347432..1349828) [2397 bp, 798 aa] {ON} simi...    38   0.058
ZYRO0F10428g Chr6 complement(846822..849263) [2442 bp, 813 aa] {...    38   0.058
YBR066C Chr2 complement(370037..370699) [663 bp, 220 aa] {ON}  N...    37   0.059
Suva_2.307 Chr2 complement(544040..546115) [2076 bp, 691 aa] {ON...    38   0.060
NCAS0B04500 Chr2 (815788..819411) [3624 bp, 1207 aa] {ON} Anc_8....    38   0.060
ZYRO0A02288g Chr1 (181918..183777) [1860 bp, 619 aa] {ON} simila...    38   0.065
Skud_7.364 Chr7 complement(609656..612088) [2433 bp, 810 aa] {ON...    38   0.066
NCAS0A10650 Chr1 complement(2121866..2122747) [882 bp, 293 aa] {...    37   0.069
YDR146C Chr4 complement(748613..750742) [2130 bp, 709 aa] {ON}  ...    38   0.070
KNAG0D02220 Chr4 (378969..382589) [3621 bp, 1206 aa] {ON} Anc_8....    38   0.073
NCAS0F03740 Chr6 complement(752361..753227) [867 bp, 288 aa] {ON...    37   0.074
NCAS0A15270 Chr1 complement(3003516..3004817) [1302 bp, 433 aa] ...    38   0.074
TPHA0L01320 Chr12 complement(275431..275937) [507 bp, 168 aa] {O...    36   0.076
NCAS0A02310 Chr1 complement(433632..436271) [2640 bp, 879 aa] {O...    38   0.080
YGR067C Chr7 complement(622372..624786) [2415 bp, 804 aa] {ON} P...    38   0.087
TDEL0D01950 Chr4 complement(377508..379775) [2268 bp, 755 aa] {O...    38   0.087
Kpol_1050.109 s1050 complement(246366..247520) [1155 bp, 384 aa]...    37   0.087
SAKL0D15136g Chr4 (1255926..1256741) [816 bp, 271 aa] {ON} some ...    37   0.088
Ecym_8387 Chr8 complement(790075..790614) [540 bp, 179 aa] {ON} ...    36   0.088
YDR253C Chr4 complement(963990..964565) [576 bp, 191 aa] {ON}  M...    37   0.090
Suva_7.349 Chr7 complement(598667..601105) [2439 bp, 812 aa] {ON...    38   0.090
KNAG0D00900 Chr4 (144302..145270) [969 bp, 322 aa] {ON} Anc_6.25...    37   0.094
KNAG0A05170 Chr1 (761499..763436) [1938 bp, 645 aa] {ON} Anc_8.3...    37   0.096
Ecym_2760 Chr2 complement(1473533..1476349) [2817 bp, 938 aa] {O...    38   0.096
TDEL0F04510 Chr6 complement(846575..848806) [2232 bp, 743 aa] {O...    37   0.098
Skud_4.405 Chr4 complement(720227..722350) [2124 bp, 707 aa] {ON...    37   0.11 
NCAS0B04670 Chr2 (852849..853649) [801 bp, 266 aa] {ON}                37   0.11 
Kwal_14.2543 s14 (807668..809803) [2136 bp, 711 aa] {ON} YJL056C...    37   0.11 
TDEL0B01500 Chr2 (265906..266292) [387 bp, 128 aa] {ON} Anc_8.48...    35   0.12 
NDAI0D04240 Chr4 complement(993054..996563) [3510 bp, 1169 aa] {...    37   0.12 
NDAI0B03080 Chr2 complement(785326..786708) [1383 bp, 460 aa] {O...    37   0.12 
Kwal_23.5400 s23 complement(1143487..1144776) [1290 bp, 429 aa] ...    37   0.13 
Smik_4.390 Chr4 complement(709330..711456) [2127 bp, 708 aa] {ON...    37   0.13 
Suva_4.305 Chr4 complement(536954..537616) [663 bp, 220 aa] {ON}...    36   0.13 
AFR580C Chr6 complement(1478501..1481017) [2517 bp, 838 aa] {ON}...    37   0.13 
Smik_10.184 Chr10 complement(322050..324707) [2658 bp, 885 aa] {...    37   0.13 
TPHA0F00260 Chr6 (50020..51600) [1581 bp, 526 aa] {ON} Anc_4.21 ...    37   0.15 
TBLA0H01260 Chr8 (283947..285665) [1719 bp, 572 aa] {ON} Anc_8.3...    37   0.15 
NDAI0I03330 Chr9 complement(781013..782065) [1053 bp, 350 aa] {O...    37   0.15 
CAGL0L12562g Chr12 complement(1353174..1353845) [672 bp, 223 aa]...    36   0.16 
TBLA0A03960 Chr1 complement(989886..992438) [2553 bp, 850 aa] {O...    37   0.16 
Skud_2.189 Chr2 complement(338427..339089) [663 bp, 220 aa] {ON}...    36   0.16 
Suva_2.419 Chr2 complement(743569..744144) [576 bp, 191 aa] {ON}...    36   0.16 
KLTH0G12254g Chr7 (1040230..1042470) [2241 bp, 746 aa] {ON} weak...    37   0.17 
TPHA0C00800 Chr3 (156349..158391) [2043 bp, 680 aa] {ON} Anc_8.3...    37   0.18 
CAGL0J05060g Chr10 (481253..483394) [2142 bp, 713 aa] {ON} simil...    37   0.19 
Kpol_344.4 s344 complement(5351..7621) [2271 bp, 756 aa] {ON} co...    37   0.20 
Suva_16.518 Chr16 complement(892114..893397) [1284 bp, 427 aa] {...    36   0.20 
Smik_2.199 Chr2 complement(351916..352578) [663 bp, 220 aa] {ON}...    35   0.20 
SAKL0B04664g Chr2 complement(410577..411857) [1281 bp, 426 aa] {...    36   0.21 
KNAG0F03980 Chr6 complement(754914..756041) [1128 bp, 375 aa] {O...    36   0.22 
KNAG0A02260 Chr1 (205510..206118) [609 bp, 202 aa] {ON} Anc_8.48...    35   0.23 
NCAS0A02160 Chr1 complement(406753..407991) [1239 bp, 412 aa] {O...    36   0.23 
TPHA0C01760 Chr3 (402424..402939) [516 bp, 171 aa] {ON} Anc_8.48...    35   0.24 
KNAG0H01070 Chr8 complement(178080..179048) [969 bp, 322 aa] {ON...    36   0.24 
NCAS0J02140 Chr10 complement(410960..415012) [4053 bp, 1350 aa] ...    36   0.28 
KAFR0B00280 Chr2 (65006..66256) [1251 bp, 416 aa] {ON} Anc_7.543...    36   0.29 
SAKL0H11440g Chr8 (982180..982797) [618 bp, 205 aa] {ON} similar...    35   0.29 
CAGL0E01331g Chr5 (124599..126668) [2070 bp, 689 aa] {ON} some s...    36   0.29 
TBLA0A00350 Chr1 complement(66653..67588) [936 bp, 311 aa] {ON} ...    35   0.30 
Kwal_56.23925 s56 complement(779625..781862) [2238 bp, 745 aa] {...    36   0.31 
KAFR0H02240 Chr8 (426388..428259) [1872 bp, 623 aa] {ON} Anc_8.3...    36   0.32 
TBLA0D02300 Chr4 (581398..584553) [3156 bp, 1051 aa] {ON} Anc_8....    36   0.34 
KAFR0B05740 Chr2 complement(1184382..1186241) [1860 bp, 619 aa] ...    36   0.34 
Skud_4.515 Chr4 complement(918500..919063) [564 bp, 187 aa] {ON}...    35   0.36 
Suva_16.349 Chr16 complement(610937..612562) [1626 bp, 541 aa] {...    35   0.37 
KLTH0H10538g Chr8 (910730..912778) [2049 bp, 682 aa] {ON} weakly...    35   0.38 
NDAI0J00990 Chr10 (226704..228863) [2160 bp, 719 aa] {ON} Anc_8....    35   0.40 
Suva_16.278 Chr16 (483789..484316) [528 bp, 175 aa] {ON} YPL038W...    34   0.42 
NCAS0A09160 Chr1 (1811448..1813769) [2322 bp, 773 aa] {ON} Anc_1...    35   0.43 
KAFR0G03050 Chr7 complement(633014..635263) [2250 bp, 749 aa] {O...    35   0.43 
NCAS0B04660 Chr2 (850607..851377) [771 bp, 256 aa] {ON}                35   0.44 
KAFR0E02900 Chr5 complement(584018..584575) [558 bp, 185 aa] {ON...    34   0.46 
Suva_16.338 Chr16 complement(594847..595590) [744 bp, 247 aa] {O...    35   0.47 
TDEL0E01590 Chr5 (312468..314780) [2313 bp, 770 aa] {ON} Anc_4.2...    35   0.47 
NCAS0C03240 Chr3 (636172..638034) [1863 bp, 620 aa] {ON} Anc_8.326     35   0.51 
Ecym_2817 Chr2 complement(1587029..1588324) [1296 bp, 431 aa] {O...    35   0.55 
YPR022C Chr16 complement(603911..607312) [3402 bp, 1133 aa] {ON}...    35   0.57 
KLLA0E13487g Chr5 complement(1190615..1191307) [693 bp, 230 aa] ...    34   0.59 
TBLA0I01970 Chr9 complement(446033..446899) [867 bp, 288 aa] {ON...    34   0.59 
NCAS0B03600 Chr2 complement(637749..639656) [1908 bp, 635 aa] {O...    35   0.60 
Kwal_34.15946 s34 complement(130149..130988) [840 bp, 279 aa] {O...    34   0.62 
KNAG0E02610 Chr5 complement(517056..519296) [2241 bp, 746 aa] {O...    35   0.62 
NCAS0B02480 Chr2 (414819..415418) [600 bp, 199 aa] {ON} Anc_8.48...    34   0.65 
KNAG0I00130 Chr9 (10977..11972) [996 bp, 331 aa] {ON}                  34   0.67 
Ecym_2536 Chr2 complement(1041642..1042364) [723 bp, 240 aa] {ON...    34   0.70 
Smik_16.450 Chr16 complement(772259..773557) [1299 bp, 432 aa] {...    35   0.70 
Suva_13.247 Chr13 (391743..391805) [63 bp, 21 aa] {OFF} YMR070W ...    30   0.71 
YPR186C Chr16 complement(909733..911022) [1290 bp, 429 aa] {ON} ...    34   0.76 
KLTH0H15048g Chr8 (1303474..1304364) [891 bp, 296 aa] {ON} some ...    34   0.77 
Smik_16.197 Chr16 (357835..358350) [516 bp, 171 aa] {ON} YPL038W...    33   0.77 
Smik_16.263 Chr16 complement(479612..482980) [3369 bp, 1122 aa] ...    35   0.77 
TBLA0B06410 Chr2 (1511970..1513319) [1350 bp, 449 aa] {ON} Anc_2...    34   0.79 
Ecym_8377 Chr8 complement(764541..765473) [933 bp, 310 aa] {ON} ...    34   0.88 
KAFR0H01500 Chr8 (277542..278336) [795 bp, 264 aa] {ON} Anc_8.48...    34   0.88 
Skud_16.490 Chr16 complement(852079..853302) [1224 bp, 407 aa] {...    34   0.88 
ZYRO0D00902g Chr4 (68162..69379) [1218 bp, 405 aa] {ON} similar ...    34   0.91 
KLLA0D11902g Chr4 (1015273..1016142) [870 bp, 289 aa] {ON} some ...    34   0.95 
Skud_16.307 Chr16 complement(568219..570672,570703..571623) [337...    34   0.97 
Kwal_27.10467 s27 complement(354071..354979) [909 bp, 302 aa] {O...    34   1.0  
SAKL0B05434g Chr2 (467863..468897) [1035 bp, 344 aa] {ON} some s...    34   1.0  
NDAI0J00160 Chr10 (19695..21068) [1374 bp, 457 aa] {ON} Anc_7.543      34   1.1  
Kwal_27.11824 s27 complement(959535..960134) [600 bp, 199 aa] {O...    33   1.2  
NDAI0E03120 Chr5 (662597..663316) [720 bp, 239 aa] {ON} Anc_8.48...    33   1.2  
NCAS0J00640 Chr10 complement(98043..98351) [309 bp, 102 aa] {ON}       32   1.2  
Skud_16.300 Chr16 complement(554576..555325) [750 bp, 249 aa] {O...    33   1.5  
Smik_16.255 Chr16 complement(465909..466652) [744 bp, 247 aa] {O...    33   1.6  
Kpol_543.29 s543 complement(59228..60583) [1356 bp, 451 aa] {ON}...    33   1.6  
KLTH0E11330g Chr5 complement(1013019..1013618) [600 bp, 199 aa] ...    33   1.7  
KLTH0A00682g Chr1 (69084..70385) [1302 bp, 433 aa] {ON} similar ...    33   1.7  
Skud_16.243 Chr16 (445581..446114) [534 bp, 177 aa] {ON} YPL038W...    32   1.7  
CAGL0E03762g Chr5 complement(351240..352994) [1755 bp, 584 aa] {...    33   1.8  
TPHA0O01440 Chr15 (289051..291387) [2337 bp, 778 aa] {ON} Anc_1....    33   2.1  
YPR015C Chr16 complement(590283..591026) [744 bp, 247 aa] {ON} P...    32   2.2  
TDEL0F01030 Chr6 (182054..185287) [3234 bp, 1077 aa] {ON} Anc_8....    33   2.5  
NCAS0C02430 Chr3 (453975..454574) [600 bp, 199 aa] {ON} Anc_8.486      32   2.5  
KAFR0F03940 Chr6 complement(769153..770511) [1359 bp, 452 aa] {O...    33   2.6  
Kwal_47.16577 s47 complement(9960..12605) [2646 bp, 881 aa] {ON}...    33   2.7  
KAFR0B02050 Chr2 complement(402767..405958) [3192 bp, 1063 aa] {...    33   2.7  
Kpol_1037.4 s1037 complement(5813..7414) [1602 bp, 533 aa] {ON} ...    33   2.7  
KLTH0C04884g Chr3 complement(422344..423372) [1029 bp, 342 aa] {...    32   2.8  
ADL040W Chr4 (618852..619844) [993 bp, 330 aa] {ON} Syntenic hom...    32   2.9  
AEL278W Chr5 (117043..118473) [1431 bp, 476 aa] {ON} Syntenic ho...    32   3.1  
NCAS0F01370 Chr6 complement(270474..270977) [504 bp, 167 aa] {ON}      32   3.3  
Ecym_8389 Chr8 (797626..798381) [756 bp, 251 aa] {ON} similar to...    32   3.4  
KLTH0G17336g Chr7 (1500141..1501598) [1458 bp, 485 aa] {ON} some...    32   3.4  
NCAS0A02360 Chr1 (448263..449699) [1437 bp, 478 aa] {ON} Anc_4.222     32   3.4  
Kpol_489.4 s489 (17106..18125) [1020 bp, 339 aa] {ON} (17106..18...    32   3.7  
CAGL0M04323g Chr13 complement(474158..476269) [2112 bp, 703 aa] ...    32   4.0  
NCAS0E00170 Chr5 (20556..21539) [984 bp, 327 aa] {ON}                  32   4.2  
ZYRO0F08162g Chr6 complement(660746..661294) [549 bp, 182 aa] {O...    31   4.2  
SAKL0F00242g Chr6 (16275..17150) [876 bp, 291 aa] {ON} similar t...    31   5.9  
CAGL0K04257g Chr11 complement(392116..393759) [1644 bp, 547 aa] ...    32   6.5  
KNAG0D04020 Chr4 complement(726098..727558) [1461 bp, 486 aa] {O...    32   6.6  
TDEL0E01860 Chr5 (353978..354790) [813 bp, 270 aa] {ON} Anc_4.18...    31   6.8  
Kpol_1031.73 s1031 complement(186968..187513) [546 bp, 181 aa] {...    30   6.9  
Kpol_1035.22 s1035 (53205..55598) [2394 bp, 797 aa] {ON} (53205....    31   7.7  
NDAI0C05210 Chr3 complement(1209022..1209789) [768 bp, 255 aa] {...    31   7.7  
Skud_8.17 Chr8 (39078..40961) [1884 bp, 627 aa] {ON} YHL027W (REAL)    31   8.3  
KLLA0A10373g Chr1 complement(907244..907864) [621 bp, 206 aa] {O...    30   8.5  
KLTH0E03124g Chr5 complement(280411..283056) [2646 bp, 881 aa] {...    31   9.0  
CAGL0K02343g Chr11 (209474..212962) [3489 bp, 1162 aa] {ON} simi...    31   9.3  
CAGL0K04697g Chr11 (459195..460742) [1548 bp, 515 aa] {ON} some ...    31   9.4  

>KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa]
           {ON} Anc_2.533 YMR070W
          Length = 554

 Score =  837 bits (2163), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/554 (77%), Positives = 431/554 (77%)

Query: 1   MNPWIRQLAPQYPLMVDXXXXXXXXXXXXXXXXXVLVNENNGFKRDQRTLLHPLSSTPRN 60
           MNPWIRQLAPQYPLMVD                 VLVNENNGFKRDQRTLLHPLSSTPRN
Sbjct: 1   MNPWIRQLAPQYPLMVDNNNNNTSNNPGANNSGGVLVNENNGFKRDQRTLLHPLSSTPRN 60

Query: 61  SESLPANSNTVANGYGYQLFQPYVLQPSPHYQAYQNAPANYNMLAXXXXXXXXXXXXXXX 120
           SESLPANSNTVANGYGYQLFQPYVLQPSPHYQAYQNAPANYNMLA               
Sbjct: 61  SESLPANSNTVANGYGYQLFQPYVLQPSPHYQAYQNAPANYNMLAQQQQQQHHQQQAQQG 120

Query: 121 XXXXXXXXXXXXPYHYQYNVLRLSQPTVGSPTPSIXXXXXXXXXXXXXXXXXXXXXXXVT 180
                       PYHYQYNVLRLSQPTVGSPTPSI                       VT
Sbjct: 121 QRPQAQQTPQQGPYHYQYNVLRLSQPTVGSPTPSINSLTGSANSANGSNGIGNQNGSGVT 180

Query: 181 SNSTLSFGIGQPSDGXXXXXXXXXXXXXXXXXXXXXXXXXKSVAXXXXXXXXXXXHSPLI 240
           SNSTLSFGIGQPSDG                         KSVA           HSPLI
Sbjct: 181 SNSTLSFGIGQPSDGLGSNNSSNSSLSSSSSTSNNNSTGSKSVATTTNNGTTKKTHSPLI 240

Query: 241 YDLRTVVTPHSLISINDQKPGNGSNNGRGSFVAGTPRLARNDSTSEAPPPQQVNGAMNPK 300
           YDLRTVVTPHSLISINDQKPGNGSNNGRGSFVAGTPRLARNDSTSEAPPPQQVNGAMNPK
Sbjct: 241 YDLRTVVTPHSLISINDQKPGNGSNNGRGSFVAGTPRLARNDSTSEAPPPQQVNGAMNPK 300

Query: 301 HYAXXXXXXXXXXXXXXQRMLNPAPFQQQLYSIPMNGPXXXXXXRHHSYSGAVINNPTPG 360
           HYA              QRMLNPAPFQQQLYSIPMNGP      RHHSYSGAVINNPTPG
Sbjct: 301 HYAGTNFNNGMGNNNNGQRMLNPAPFQQQLYSIPMNGPYQYQQQRHHSYSGAVINNPTPG 360

Query: 361 YSLSNSALATSSKFPFGDDANGNGTDNILKKGTGANDITGIVNNGTIPSEQDTSNNKLTI 420
           YSLSNSALATSSKFPFGDDANGNGTDNILKKGTGANDITGIVNNGTIPSEQDTSNNKLTI
Sbjct: 361 YSLSNSALATSSKFPFGDDANGNGTDNILKKGTGANDITGIVNNGTIPSEQDTSNNKLTI 420

Query: 421 TTLTNSDNSSPSNFIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLL 480
           TTLTNSDNSSPSNFIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLL
Sbjct: 421 TTLTNSDNSSPSNFIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLL 480

Query: 481 QHMKLKHSNYLLDELKNANVSFNWGTYDGQNSTDSMPKTLSGYPDSSIKKLLYRGILNKD 540
           QHMKLKHSNYLLDELKNANVSFNWGTYDGQNSTDSMPKTLSGYPDSSIKKLLYRGILNKD
Sbjct: 481 QHMKLKHSNYLLDELKNANVSFNWGTYDGQNSTDSMPKTLSGYPDSSIKKLLYRGILNKD 540

Query: 541 DVKRVLNKIIERSN 554
           DVKRVLNKIIERSN
Sbjct: 541 DVKRVLNKIIERSN 554

>KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.533
           YMR070W
          Length = 490

 Score =  159 bits (401), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 79/134 (58%), Positives = 92/134 (68%), Gaps = 20/134 (14%)

Query: 425 NSDNSSPS-----NFIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNL 479
           N+DNSS         IH CHLCEKSF+R+SWLKRHLLSHS ER +LCPWCLSRHKRKDNL
Sbjct: 337 NTDNSSNVIGGNLTLIHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNL 396

Query: 480 LQHMKLKHSNYLLDELKNANVSF---NWGTYDGQNSTDSMPKTLSGYPDSSIKKLLYRGI 536
           LQHMKLKHSNYL+ ELK  N  F   N G  +  N TD             I+ L+  G+
Sbjct: 397 LQHMKLKHSNYLVIELKKNNAVFSCVNGGNREKLNDTD------------DIRNLISLGV 444

Query: 537 LNKDDVKRVLNKII 550
           +NKDDVK+V+NK+I
Sbjct: 445 INKDDVKKVINKLI 458

>Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 aa]
           {ON} YMR070W (REAL)
          Length = 473

 Score =  157 bits (396), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 95/142 (66%), Gaps = 16/142 (11%)

Query: 429 SSPSNFIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHS 488
           SS   +IH+C  CEKSFKR+SWLKRHLLSHS +RH+LCPWCLSR KRKDNLLQHMKLKH+
Sbjct: 331 SSDHKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHT 390

Query: 489 NYLLDELKNANVSFNW---------------GTYDGQNSTDSMPKTLSGYP-DSSIKKLL 532
           NYLLDELK  N+ FN+                +  G  S  + P+   G   D +IK L+
Sbjct: 391 NYLLDELKKNNIIFNYNNSSINSNNSNNNNSASGSGGGSAAAAPENEDGNSYDPNIKTLI 450

Query: 533 YRGILNKDDVKRVLNKIIERSN 554
             G+LNKDDVKRVLN +I   N
Sbjct: 451 NDGVLNKDDVKRVLNNLIVSHN 472

>TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.533
           YMR070W
          Length = 239

 Score =  149 bits (375), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 71/149 (47%), Positives = 97/149 (65%), Gaps = 16/149 (10%)

Query: 406 TIPSEQDTSNNKLTITTLTNSDNSSPSNFIHKCHLCEKSFKRRSWLKRHLLSHSAERHYL 465
           +IP ++  +   L+  +  + +      ++HKCHLC KSFKR+SWL+RHLLSHS  RH+ 
Sbjct: 104 SIPGQRAVAVASLSSNSADDEEQREAQGYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFS 163

Query: 466 CPWCLSRHKRKDNLLQHMKLKHSNYLLDELKNANVSFNWGTYDGQNSTDSMPKTLSGYPD 525
           CPWCLS+HKRKDNLLQHMKLKH++Y+L EL+  NV                  +  G   
Sbjct: 164 CPWCLSKHKRKDNLLQHMKLKHTDYVLQELRLNNVYV----------------STEGSCK 207

Query: 526 SSIKKLLYRGILNKDDVKRVLNKIIERSN 554
           ++I+ LLY G LNKD+VK+VLN +I+R N
Sbjct: 208 NNIRTLLYEGRLNKDEVKKVLNSLIDRHN 236

>YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}
           MOT3Transcriptional repressor and activator with two
           C2-H2 zinc fingers; involved in repression of a subset
           of hypoxic genes by Rox1p, repression of several DAN/TIR
           genes during aerobic growth, and repression of
           ergosterol biosynthetic genes in response to
           hyperosmotic stress; contributes to recruitment of the
           Tup1p-Cyc8p general repressor to promoters; involved in
           positive transcriptional regulation of CWP2 and other
           genes; can form the [MOT3+] prion
          Length = 490

 Score =  154 bits (389), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 79/152 (51%), Positives = 95/152 (62%), Gaps = 27/152 (17%)

Query: 429 SSPSNFIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHS 488
           SS   +IH+C  CEKSFKR+SWLKRHLLSHS +RH+LCPWCLSR KRKDNLLQHMKLKH+
Sbjct: 339 SSDHKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHT 398

Query: 489 NYLLDELKNANVSFNWGTYDGQNSTDSMPKTL--------------------------SG 522
           NYLLDELK  N+ FN+      N+ +                                +G
Sbjct: 399 NYLLDELKKNNIIFNYNNSSSSNNNNDNNNNNNSNSASGSGGAGAAAAAATAPENEDGNG 458

Query: 523 YPDSSIKKLLYRGILNKDDVKRVLNKIIERSN 554
           Y D++IK L+  G+LNKDDVKRVLN +I   N
Sbjct: 459 Y-DTNIKTLINDGVLNKDDVKRVLNNLIVSHN 489

>Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)
           [1428 bp, 475 aa] {ON} YMR070W (REAL)
          Length = 475

 Score =  152 bits (385), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 94/154 (61%), Gaps = 28/154 (18%)

Query: 429 SSPSNFIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHS 488
           SS   +IH+C  CEKSFKR+SWLKRHLLSHS +RH+LCPWCLSR KRKDNLLQHMKLKH+
Sbjct: 321 SSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHT 380

Query: 489 NYLLDELKNANVSFNWG---------------------------TYDGQNSTDSMPKTLS 521
           NYLLDELK  N+ FN+                               G  +  + P+   
Sbjct: 381 NYLLDELKKNNIIFNYNKTSTNSNDNNNSTSTRTSASASSGGGGGGGGGAAAAAAPENED 440

Query: 522 GYP-DSSIKKLLYRGILNKDDVKRVLNKIIERSN 554
           G   D +IK L+  G+LNKDDVKRVLN +I   N
Sbjct: 441 GSSYDPNIKTLINDGVLNKDDVKRVLNNLIVSHN 474

>NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {ON}
           Anc_2.533
          Length = 525

 Score =  152 bits (384), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 92/136 (67%), Gaps = 16/136 (11%)

Query: 433 NFIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLL 492
           N ++ CH+C K+FKRRSWLKRHLLSHS+ERHY CPWCLSRHKR+DNLLQHMKLKHS  L+
Sbjct: 385 NAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNLI 444

Query: 493 DELKNANVSFNWGTYDGQNSTDS---------MPKTLSGY-------PDSSIKKLLYRGI 536
           +ELK  NV F+W  Y  Q              MP  + G         + +I+ L+  G+
Sbjct: 445 NELKFRNVIFDWHNYHYQQQVQRHQQYQQQGGMPPQIHGANEPFNINSEFTIRTLVTNGV 504

Query: 537 LNKDDVKRVLNKIIER 552
           +NK+DVKRVLN++++ 
Sbjct: 505 VNKEDVKRVLNQLVDE 520

>CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakly
           similar to uniprot|P54785 Saccharomyces cerevisiae
           YMR070w MOT3
          Length = 647

 Score =  149 bits (377), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 68/124 (54%), Positives = 89/124 (71%), Gaps = 11/124 (8%)

Query: 434 FIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLD 493
           F H+CHLC K FKR+SWLKRHLLSHS +RH+LCPWC SRHKR+DNLLQHMKLKH   LL 
Sbjct: 532 FPHRCHLCPKLFKRKSWLKRHLLSHSQQRHFLCPWCNSRHKRRDNLLQHMKLKHVPNLLQ 591

Query: 494 ELKNANVSFNWGTYDGQNSTDSMPKTLSG---YPDSSIKKLLYRGILNKDDVKRVLNKII 550
           E+ + N+ FNW         + + K + G   YPD+  K L++ G+LNKD++K +LN +I
Sbjct: 592 EINSRNMRFNWPIL------ERLSKQIDGTIEYPDT--KTLIHEGLLNKDELKNILNTVI 643

Query: 551 ERSN 554
           ++ N
Sbjct: 644 DKHN 647

>NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {ON}
           Anc_2.533
          Length = 541

 Score =  146 bits (368), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 100/158 (63%), Gaps = 25/158 (15%)

Query: 419 TITTLTNSDNSSPSNFIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDN 478
           TI ++   D  S S   ++C +CEK FKRRSWLKRHLLSHS+ERHYLCPWCLSRHKR+DN
Sbjct: 386 TILSMGEFDIESQS---YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDN 442

Query: 479 LLQHMKLKHSNYLLDELK----------NANVSFNWGTYDGQNST-DSMPKTLSGYPDS- 526
           LLQHMKLKH N L++ELK           A+V+F         S  D M  T++G  D+ 
Sbjct: 443 LLQHMKLKHPNNLINELKLRNFISSQTAAASVAFVTSAAPSIMSINDGMNNTVAGTVDNA 502

Query: 527 ----------SIKKLLYRGILNKDDVKRVLNKIIERSN 554
                     +IK L+  G++NK+DVKR+LN +I+  N
Sbjct: 503 VSTPGYETGITIKDLISEGLINKEDVKRLLNILIDEYN 540

>ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 294

 Score =  139 bits (351), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 84/119 (70%), Gaps = 17/119 (14%)

Query: 436 HKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLDEL 495
           H C +C+KSFKR+SWL+RHLLSHS ERH+ CPWCLS+HKRKDNLLQHMKLKH+ Y+L++L
Sbjct: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKL 251

Query: 496 KNANVSFNWGTYDGQNSTDSMPKTLSGYPDSSIKKLLYRGILNKDDVKRVLNKIIERSN 554
           +N NV       DG+   D            +I+ LL  G LNK+DVK+VLN +I+  N
Sbjct: 252 RNQNVGI-----DGEVRND------------NIRTLLCEGRLNKEDVKKVLNGLIDSYN 293

>Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {ON}
           complement(96025..97794) [1770 nt, 590 aa]
          Length = 589

 Score =  144 bits (362), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 89/122 (72%), Gaps = 8/122 (6%)

Query: 433 NFIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLL 492
           NF H CH+C K FKR+SWL+RHLLSHS+ER++ CPWCLS+HKRKDNLLQHMKLKH+  +L
Sbjct: 474 NFAHVCHICGKQFKRKSWLQRHLLSHSSERNFDCPWCLSKHKRKDNLLQHMKLKHAENVL 533

Query: 493 DELKNANVSFNWGTYDGQNSTDSMPKTLSGYPDSSIKKLLYRGILNKDDVKRVLNKIIER 552
           ++L+  N+  N       N  D+   TL G  D +I+ L+  GILNKD+VK++LN ++ +
Sbjct: 534 EQLR-INLKAN-------NPNDNSEPTLEGNGDHNIRTLMGEGILNKDEVKKLLNSLVAQ 585

Query: 553 SN 554
            N
Sbjct: 586 HN 587

>SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 388

 Score =  138 bits (347), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 71/127 (55%), Positives = 87/127 (68%), Gaps = 9/127 (7%)

Query: 436 HKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLDEL 495
           H+CHLC+KSFKR+SWLKRHLLSHS+ + + CPWC SRHKRKDNLLQHMKLKH+  +L EL
Sbjct: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQEL 317

Query: 496 KNANVS--------FNWGTYDGQNSTDSM-PKTLSGYPDSSIKKLLYRGILNKDDVKRVL 546
           ++A V          N  +  GQN   S+ P        +SIK ++  G LNKDDVKRVL
Sbjct: 318 QSAGVHPIVSNITLINLASTAGQNGVPSLVPVHGDMSMMTSIKTMIDDGTLNKDDVKRVL 377

Query: 547 NKIIERS 553
           N +I RS
Sbjct: 378 NMLINRS 384

>NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {ON}
           Anc_2.533
          Length = 511

 Score =  140 bits (352), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 87/120 (72%), Gaps = 7/120 (5%)

Query: 435 IHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLDE 494
           +++CH+C KSF+R SWLKRHLL+HS++RHY CP C+S+HKRKDNLLQH+KLKH+ ++L++
Sbjct: 386 VYQCHMCVKSFRRHSWLKRHLLAHSSQRHYSCPKCVSKHKRKDNLLQHLKLKHTAFVLEQ 445

Query: 495 LKNANVSFNWGTYDGQNSTDSMPKTLSGYPDSSIKKLLYRGILNKDDVKRVLNKIIERSN 554
           L+  N+       +G+    +   T       +IK LL  G LNK+DVK+VLN++I+ +N
Sbjct: 446 LRQDNIDIKTAKDEGEEDQGTASNT-------NIKTLLVEGRLNKEDVKKVLNRLIDSAN 498

>TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.533
           YMR070W
          Length = 216

 Score =  130 bits (326), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 61/116 (52%), Positives = 82/116 (70%), Gaps = 13/116 (11%)

Query: 436 HKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLDEL 495
           HKC  CEK FKR+SWLKRH+LSHS ER Y CPWC+SRHKRKDNLLQHMKLKH++ +L +L
Sbjct: 113 HKCPQCEKRFKRKSWLKRHMLSHSEERQYSCPWCISRHKRKDNLLQHMKLKHTDEVLKKL 172

Query: 496 KNANVSFNWGTYDGQNSTDSMPKTLSGYPDSSIKKLLYRGILNKDDVKRVLNKIIE 551
           K           +G +  + M +        +I+ +LY G+L+KD+VK+VLN+++E
Sbjct: 173 KMT------CYLEGDDGEEMMNR-------DNIRTMLYEGLLDKDEVKKVLNELLE 215

>Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070W
           (REAL)
          Length = 419

 Score =  135 bits (339), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 64/74 (86%)

Query: 429 SSPSNFIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHS 488
           SS   +IH+C  CEKSFKR+SWLKRHLLSHS +RH+LCPWCLSR KRKDNLLQHMKLKH+
Sbjct: 320 SSDQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHT 379

Query: 489 NYLLDELKNANVSF 502
           NYLLDELK  N+ F
Sbjct: 380 NYLLDELKKNNIIF 393

>NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {ON}
           Anc_2.533
          Length = 730

 Score =  132 bits (331), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 66/138 (47%), Positives = 87/138 (63%), Gaps = 18/138 (13%)

Query: 435 IHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLDE 494
           + +C  C KSFKR SWLKRHLL+HS ERHY CPWCLS+HKRKDNLLQH+KLKH+  +L +
Sbjct: 559 VFQCSYCVKSFKRFSWLKRHLLAHSPERHYSCPWCLSKHKRKDNLLQHLKLKHTEMVLQQ 618

Query: 495 LKNANVSFNW-------GTYDGQNSTDSMPKTLSGY-----------PDSSIKKLLYRGI 536
           L+  N+  +           D    + S+    SG            P ++IK LLY G 
Sbjct: 619 LRLENIEISTIEETMEDRRVDVHERSKSVDTGTSGVNDDIDIKNVKQPGTNIKTLLYDGR 678

Query: 537 LNKDDVKRVLNKIIERSN 554
           LNK+DVK+VLNK+++ +N
Sbjct: 679 LNKEDVKKVLNKLLDGTN 696

>TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.533
           YMR070W
          Length = 387

 Score =  121 bits (303), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 85/133 (63%), Gaps = 14/133 (10%)

Query: 434 FIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLL- 492
           +I +C++C K FKR+SWLKRHLLSHS+ R Y CPWCLS+HKRKDNLLQHMKLKH   +L 
Sbjct: 252 YIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQ 311

Query: 493 --DELKNANVSFNWGTYDGQNSTD--------SMPKTLSGYPDS---SIKKLLYRGILNK 539
             D+L  +++  N  +  G ++          SM    SG   +   SI  ++  G L K
Sbjct: 312 EMDKLSESSLELNDESSTGTDTASPIVNETALSMLNDDSGSSSNDNVSIIAMVDNGTLKK 371

Query: 540 DDVKRVLNKIIER 552
           ++VK+VLN IIER
Sbjct: 372 ENVKKVLNSIIER 384

>Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}
           similar to Ashbya gossypii AGL071C
          Length = 544

 Score =  123 bits (308), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 92/153 (60%), Gaps = 20/153 (13%)

Query: 418 LTITTLTNSDNSSPSNF--IHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKR 475
           + ++ +T+S    P++F  IHKCH CEK+FKR+SWLKRHLLSHS  + Y CPWC SRHKR
Sbjct: 266 IGVSNVTSSQLMDPNSFENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKR 325

Query: 476 KDNLLQHMKLKHSNYLLDEL-----------------KNANVSFNWGTYDGQNSTDSMPK 518
           KDNL QH+KLKH+  LL+ L                  N  V+    + D   +  S   
Sbjct: 326 KDNLSQHLKLKHAEMLLERLSSNPNTASHLMNRLHSGANGAVAVTAASADSSATMVSSSS 385

Query: 519 TLSGYPDS-SIKKLLYRGILNKDDVKRVLNKII 550
           + +  P + SIK ++  G+L+K++VK+ LN +I
Sbjct: 386 SSAAGPTTFSIKDMIDSGMLSKNEVKKTLNSLI 418

>Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W
           (MOT3) - 2 Cys2-His2 zinc fingers at c-terminus,
           glutamine and asparagine rich [contig 55] FULL
          Length = 507

 Score =  122 bits (305), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 57/119 (47%), Positives = 74/119 (62%), Gaps = 6/119 (5%)

Query: 436 HKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLDEL 495
           ++C +C+KSFKRRSW KRHLLSHS+ + Y CPWC SRHKR+DNL QHMK KH  +++ EL
Sbjct: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQEL 448

Query: 496 KNANVSFNWGTYDGQNSTDSMPKTLSGYPDSSIKKLLYRGILNKDDVKRVLNKIIERSN 554
                    G  DG   +     +    P+ SIK L+  G + K+ VK VLN +I R N
Sbjct: 449 ------LEVGDVDGSVMSGMQVTSDESAPEPSIKTLIQDGQVKKERVKAVLNAVIARVN 501

>KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]
           {ON} some similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 431

 Score =  120 bits (301), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 59/124 (47%), Positives = 79/124 (63%), Gaps = 10/124 (8%)

Query: 436 HKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLDEL 495
           ++CHLCEK F+R+SWLKRHLLSHS  + + CPWC S HKRKDNLLQH+KLKH+ YLL E 
Sbjct: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLLHEF 365

Query: 496 KNANVSFNWGTYDGQNSTDSMPKTLSG--------YPDSSIKKLLYRGILNKDDVKRVLN 547
               +  N    +G  +T ++  T +G         P ++I+ +L    L KD VKR LN
Sbjct: 366 TLFGILMNVN--NGSGNTANLVTTSTGETICLINNEPSTTIRDMLDSNALPKDQVKRCLN 423

Query: 548 KIIE 551
            I++
Sbjct: 424 YIVD 427

>AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR070W
           (MOT3)
          Length = 396

 Score =  119 bits (299), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 59/119 (49%), Positives = 75/119 (63%), Gaps = 3/119 (2%)

Query: 435 IHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLDE 494
           IHKCH CEK+FKR+SWLKRHLLSHS  + Y CPWC SRHKRKDNL QH+KLKH+  LL+ 
Sbjct: 184 IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLER 243

Query: 495 LK---NANVSFNWGTYDGQNSTDSMPKTLSGYPDSSIKKLLYRGILNKDDVKRVLNKII 550
           L    N   S     +    +  S           SIK ++  G+L+K++VK+ LN +I
Sbjct: 244 LSSNPNTPTSLINRLHSSDAAAGSAAAAAGTPAAFSIKDMIDSGMLSKNEVKKTLNSLI 302

>KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 506

 Score =  117 bits (293), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 75/126 (59%), Gaps = 6/126 (4%)

Query: 427 DNSSPSNFIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLK 486
           D  S    +++C +CEKSFKR+SW +RHLLSHS+ + Y CPWC SRHKR+DNL QHMK K
Sbjct: 379 DTGSSMAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTK 438

Query: 487 HSNYLLDELKNANVSFNWGTYDGQNSTDSMPKTLSGYPDSSIKKLLYRGILNKDDVKRVL 546
           H + +L EL  A      G  DG   T+            SI+ L+  G + K+ VK VL
Sbjct: 439 HVHQVLQELMEA------GDLDGSMGTNVRLAIDDMVAGPSIRTLVQDGRVKKERVKTVL 492

Query: 547 NKIIER 552
           N +I R
Sbjct: 493 NAVIAR 498

>TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.533
           YMR070W
          Length = 513

 Score =  109 bits (273), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 44/63 (69%), Positives = 56/63 (88%)

Query: 433 NFIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLL 492
           + I +CHLCEKSFKR+SWLKRHLLSHS +R++ CP CLS+HKRKDNL+QH+KLKH +Y+L
Sbjct: 337 DIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKHLDYIL 396

Query: 493 DEL 495
            +L
Sbjct: 397 KKL 399

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 21/28 (75%)

Query: 527 SIKKLLYRGILNKDDVKRVLNKIIERSN 554
           ++KKL+    +NKD++KRV+N II  +N
Sbjct: 485 TVKKLINDAKVNKDELKRVINYIISEAN 512

>KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON} 
          Length = 218

 Score = 96.3 bits (238), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 43/123 (34%), Positives = 73/123 (59%), Gaps = 19/123 (15%)

Query: 428 NSSPSNFIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKH 487
           N      +++C++C K F+R +WL+RH LSH+ +R++LCPWC S+HKR+DNL +H+KLKH
Sbjct: 111 NEDEVTSVYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKH 170

Query: 488 SNYLLDELKNANVSFNWGTYDGQNSTDSMPKTLSGYPDSSIKKLLYRGILNKDDVKRVLN 547
              L+  ++                 +  P  L+ + D  + +L+  G L+++D+KRV  
Sbjct: 171 MELLMKAIR-----------------EYYP--LTDFEDKDLNELMRSGYLHREDIKRVFL 211

Query: 548 KII 550
            +I
Sbjct: 212 HLI 214

>KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON}
           Anc_2.533 YMR070W
          Length = 352

 Score = 92.0 bits (227), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 45/120 (37%), Positives = 68/120 (56%), Gaps = 19/120 (15%)

Query: 431 PSNFIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNY 490
           P+   + C  C KSF+R +WLKRH ++H+    + C WC S HKR+DN+ +HMKLKH N 
Sbjct: 245 PTMTSYPCPQCPKSFQRSAWLKRHSITHTNSHPFKCVWCKSEHKRRDNMFKHMKLKHMNL 304

Query: 491 LLDELKNANVSFNWGTYDGQNSTDSMPKTLSGYPDSSIKKLLYRGILNKDDVKRVLNKII 550
           L+  ++N    +    ++G++                +K LL  G L+K+DVKRVL  I+
Sbjct: 305 LMKVIRNY---YPLAEFEGKD----------------LKGLLADGRLHKEDVKRVLVDIV 345

>TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.533
           YMR070W
          Length = 417

 Score = 76.3 bits (186), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 28/53 (52%), Positives = 40/53 (75%)

Query: 435 IHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKH 487
            ++C +C K+FKR SWLKRH  SHS  +++ C WC  ++KRKDNL+QH++ KH
Sbjct: 323 FYECKVCHKTFKRNSWLKRHFFSHSKLKNFSCNWCSGKYKRKDNLVQHIRKKH 375

>NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa]
           {ON} Anc_2.598
          Length = 822

 Score = 63.9 bits (154), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 35/58 (60%), Gaps = 1/58 (1%)

Query: 428 NSSPSNFIHKCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMK 484
           N S  N   KC  C K+F+R   LKRH+ S HS+ER + CP C  +  R DNL QH+K
Sbjct: 757 NFSDENKTFKCETCGKAFRRSEHLKRHIRSVHSSERPFACPTCDKKFSRSDNLAQHIK 814

>YKL062W Chr11 (323228..325120) [1893 bp, 630 aa] {ON}
           MSN4Transcriptional activator related to Msn2p;
           activated in stress conditions, which results in
           translocation from the cytoplasm to the nucleus; binds
           DNA at stress response elements of responsive genes,
           inducing gene expression
          Length = 630

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/93 (39%), Positives = 52/93 (55%), Gaps = 12/93 (12%)

Query: 403 NNGTIPSEQDTSNNKLTITTL--TNSDNSSPSNFIHKCHLCEKSFKRRSWLKRHLLS-HS 459
           NNG +P +      + +ITT+   N D + P     KC  CEK+F+R   LKRH+ S HS
Sbjct: 545 NNGKVPVQP---RKRKSITTIDPNNYDKNKP----FKCKDCEKAFRRSEHLKRHIRSVHS 597

Query: 460 AERHYLCPWCLSRHKRKDNLLQHMKL--KHSNY 490
            ER + C +C  +  R DNL QH+K   KH ++
Sbjct: 598 TERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 630

>NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598
          Length = 972

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/57 (50%), Positives = 36/57 (63%), Gaps = 3/57 (5%)

Query: 437 KCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKL--KHSNY 490
           KC  CEK+F+R   LKRH  S HSAER + C +C  R  R DNL QH+K   KH ++
Sbjct: 916 KCSDCEKAFRRSEHLKRHFRSVHSAERPFGCMFCTKRFSRSDNLSQHLKTHKKHGDF 972

>Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON}
           complement(4290..6233) [1944 nt, 648 aa]
          Length = 647

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 37/57 (64%), Gaps = 3/57 (5%)

Query: 437 KCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKL--KHSNY 490
           KC  CEK+F+R   LKRH+ S HS+ER + C +C  +  R DNL QH+K   KH ++
Sbjct: 591 KCTDCEKAFRRSEHLKRHIRSVHSSERPFACNYCEKKFSRSDNLSQHLKTHKKHGDF 647

>Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062W
           (REAL)
          Length = 641

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 3/57 (5%)

Query: 437 KCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKL--KHSNY 490
           KC  CEK+F+R   LKRH+ S HS ER + C +C  +  R DNL QH+K   KH ++
Sbjct: 585 KCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 641

>ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar to
           uniprot|P33749 Saccharomyces cerevisiae YKL062W MSN4
           Transcriptional activator related to Msn2p activated in
           stress conditions which results in translocation from
           the cytoplasm to the nucleus binds DNA at stress
           response elements of responsive genes inducing gene
           expression
          Length = 584

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 48/84 (57%), Gaps = 9/84 (10%)

Query: 416 NKLTITTLTNSDNSSPSNFIH------KCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPW 468
           N+ T+++  NS + +P N         KC  C K+F+R   LKRH+ S HS+ER + C +
Sbjct: 501 NQPTVSSRKNSRSITPMNASDEDVKPFKCKECSKAFRRSEHLKRHIRSVHSSERPFACMF 560

Query: 469 CLSRHKRKDNLLQHMKL--KHSNY 490
           C  +  R DNL QH+K   KH ++
Sbjct: 561 CEKKFSRSDNLSQHLKTHKKHGDF 584

>Skud_11.167 Chr11 (302970..304856) [1887 bp, 628 aa] {ON} YKL062W
           (REAL)
          Length = 628

 Score = 60.1 bits (144), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 3/57 (5%)

Query: 437 KCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKL--KHSNY 490
           KC  CEK+F+R   LKRH+ S HS ER + C +C  +  R DNL QH+K   KH ++
Sbjct: 572 KCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 628

>Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {ON}
           YMR037C (REAL)
          Length = 709

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 438 CHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMK 484
           CH+C KSFKR   LKRH+ S HS ER + C  C  +  R DNL QH+K
Sbjct: 654 CHICSKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIK 701

>TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.598
           YMR037C
          Length = 365

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 31/49 (63%), Gaps = 1/49 (2%)

Query: 437 KCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMK 484
           KC+ CEK FKR   LKRH+ S HS ER Y C +C     R DNL QH+K
Sbjct: 309 KCNKCEKKFKRSEHLKRHIRSVHSTERPYHCQFCEKNFSRSDNLSQHLK 357

>Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {ON}
           YMR037C (REAL)
          Length = 704

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 438 CHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMK 484
           CH+C KSFKR   LKRH+ S HS ER + C  C  +  R DNL QH+K
Sbjct: 649 CHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIK 696

>YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON}
           MSN2Transcriptional activator related to Msn4p;
           activated in stress conditions, which results in
           translocation from the cytoplasm to the nucleus; binds
           DNA at stress response elements of responsive genes,
           inducing gene expression
          Length = 704

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 438 CHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMK 484
           CH+C KSFKR   LKRH+ S HS ER + C  C  +  R DNL QH+K
Sbjct: 649 CHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIK 696

>TBLA0G01920 Chr7 complement(502783..504354) [1572 bp, 523 aa] {ON}
           Anc_2.598 YMR037C
          Length = 523

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 37/57 (64%), Gaps = 3/57 (5%)

Query: 437 KCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKL--KHSNY 490
           KC  CEK+F+R   LKRH+ S HS+ER + C +C  R  R DNL QH+K   KH ++
Sbjct: 467 KCGQCEKAFRRSEHLKRHVRSVHSSERPFPCTFCDKRFSRSDNLSQHLKTHKKHGDF 523

>Suva_11.164 Chr11 (305916..307835) [1920 bp, 639 aa] {ON} YKL062W
           (REAL)
          Length = 639

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 36/56 (64%), Gaps = 3/56 (5%)

Query: 438 CHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKL--KHSNY 490
           C  C+K+F+R   LKRH+ S HSAER + C +C  +  R DNL QH+K   KH ++
Sbjct: 584 CKDCDKAFRRSEHLKRHIRSVHSAERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 639

>CAGL0L06072g Chr12 complement(681921..682823) [903 bp, 300 aa] {ON}
           some similarities with uniprot|P39959 Saccharomyces
           cerevisiae YER130c or uniprot|P33749 Saccharomyces
           cerevisiae YKL062w MSN4 transcriptional activator
          Length = 300

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 435 IHKCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKLKHSN 489
           I KC +CE+ FKR+  LKRH+ S H  ER Y C  CL    R DNL QH K  H+N
Sbjct: 217 IFKCDMCERRFKRQEHLKRHVSSLHMGERPYSCDICLKSFSRSDNLNQH-KRTHNN 271

>Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {ON}
           YMR037C (REAL)
          Length = 703

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 438 CHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMK 484
           CH+C KSFKR   LKRH+ S HS ER + C  C  +  R DNL QH+K
Sbjct: 648 CHICPKSFKRSEHLKRHVRSVHSNERPFACHICEKKFSRSDNLSQHIK 695

>TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {ON}
           Anc_2.598 YMR037C
          Length = 746

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 31/49 (63%), Gaps = 1/49 (2%)

Query: 437 KCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMK 484
           KC  C K+F+R   LKRH+ S HS ER + C  CL +  R DNL QH+K
Sbjct: 690 KCDTCGKNFRRSEHLKRHIRSVHSMERPFSCDICLKKFSRSDNLSQHLK 738

>SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 499

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 36/57 (63%), Gaps = 3/57 (5%)

Query: 437 KCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKL--KHSNY 490
           KC  C K+F+R   LKRH+ S HS+ER + C +C  +  R DNL QH+K   KH ++
Sbjct: 443 KCQECTKAFRRSEHLKRHIRSVHSSERPFHCSYCDKKFSRSDNLSQHLKTHKKHGDF 499

>KAFR0F02070 Chr6 (409867..410979) [1113 bp, 370 aa] {ON} Anc_2.598
           YMR037C
          Length = 370

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 33/57 (57%), Gaps = 3/57 (5%)

Query: 437 KCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKL--KHSNY 490
           KC  CEK FKR   LKRH  S HS ER + C  C  +  R DNL QH+K   KH ++
Sbjct: 314 KCSECEKGFKRSEHLKRHFRSVHSNERPFPCMLCEKKFSRSDNLSQHLKTHKKHGDF 370

>TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {ON}
           Anc_2.598 YMR037C
          Length = 519

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 38/57 (66%), Gaps = 3/57 (5%)

Query: 437 KCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKL--KHSNY 490
           KC+ CEK+F+R   LKRH+ S HS+ER + C +C  +  R DNL QH+K   KH ++
Sbjct: 463 KCNNCEKAFRRSEHLKRHIRSVHSSERPFPCNYCEKKFSRSDNLSQHLKTHKKHGDF 519

>CAGL0F05995g Chr6 complement(598819..600612) [1794 bp, 597 aa] {ON}
           some similarities with uniprot|P33748 Saccharomyces
           cerevisiae YMR037c MSN2
          Length = 597

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 438 CHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMK 484
           CHLC K+FKR   LKRH+ S HS +R + C  C  +  R DNL QH+K
Sbjct: 537 CHLCSKAFKRSEHLKRHVRSVHSTDRPFSCHLCEKKFSRSDNLSQHIK 584

>NCAS0H03080 Chr8 complement(592814..595006) [2193 bp, 730 aa] {ON}
           Anc_2.598
          Length = 730

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 36/57 (63%), Gaps = 3/57 (5%)

Query: 437 KCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKL--KHSNY 490
           KC  C K+F+R   LKRH+ S HS+ER + C +C  +  R DNL QH+K   KH ++
Sbjct: 674 KCSECIKAFRRSEHLKRHIRSVHSSERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 730

>Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {ON}
           YKL062W (MSN4) - zinc finger protein [contig 59] FULL
          Length = 698

 Score = 57.0 bits (136), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 36/57 (63%), Gaps = 3/57 (5%)

Query: 437 KCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKL--KHSNY 490
           KC  C K+F+R   LKRH+ S HS+ER + C +C  +  R DNL QH+K   KH ++
Sbjct: 642 KCQECTKAFRRSEHLKRHIRSVHSSERPFHCSYCDKKFSRSDNLSQHLKTHKKHGDF 698

>KNAG0M02310 Chr13 complement(426937..428919) [1983 bp, 660 aa] {ON}
           Anc_2.598 YMR037C
          Length = 660

 Score = 57.0 bits (136), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 42/75 (56%), Gaps = 6/75 (8%)

Query: 422 TLTNSDNSSPSNFIHK---CHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKD 477
           TL  SD S+  + + K   C  C K+FKR   LKRH+ S HS ER Y C  C  +  R D
Sbjct: 586 TLRRSDPSTAEDDMEKPFHCEQCLKAFKRSEHLKRHVRSVHSQERPYGCNICDKKFSRSD 645

Query: 478 NLLQHMKL--KHSNY 490
           NL QH+K   +H ++
Sbjct: 646 NLSQHLKTHKRHGDF 660

>TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa]
           {ON} Anc_2.598 YMR037C
          Length = 437

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 35/57 (61%), Gaps = 3/57 (5%)

Query: 437 KCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKL--KHSNY 490
           KC  C K+F+R   LKRH+ S HS ER + C +C  +  R DNL QH+K   KH ++
Sbjct: 381 KCKECAKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 437

>Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {ON}
           complement(39687..41171) [1485 nt, 495 aa]
          Length = 494

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 34/57 (59%), Gaps = 3/57 (5%)

Query: 437 KCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKL--KHSNY 490
           KC  C K F+R   LKRH+ S HS ER + C +C  +  R DNL QH+K   KH ++
Sbjct: 438 KCGDCTKQFRRSEHLKRHIRSVHSKERPFPCKYCDKKFSRSDNLSQHLKTHKKHGDF 494

>KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598
           YMR037C
          Length = 620

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 34/57 (59%), Gaps = 3/57 (5%)

Query: 437 KCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKL--KHSNY 490
           KC  C K+FKR   LKRH+ S HS +R + C  C  +  R DNL QH+K   KH ++
Sbjct: 564 KCGQCVKAFKRSEHLKRHVRSVHSNDRPFACTLCEKKFSRSDNLSQHLKTHKKHGDF 620

>KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weakly
           similar to uniprot|P33748 Saccharomyces cerevisiae
           YMR037C MSN2 Transcriptional activator related to Msn4p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 694

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 35/60 (58%), Gaps = 1/60 (1%)

Query: 437 KCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLDEL 495
           KC  C K+F+R   LKRH+ S HS ER + C +C  +  R DNL QH+K    +  + EL
Sbjct: 622 KCDQCNKTFRRSEHLKRHVRSVHSTERPFHCQFCDKKFSRSDNLSQHLKTHKKHGDITEL 681

>KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 677

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 35/57 (61%), Gaps = 3/57 (5%)

Query: 437 KCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKL--KHSNY 490
           KC  C K+F+R   LKRH+ S HS ER + C +C  +  R DNL QH+K   KH ++
Sbjct: 621 KCQECTKAFRRSEHLKRHIRSVHSTERPFHCSYCDKKFSRSDNLSQHLKTHKKHGDF 677

>NDAI0B01340 Chr2 (309326..311635) [2310 bp, 769 aa] {ON} Anc_2.598
          Length = 769

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/49 (48%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 437 KCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMK 484
           +C  C KSF+R   LKRH+ S HS ER + C  C  +  R DNL QH+K
Sbjct: 713 QCDQCTKSFRRSEHLKRHVRSVHSKERPFACNLCEKKFSRSDNLSQHLK 761

>ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL062W
           (MSN4) and YMR037C (MSN2)
          Length = 571

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 32/49 (65%), Gaps = 1/49 (2%)

Query: 437 KCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMK 484
           KC  C K+F+R   LKRH+ S HS++R + C +C  +  R DNL QH+K
Sbjct: 505 KCQECTKAFRRSEHLKRHIRSVHSSDRPFPCTYCDKKFSRSDNLSQHLK 553

>KAFR0A02320 Chr1 complement(482194..483525) [1332 bp, 443 aa] {ON}
           Anc_2.598 YMR037C
          Length = 443

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/49 (48%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 437 KCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMK 484
           KC  C K+F+R   LKRH+ S HS ER + C  C  +  R DNL QH+K
Sbjct: 387 KCDTCYKAFRRSEHLKRHIRSVHSTERPFACTICDKKFSRSDNLSQHLK 435

>KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {ON}
           Anc_8.144 YER130C
          Length = 472

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 438 CHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKLKHSN 489
           C  C + FKR+  LKRH+LS H  E+ + CP C     R DNL QH+K  HSN
Sbjct: 402 CKYCPRKFKRQEHLKRHILSLHVGEKRFGCPICGKNFSRSDNLNQHIK-THSN 453

>TBLA0G03240 Chr7 (859142..860677) [1536 bp, 511 aa] {ON} Anc_3.298
          Length = 511

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 34/59 (57%), Gaps = 2/59 (3%)

Query: 431 PSNFIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPW--CLSRHKRKDNLLQHMKLKH 487
           P NF + C +C K F+R S LK H+  H+  + YLCP+  C      K N+L+H KL +
Sbjct: 410 PKNFKYHCDICHKFFRRPSSLKTHMNIHTGVKPYLCPYNNCYKPFNAKSNMLRHFKLHY 468

>CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa]
           {ON} weakly similar to uniprot|P33749 Saccharomyces
           cerevisiae YKL062w MSN4 transcriptional activator
          Length = 541

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 36/57 (63%), Gaps = 3/57 (5%)

Query: 437 KCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKL--KHSNY 490
           +C  C+K+F+R   LKRH+ S HS ER + C +C  +  R DNL QH+K   +H ++
Sbjct: 485 QCADCDKAFRRSEHLKRHVRSVHSTERPFPCMFCEKKFSRSDNLSQHLKTHKRHGDF 541

>Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar to
           Ashbya gossypii ABR089C
          Length = 767

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 31/49 (63%), Gaps = 1/49 (2%)

Query: 437 KCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMK 484
           KC  C K+F+R   LKRH+ S HS +R + C +C  +  R DNL QH+K
Sbjct: 699 KCQECTKAFRRSEHLKRHIRSVHSTDRPFPCTYCDKKFSRSDNLSQHLK 747

>KAFR0F01210 Chr6 (232343..233278) [936 bp, 311 aa] {ON} Anc_6.256
           YPL230W
          Length = 311

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 32/63 (50%), Gaps = 3/63 (4%)

Query: 438 CH---LCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLDE 494
           CH    C  +F R   L RH+  H+ E+ + C  C     R DNL QH +  H+N  +DE
Sbjct: 20  CHGYGDCHMTFARAEHLARHVRRHTGEKPFECNVCFKHFSRVDNLKQHKETVHANVFIDE 79

Query: 495 LKN 497
           + N
Sbjct: 80  MSN 82

>SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]
           {ON} weakly similar to uniprot|P39959 Saccharomyces
           cerevisiae YER130C Hypothetical ORF
          Length = 410

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 438 CHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNY 490
           C  C++ FKR+  LKRH+ S H  E+ Y C  C  +  R DNL QH+K    +Y
Sbjct: 356 CEFCDRRFKRQEHLKRHVRSLHMGEKPYGCEICGKKFSRSDNLNQHIKTHGGDY 409

>NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {ON}
           Anc_8.144
          Length = 547

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 438 CHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMK 484
           C  CE+ FKR+  LKRH+ S H  E+ Y C  C     R DNL QH+K
Sbjct: 497 CDYCERRFKRQEHLKRHVRSLHIGEKPYACHICNKNFSRSDNLTQHIK 544

>ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER130C
          Length = 520

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 438 CHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKLKHSN 489
           C  CE+ FKR+  LKRH+ S H  E+ Y C  C  +  R DNL QH+K  HSN
Sbjct: 462 CEYCERRFKRQEHLKRHIRSLHMGEKPYGCDICGKKFSRSDNLNQHIKT-HSN 513

>TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.351
           YJR127C
          Length = 1310

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 41/75 (54%), Gaps = 1/75 (1%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHM-KLKHSNYLLDELK 496
           C +C + F R+  LKRH +SH+ E+ +LC +C     RKD +L+H  KL  S     E  
Sbjct: 36  CSICTRGFVRQEHLKRHKISHTNEKPFLCIFCGRCFARKDLVLRHQYKLHPSLISKKEAI 95

Query: 497 NANVSFNWGTYDGQN 511
           N  VS N GT +  N
Sbjct: 96  NDTVSENEGTVNNTN 110

>Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}
           similar to Ashbya gossypii ACL057W
          Length = 573

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 438 CHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLDE 494
           C  CE+ FKR+  LKRH+ S H  E+ Y C  C  +  R DNL QH+K  H+N   D+
Sbjct: 516 CEFCERRFKRQEHLKRHVRSLHMGEKPYGCDICGKKFSRSDNLNQHIK-THTNGNFDD 572

>SAKL0F01980g Chr6 (165916..167073) [1158 bp, 385 aa] {ON} some
           similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 385

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 436 HKCHLCEKSFKRRSWLKRHLLSHSAERHYLC--PWCLSRHKRKDNLLQHMKLKHSN 489
           +KC LC K F R    +RH+ +H+ E+ + C  P C+ R  R D L +H+++ H+N
Sbjct: 25  YKCELCNKGFHRLEHKRRHIRTHTGEKPHACTFPGCMKRFSRSDELKRHLRI-HTN 79

>KNAG0H01180 Chr8 (200503..201267) [765 bp, 254 aa] {ON} Anc_3.281
           YBR066C
          Length = 254

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPW--CLSRHKRKDNLLQHMKLKHSNYLLDEL 495
           C  C K F     L RH   H+ E+++LCP+  C  R  R+DN LQH +    N+    L
Sbjct: 187 CTTCTKGFTTSGHLARHKRIHTGEKNHLCPFEGCKQRFSRQDNCLQHYRTHFKNFTFTNL 246

Query: 496 KN 497
            N
Sbjct: 247 AN 248

>KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} similar
           to uniprot|Q04545 Saccharomyces cerevisiae YML081W
          Length = 1332

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 41/63 (65%), Gaps = 1/63 (1%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLDELKN 497
           C +C + F R+  L+RH  SH+ E+ +LC +C     R+D +L+H +  H++ L+D+ K+
Sbjct: 85  CPICTRGFARQEHLRRHERSHTNEKPFLCAFCGRCFARRDLVLRHQQKLHAS-LMDQDKD 143

Query: 498 ANV 500
           A++
Sbjct: 144 ADI 146

>KLLA0C17072g Chr3 (1494101..1495525) [1425 bp, 474 aa] {ON} weakly
           similar to uniprot|P39959 Saccharomyces cerevisiae
           YER130C Hypothetical ORF
          Length = 474

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 438 CHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMK 484
           C  C++ FKR+  LKRH+ S H  E+ Y C  C  +  R DNL QH+K
Sbjct: 420 CEYCDRRFKRQEHLKRHIRSLHICEKPYGCHLCGKKFSRSDNLSQHLK 467

>NCAS0C04070 Chr3 (831321..832190) [870 bp, 289 aa] {ON} Anc_8.144
          Length = 289

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 438 CHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLDELK 496
           CHLC+K FKR   LKRH  + H   R + C  C  R  R DNL QH+++     +++ ++
Sbjct: 225 CHLCKKRFKRHEHLKRHFRTIHLRVRPFECSVCHKRFSRNDNLNQHVRIHEQQPIMEPIR 284

>Suva_13.70 Chr13 (106147..108480) [2334 bp, 777 aa] {ON} YML081W
           (REAL)
          Length = 777

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 33/57 (57%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLDE 494
           CH+C + F R+  LKRH  +H+ E+ +LC +C     R+D +L+H    HS  +  E
Sbjct: 63  CHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHSALVSKE 119

>CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some
           similarities with uniprot|P39959 Saccharomyces
           cerevisiae YER130c
          Length = 317

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 438 CHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMK 484
           C  C++ FKR+  LKRH+ S H  E+ Y C  C  +  R DNL QH+K
Sbjct: 266 CEFCDRRFKRQEHLKRHIRSLHMGEKPYECHICNKKFSRSDNLNQHIK 313

>NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 34/61 (55%), Gaps = 2/61 (3%)

Query: 437 KCHLCEKSFKRRSWLKRHLLSHSAERHYLCPW--CLSRHKRKDNLLQHMKLKHSNYLLDE 494
           +CH+C KS  R S L+ H+L H+ +R + C W  C  R   K N+ +H KL     L +E
Sbjct: 492 QCHICGKSVTRTSTLQTHMLVHTGDRPFECVWSGCHKRFNVKSNMNRHYKLHLKKQLANE 551

Query: 495 L 495
           +
Sbjct: 552 V 552

>KAFR0A06720 Chr1 (1361355..1362062) [708 bp, 235 aa] {ON} Anc_5.586
           YHR006W
          Length = 235

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 14/78 (17%)

Query: 426 SDNSSPSNFIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHK----------- 474
           SD +S +N ++ CH C+ SF+ R +L RH+  HS E+ Y CP+  + H+           
Sbjct: 25  SDKTSKTNGMYVCHYCDASFRIRGYLTRHIKKHSIEKAYHCPF-YNEHQPSELKCHNSGG 83

Query: 475 --RKDNLLQHMKLKHSNY 490
             R+D    H+K +H  Y
Sbjct: 84  FSRRDTYKTHLKSRHILY 101

>Smik_13.387 Chr13 complement(609003..609641) [639 bp, 212 aa] {ON}
           YMR182C (REAL)
          Length = 212

 Score = 48.9 bits (115), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 38/83 (45%), Gaps = 1/83 (1%)

Query: 441 CEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLDELKNANV 500
           C  SF R   L RH+  H+ E+ + C  CL    R DNL QH    HS+  L  L+    
Sbjct: 27  CNMSFNRAEHLARHIRKHTGEKPFQCNICLKFFSRIDNLRQHQSSVHSDVDLMSLRRLQQ 86

Query: 501 SFNWGTYDGQNSTDSMPKTLSGY 523
           S N  T +  N+T  M   L  Y
Sbjct: 87  SAN-NTANEPNATTRMFPQLRPY 108

>KLTH0H08800g Chr8 (762417..762923) [507 bp, 168 aa] {ON} some
           similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 168

 Score = 48.1 bits (113), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 23/59 (38%), Positives = 35/59 (59%), Gaps = 2/59 (3%)

Query: 429 SSPSNFIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLC--PWCLSRHKRKDNLLQHMKL 485
           + PS  +H+CH+C K+F R S L  H L H+  + ++C  P C  R   K NL++H K+
Sbjct: 104 APPSATLHECHVCGKTFSRPSGLNTHALIHTGHQPFVCDVPHCGKRFNVKSNLIRHKKI 162

>KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly
           similar to uniprot|P39959 Saccharomyces cerevisiae
           YER130C Hypothetical ORF
          Length = 397

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 438 CHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMK 484
           C  C++ FKR+  LKRH+ S H  E+ + C  C  +  R DNL QH+K
Sbjct: 342 CDFCDRRFKRQEHLKRHVRSLHMGEKPFDCQICGKKFSRSDNLNQHVK 389

>Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa]
           {ON} complement(101434..102513) [1080 nt, 360 aa]
          Length = 359

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 33/54 (61%), Gaps = 2/54 (3%)

Query: 438 CHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNY 490
           C  C++ FKR+  LKRH+ S H  E+ + C  C  +  R DNL QH+K  HSN+
Sbjct: 305 CEHCDRRFKRQEHLKRHVRSLHMGEKPFSCHICEKKFSRSDNLNQHIK-THSNF 357

>ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR113W (AZF1)
          Length = 769

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 34/68 (50%), Gaps = 3/68 (4%)

Query: 437 KCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNY--LLDE 494
           +C  C K F +   L+ H+  H+ ER Y C  C  R  RK NL  HM L H NY     +
Sbjct: 516 QCEYCGKRFTQGGNLRTHVRLHTGERPYECDKCGKRFSRKGNLAAHM-LTHENYKPFQCK 574

Query: 495 LKNANVSF 502
           L + N SF
Sbjct: 575 LDDCNKSF 582

>CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} similar
           to uniprot|P46974 Saccharomyces cerevisiae YJR127c ZMS1
           or uniprot|Q04545 Saccharomyces cerevisiae YML081w
          Length = 1020

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 35/58 (60%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLDEL 495
           C +C + F R+  LKRH  SH+ E+ +LC  C     RKD +L+H++  H +Y  ++L
Sbjct: 29  CPICSRGFVRQEHLKRHQNSHTHEKPFLCLICGKCFARKDLVLRHLQKLHRDYKTEQL 86

>TPHA0D01050 Chr4 complement(216444..217763) [1320 bp, 439 aa] {ON}
           Anc_8.144 YER130C
          Length = 439

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 438 CHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMK 484
           C  CE+ FKR+  LKRH+ S H   + Y C  C  +  R DNL QH+K
Sbjct: 388 CDYCERRFKRQEHLKRHVRSLHMCVKPYACHICDKKFSRSDNLSQHIK 435

>KNAG0M00350 Chr13 (51209..54439) [3231 bp, 1076 aa] {ON} Anc_4.351
           YJR127C
          Length = 1076

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 37/63 (58%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLDELKN 497
           C +C ++F R+  LKRH  SH+ E+ ++C +C     R+D +L+H    HS  +  EL +
Sbjct: 54  CSVCTRAFIRQEHLKRHQRSHTNEKPFICVFCGRCFARRDLVLRHQHKLHSALIGTELHH 113

Query: 498 ANV 500
            NV
Sbjct: 114 ENV 116

>KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON}
           Anc_8.425 YDR216W
          Length = 627

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 69/153 (45%), Gaps = 12/153 (7%)

Query: 380 ANGNGTDNILKKGTGANDITGIVNNGTIPSEQDTSNNKLTITTLTNSDNSSPSNFIHKCH 439
            N    D+  K  T +N++   VN        DT  + L +  LT S N     F+  C 
Sbjct: 2   TNSRKLDSQQKYTTSSNNMNSKVNKNL-----DTIPDNLKLNGLTPSGN--KRTFL--CF 52

Query: 440 LCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLDELKNAN 499
           +C+K+F R+  L RHL SH+ E+ + C  C     R+D L++H    HS+  + + K+ N
Sbjct: 53  VCQKAFARQEHLDRHLRSHTNEKPFKCAVCDKDFTRRDLLIRHSNKLHSDTAIVQRKSCN 112

Query: 500 VS---FNWGTYDGQNSTDSMPKTLSGYPDSSIK 529
                +   ++  Q+      K  S   D+ IK
Sbjct: 113 ARKKLYRRASFSAQSGDSYACKKKSSSKDNEIK 145

>Skud_13.348 Chr13 complement(598668..599318) [651 bp, 216 aa] {ON}
           YMR182C (REAL)
          Length = 216

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 38/83 (45%), Gaps = 1/83 (1%)

Query: 441 CEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLDELKNANV 500
           C  SF R   L RH+  H+ E+ + C  CL    R DNL QH    HS+  L  L+    
Sbjct: 27  CNMSFNRAEHLARHIRKHTGEKPFQCNICLKFFSRIDNLRQHQSSVHSDVDLMSLRRQKQ 86

Query: 501 SFNWGTYDGQNSTDSMPKTLSGY 523
           S +  T +G N+   M   L  Y
Sbjct: 87  S-SGNTVNGPNAGTRMFPQLRPY 108

>YMR182C Chr13 complement(624532..625167) [636 bp, 211 aa] {ON}
           RGM1Putative zinc finger DNA binding transcription
           factor; contains two N-terminal C2H2 zinc fingers and
           C-terminal proline rich domain; overproduction impairs
           cell growth and induces expression of genes involved in
           monosaccharide catabolism and aldehyde metabolism;
           deletion decreases expression of Y-prime telomeric
           elements; regulates expression of subtelomeric COS genes
           in conjunction with RNA binding protein Pub1p; localized
           to X elements within subtelomeric regions by ChIP
          Length = 211

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 37/78 (47%), Gaps = 1/78 (1%)

Query: 441 CEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLDELKNANV 500
           C  SF R   L RH+  H+ E+ + C  CL    R DNL QH    HS+  L  L+    
Sbjct: 27  CNMSFNRTEHLARHIRKHTGEKPFQCNICLKFFSRIDNLRQHQSSVHSDVDLMSLRRLQQ 86

Query: 501 SFNWGTYDGQNSTDSMPK 518
           S N  T +  N+T   P+
Sbjct: 87  SAN-STANDPNATRMFPQ 103

>AGR172W Chr7 (1071485..1074658) [3174 bp, 1057 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR216W (ADR1)
          Length = 1057

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 32/61 (52%)

Query: 435 IHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLDE 494
           +  CH C ++F R+  L RH  SH+ E+ Y+C  C  R  R+D LL+H    H     D 
Sbjct: 48  LFVCHTCTRAFARQEHLIRHKRSHTNEKPYICGICDRRFSRRDLLLRHAHKLHGGSCGDA 107

Query: 495 L 495
           L
Sbjct: 108 L 108

>TBLA0B06160 Chr2 (1454045..1458199) [4155 bp, 1384 aa] {ON}
           Anc_4.351 YJR127C
          Length = 1384

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 36/61 (59%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLDELKN 497
           C  C + F R+  LKRH  SH+ E+ +LC +C     R+D +L+H +  HS+ + ++  N
Sbjct: 107 CQTCTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLILRHQRRLHSSLMTNDSMN 166

Query: 498 A 498
           +
Sbjct: 167 S 167

>Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON}
           complement(124703..125578) [876 nt, 292 aa]
          Length = 291

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 48/96 (50%), Gaps = 7/96 (7%)

Query: 396 NDITGIVNNGTIPSEQDTSNNKLTITTL----TNSDNSSPSNFIHK-CHLCEKSFKRRSW 450
           N +  +   G++P    TS +  +I  +     NS+ S     + K CH+C+K   R + 
Sbjct: 104 NSVIKVEPEGSMPMPAMTSPSSSSINKIGKKAFNSEESKKMTLLRKQCHICKKICSRPAT 163

Query: 451 LKRHLLSHSAERHYLCPW--CLSRHKRKDNLLQHMK 484
           LK HLL H+ +  + CPW  C      K N+L+H+K
Sbjct: 164 LKTHLLIHTGDTPFKCPWENCPKSFNVKSNMLRHLK 199

>NDAI0G03420 Chr7 (817362..818816) [1455 bp, 484 aa] {ON} Anc_8.144
           YER130C
          Length = 484

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 30/54 (55%), Gaps = 1/54 (1%)

Query: 438 CHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNY 490
           C +C + F+R+  +KRH+ + H  ER Y C  C     R DNL QH++    NY
Sbjct: 415 CTICSRRFRRQEHMKRHIRTIHFQERPYTCYVCEKTFSRSDNLNQHLRTHTRNY 468

>Smik_5.276 Chr5 complement(429983..431311) [1329 bp, 442 aa] {ON}
           YER130C (REAL)
          Length = 442

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 438 CHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMK 484
           C  C++ FKR+  LKRH+ S H  E+ + C  C     R DNL QH+K
Sbjct: 390 CEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 437

>Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W
           (REAL)
          Length = 392

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 28/52 (53%)

Query: 441 CEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLL 492
           C  SF R   L RH+  H+ E+ + CP CL    R DNL QH +  H++  L
Sbjct: 52  CAMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVHAHKQL 103

>Skud_13.61 Chr13 (104114..107875) [3762 bp, 1253 aa] {ON} YML081W
           (REAL)
          Length = 1253

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 35/61 (57%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLDELKN 497
           CH+C + F R+  LKRH  +H+ E+ +LC +C     R+D +L+H    HS  +  E  N
Sbjct: 63  CHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHSALVSKESVN 122

Query: 498 A 498
           +
Sbjct: 123 S 123

>Smik_13.58 Chr13 (102509..106270) [3762 bp, 1253 aa] {ON} YML081W
           (REAL)
          Length = 1253

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 35/61 (57%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLDELKN 497
           CH+C + F R+  LKRH  +H+ E+ +LC +C     R+D +L+H    HS  +  E  N
Sbjct: 63  CHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHSALVSKESVN 122

Query: 498 A 498
           +
Sbjct: 123 S 123

>YPL230W Chr16 (115312..116487) [1176 bp, 391 aa] {ON}  USV1Putative
           transcription factor containing a C2H2 zinc finger;
           mutation affects transcriptional regulation of genes
           involved in growth on non-fermentable carbon sources,
           response to salt stress and cell wall biosynthesis
          Length = 391

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 26/48 (54%)

Query: 441 CEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHS 488
           C  SF R   L RH+  H+ E+ + CP CL    R DNL QH +  H+
Sbjct: 49  CTMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVHA 96

>NCAS0A01820 Chr1 (351123..352490) [1368 bp, 455 aa] {ON} Anc_4.80
          Length = 455

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 50/95 (52%), Gaps = 6/95 (6%)

Query: 397 DITGIVNNGTIPSEQDTSNNKLTITTLTNSDNSSPSNFIHKCHLCEKSFKRRSWLKRHLL 456
           + + I++NG +  E  T+  K    +  N D  +P    H C +C+++F R     RH+ 
Sbjct: 32  ETSNIISNGGM-QEPQTTVKKPRPRSRANKDGDAPRP--HVCPICQRAFHRLEHQTRHMR 88

Query: 457 SHSAERHYLC--PWCLSRHKRKDNLLQHMKLKHSN 489
           +H+ E+ + C  P C+ +  R D L +H ++ H+N
Sbjct: 89  THTGEKPHECDFPGCVKKFSRSDELTRHKRI-HTN 122

>KNAG0D02120 Chr4 (359406..360614) [1209 bp, 402 aa] {ON} Anc_8.144
           YER130C
          Length = 402

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 431 PSNFIH-KCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMK 484
           P N  H  C  CE+ FKR+  LKRH+ S H   + Y C  C  +  R DNL QH K
Sbjct: 343 PDNTKHYSCEYCERRFKRQEHLKRHIRSLHLGAKPYTCHICARKFSRSDNLNQHTK 398

>Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON}
           YPR013C - Hypothetical ORF [contig 55] FULL
          Length = 190

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 31/51 (60%), Gaps = 2/51 (3%)

Query: 436 HKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPW--CLSRHKRKDNLLQHMK 484
           ++C LC K F R S L+ HLL+H+  R + CP+  C      K N+++H+K
Sbjct: 128 YQCQLCLKIFSRSSALQAHLLTHTGSRPFRCPFASCSKTFNVKSNMVRHLK 178

>NDAI0D03750 Chr4 (888448..889929) [1482 bp, 493 aa] {ON} Anc_4.80
          Length = 493

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 33/56 (58%), Gaps = 3/56 (5%)

Query: 436 HKCHLCEKSFKRRSWLKRHLLSHSAERHYLC--PWCLSRHKRKDNLLQHMKLKHSN 489
           H C +C+++F R     RHL +H+ E+  +C  P C+ R  R D L +H ++ H+N
Sbjct: 43  HVCPVCQRAFHRLEHQTRHLRTHTGEKPNVCDFPGCIKRFSRSDELTRHKRI-HTN 97

>Skud_5.248 Chr5 (399138..400466) [1329 bp, 442 aa] {ON} YER130C
           (REAL)
          Length = 442

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 438 CHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMK 484
           C  C++ FKR+  LKRH+ S H  E+ + C  C     R DNL QH+K
Sbjct: 390 CEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 437

>YML081W Chr13 (104777..108532) [3756 bp, 1251 aa] {ON}
           TDA9DNA-binding protein, putative transcription factor;
           green fluorescent protein (GFP)-fusion protein localizes
           to the nucleus; null mutant is sensitive to expression
           of the top1-T722A allele; not an essential gene
          Length = 1251

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 35/61 (57%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLDELKN 497
           CH+C + F R+  LKRH  +H+ E+ +LC +C     R+D +L+H    HS  +  E  N
Sbjct: 63  CHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHSALVSKESIN 122

Query: 498 A 498
           +
Sbjct: 123 S 123

>ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]
           {ON} weakly similar to uniprot|P39959 Saccharomyces
           cerevisiae YER130C Hypothetical ORF
          Length = 557

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 438 CHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMK 484
           C  C++ FKR+  LKRH+ S H  E+ + C  C  +  R DNL QH+K
Sbjct: 505 CEYCDRRFKRQEHLKRHVRSLHMCEKPFGCHICGKKFSRSDNLNQHIK 552

>Suva_5.251 Chr5 complement(396841..398190) [1350 bp, 449 aa] {ON}
           YER130C (REAL)
          Length = 449

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 438 CHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMK 484
           C  C++ FKR+  LKRH+ S H  E+ + C  C     R DNL QH+K
Sbjct: 397 CEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 444

>TDEL0F02690 Chr6 (493944..494996) [1053 bp, 350 aa] {ON} Anc_4.80
           YGL035C
          Length = 350

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 33/56 (58%), Gaps = 3/56 (5%)

Query: 436 HKCHLCEKSFKRRSWLKRHLLSHSAERHYLC--PWCLSRHKRKDNLLQHMKLKHSN 489
           H C +C+++F+R     RHL +H+ E+ + C  P C  R  R D L +H ++ H+N
Sbjct: 29  HVCPICQRAFRRLEHQTRHLRTHTGEKPHACDFPGCAKRFSRSDELTRHRRI-HTN 83

>NCAS0F00920 Chr6 (185346..186410) [1065 bp, 354 aa] {ON} Anc_2.531
          Length = 354

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 435 IHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPW--CLSRHKRKDNLLQHMK 484
           IHKC +C+K   R + L+ HLL H+ E+ Y C W  C +    K N+ +H K
Sbjct: 295 IHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYK 346

>KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {ON}
           Anc_8.144 YER130C
          Length = 453

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 438 CHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKLKHSN 489
           C  C++ FKR+  LKRH+ S H  E+ + C  C     R DNL QH+K  HSN
Sbjct: 400 CEYCDRRFKRQEHLKRHIRSLHICEKPFHCHICDKHFSRSDNLNQHIK-THSN 451

>Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130C -
           Hypothetical ORF [contig 211] FULL
          Length = 403

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 438 CHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMK 484
           C  C++ FKR+  LKRH+ S H  E+ + C  C  +  R DNL QH+K
Sbjct: 348 CDFCDRRFKRQEHLKRHVRSLHMGEKPFDCHICGKKFSRSDNLNQHIK 395

>TBLA0F03830 Chr6 (947034..949937) [2904 bp, 967 aa] {ON} Anc_8.234
           YER169W
          Length = 967

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 435 IHKCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKLK 486
           I+ C  C++ F     L RH  S HS E+ + CP C  R KR+D++LQH+  K
Sbjct: 858 IYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 910

>KLLA0F13046g Chr6 (1201353..1205492) [4140 bp, 1379 aa] {ON} weakly
           similar to uniprot|P07248 Saccharomyces cerevisiae
           YDR216W ADR1 Positive transcriptional regulator controls
           the expression of ADH2 peroxisomal protein genes and
           genes required for ethanol glycerol and fatty acid
           utilization
          Length = 1379

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 30/50 (60%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKH 487
           C +C ++F R+  L RH  SH+ E+ Y+C  C  R  R+D L++H +  H
Sbjct: 127 CKVCTRAFARQEHLTRHERSHTKEKPYVCGICERRFTRRDLLIRHCQKLH 176

>Smik_6.435 Chr6 complement(707873..709033) [1161 bp, 386 aa] {ON}
           YPL230W (REAL)
          Length = 386

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 26/48 (54%)

Query: 441 CEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHS 488
           C  SF R   L RH+  H+ E+ + CP CL    R DNL QH +  H+
Sbjct: 49  CAMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVHA 96

>YER130C Chr5 complement(421115..422446) [1332 bp, 443 aa] {ON}
           Protein of unknown function; transcription is regulated
           by Haa1p, Sok2p and Zap1p transcriptional activators;
           computational analysis suggests a role as a
           transcription factor; C. albicans homolog (MNL1) plays a
           role in adaptation to stress
          Length = 443

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 438 CHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMK 484
           C  C++ FKR+  LKRH+ S H  E+ + C  C     R DNL QH+K
Sbjct: 391 CEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 438

>ADL051W Chr4 (595493..596014) [522 bp, 173 aa] {ON} NOHBY404; No
           homolog in Saccharomyces cerevisiae
          Length = 173

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 42/79 (53%), Gaps = 7/79 (8%)

Query: 418 LTITTLTNSDNSSPSNFIHK-----CHLCEKSFKRRSWLKRHLLSHSAERHYLCPW--CL 470
           +T++   +   S P+N +HK     C +C KSF R++ L+ H+L H+  + Y CP+  C 
Sbjct: 93  VTLSCELSKGVSDPANSVHKVSGKTCAICRKSFTRKTSLQTHMLIHTKAKPYRCPYRTCN 152

Query: 471 SRHKRKDNLLQHMKLKHSN 489
                K NL +H ++   N
Sbjct: 153 KTFNVKSNLYRHERIHKRN 171

>NDAI0B01930 Chr2 (468399..469709) [1311 bp, 436 aa] {ON} Anc_8.144
          Length = 436

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 438 CHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMK 484
           C  CE+ FKR+  LKRH+ S H   + Y C  C     R DNL QH+K
Sbjct: 386 CEYCERRFKRQEHLKRHVRSLHIGVKPYTCHICQKNFSRSDNLSQHIK 433

>Skud_16.48 Chr16 (88821..90017) [1197 bp, 398 aa] {ON} YPL230W
           (REAL)
          Length = 398

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 27/49 (55%)

Query: 441 CEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSN 489
           C  SF R   L RH+  H+ E+ + CP CL    R DNL QH +  H++
Sbjct: 49  CAMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVHAH 97

>SAKL0H12958g Chr8 complement(1112324..1115713) [3390 bp, 1129 aa]
           {ON} similar to uniprot|P07248 Saccharomyces cerevisiae
           YDR216W ADR1 Positive transcriptional regulator controls
           the expression of ADH2 peroxisomal protein genes and
           genes required for ethanol glycerol and fatty acid
           utilization
          Length = 1129

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 27/45 (60%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQH 482
           C +C ++F R+  L RH  SH+ E+ Y C  C  R  R+D LL+H
Sbjct: 61  CKICTRAFARQEHLTRHERSHTKEKPYFCGICDRRFSRRDLLLRH 105

>NDAI0D03240 Chr4 complement(769306..773394) [4089 bp, 1362 aa] {ON}
           Anc_4.351
          Length = 1362

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 64/149 (42%), Gaps = 22/149 (14%)

Query: 384 GTDNILKKGTGANDITGIVNNGTIPSEQDTSNNKLTITTLTNSDNSSPSNFIHKCHLCEK 443
           GTD     G+G +  T     G IP  + +   K           + P  F+  C  C +
Sbjct: 31  GTDTASMTGSGDSSQTATPTPGLIPIPKKSRRIK----------TNKPRPFV--CSTCTR 78

Query: 444 SFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLDELKNANVSFN 503
            F R+  LKRH  SH+ E+ +LC +C     R+D +L+H    H+         A +  +
Sbjct: 79  GFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRHQHKLHA---------ALIGTS 129

Query: 504 WGTYDGQNSTDSMPKTLSG-YPDSSIKKL 531
             +Y   ++ + +P    G  PDS+  K+
Sbjct: 130 MDSYTNSSNNNGIPVPFQGPLPDSAEDKI 158

>KNAG0E01600 Chr5 complement(319141..320157) [1017 bp, 338 aa] {ON}
           Anc_3.518 YGL209W
          Length = 338

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 437 KCHLCEKSFKRRSWLKRHLLSHSAERHYLC--PWCLSRHKRKDNLLQHMKLKHSNYL 491
           KC LC++ F R    KRH+ +H+ E+ Y C  P C     R D L +H K+ H N+L
Sbjct: 18  KCPLCQRGFHRLEHKKRHVRTHTGEKPYKCSFPDCPKSFSRTDELKRHSKI-HGNFL 73

>KAFR0B02550 Chr2 (507752..510424) [2673 bp, 890 aa] {ON} Anc_8.234
           YER169W
          Length = 890

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 435 IHKCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKLK 486
           ++ C +C++ F     L RH  S HS E+ + CP C  R KR+D++LQH+  K
Sbjct: 780 VYICQICKRQFSSGHHLTRHKKSVHSGEKPFSCPKCGKRFKRRDHVLQHLNKK 832

>AGR117C Chr7 complement(964411..966810) [2400 bp, 799 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER169W
           (RPH1) and YDR096W (GIS1)
          Length = 799

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 56/127 (44%), Gaps = 15/127 (11%)

Query: 371 SSKFPFGDDANGNGTDNILKKGTGANDITGIVNNGTI----------PSEQDTSNNKLTI 420
           S+K   GD  N +G  +    G   ND   ++N+  +          P    +  +K++ 
Sbjct: 661 SAKAYHGDKVNIHGVSSGKFVGHQINDSLALLNDDALTNSVLPGAGRPERATSPTSKISA 720

Query: 421 TTLTNSDNSSPSNFIHKCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNL 479
             +  SD        + C  C++ F     L RH  S HS E+ + CP C  + KR+D++
Sbjct: 721 EEIIISDKGK----AYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHV 776

Query: 480 LQHMKLK 486
           LQH+  K
Sbjct: 777 LQHLNKK 783

>TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1311

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKH 487
           C  C+++F R+  L RH  SH+ E+ +LC  C     R+D L++H +  H
Sbjct: 154 CDFCKRAFARQEHLTRHKRSHTNEKPFLCNLCFKNFTRRDLLIRHAQKIH 203

>Kpol_1001.1 s1001 (3077..7102) [4026 bp, 1341 aa] {ON} (3077..7102)
           [4026 nt, 1342 aa]
          Length = 1341

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 28/45 (62%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQH 482
           C +C + F R   LKRH +SH+ E+ +LC +C     RKD +L+H
Sbjct: 38  CSICTRGFVRHEHLKRHKISHTNEKPFLCIFCGRCFARKDLVLRH 82

>KAFR0B06810 Chr2 complement(1416866..1420333) [3468 bp, 1155 aa]
           {ON} Anc_4.351 YJR127C
          Length = 1155

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 33/54 (61%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYL 491
           C +C + F R+  LKRH  +H++E+ +LC +C     R+D +L+H    HS+ +
Sbjct: 56  CSICTRGFVRQEHLKRHQRAHTSEKPFLCTFCGRCFARRDLVLRHQHKLHSSLI 109

>TPHA0A01940 Chr1 complement(391362..394100) [2739 bp, 912 aa] {ON}
           Anc_8.234 YER169W
          Length = 912

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 50/101 (49%), Gaps = 13/101 (12%)

Query: 389 LKKGTGA--NDITGIVNNGTIPSEQDTSNNKLTITTLTNSDNSSPSNFIHKCHLCEKSFK 446
           ++KGT +  N++      G+IP       NK     +  S+N      ++ C  C++ F 
Sbjct: 738 IEKGTASYSNEMKKKNTAGSIPQ------NKFGSDEIVISENGK----VYICQDCKRQFS 787

Query: 447 RRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKLK 486
               L RH  S HS E+ + CP C  R KR+D++LQH+  K
Sbjct: 788 SGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 828

>Suva_8.62 Chr8 (113740..115377) [1638 bp, 545 aa] {ON} YHR006W
           (REAL)
          Length = 545

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 51/105 (48%), Gaps = 13/105 (12%)

Query: 398 ITGIVNNGTIPSEQDTSNNKLTITTLTNSDNSSPSNFIHKCHLCEKSFKRRSWLKRHLLS 457
           IT + N  T  S++   ++ L+ +   N+D SS +   + CH C+  F+ R +L RH+  
Sbjct: 167 ITPVSNVITPASKKSVDDSPLSDSVQGNTDESSET-LPYICHYCDSRFRIRGYLTRHIKK 225

Query: 458 HSAERHYLCPWC-------LSRH-----KRKDNLLQHMKLKHSNY 490
           H+  + Y CP+        L  H      R+D    H+K +H NY
Sbjct: 226 HAKRKAYHCPFFDGSISQELRCHNSGGFSRRDTYKTHLKSRHFNY 270

>TDEL0B04670 Chr2 (830511..831449) [939 bp, 312 aa] {ON} Anc_8.144
           YER130C
          Length = 312

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 438 CHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMK 484
           C  C++ FKR+  LKRH+ S H  E+ + C  C  +  R DNL QH+K
Sbjct: 260 CEFCDRRFKRQEHLKRHVRSLHMCEKPFNCHICDKKFSRSDNLNQHIK 307

>SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa]
           {ON} similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1238

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 1/59 (1%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLDELK 496
           C +C + F R+  LKRH  SH+ E+ +LC +C     R+D +L+H +  H++ L+D+ K
Sbjct: 75  CPICTRGFARQEHLKRHQRSHTNEKPFLCAFCGRCFARRDLVLRHQQKLHAS-LMDQDK 132

>Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar to
           Ashbya gossypii ACR264W
          Length = 775

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 34/68 (50%), Gaps = 3/68 (4%)

Query: 437 KCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNY--LLDE 494
           +C  C K F +   L+ H+  H+ ER Y C  C  R  RK NL  HM L H N+     +
Sbjct: 520 QCEYCGKRFTQGGNLRTHVRLHTGERPYECDKCGKRFSRKGNLAAHM-LTHENHKPFQCK 578

Query: 495 LKNANVSF 502
           L + N SF
Sbjct: 579 LDDCNKSF 586

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 27/50 (54%)

Query: 436 HKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKL 485
           H+C  C K F + + L+ H+ SH   + + C +C  R  +  NL  H++L
Sbjct: 491 HECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHVRL 540

>TPHA0C02160 Chr3 complement(486620..490747) [4128 bp, 1375 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1375

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKH 487
           C +C ++F R+  L RH  SH+ E+ Y C  C  +  R+D LL+H +  H
Sbjct: 46  CSICTRAFARQEHLTRHERSHTKEKPYCCGLCQRKFSRRDLLLRHAQKIH 95

>TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON}
           Anc_3.518 YGL209W
          Length = 330

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 437 KCHLCEKSFKRRSWLKRHLLSHSAERHYLCPW--CLSRHKRKDNLLQHMKL 485
           KC +C + F R    KRH+ +H+ E+ +LCP   C     R D L +HMK+
Sbjct: 17  KCPMCHRGFYRAEHKKRHIRTHTGEKPHLCPILGCNKSFSRTDELKRHMKV 67

 Score = 30.8 bits (68), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 17/32 (53%), Gaps = 2/32 (6%)

Query: 436 HKCHL--CEKSFKRRSWLKRHLLSHSAERHYL 465
           H C +  C KSF R   LKRH+  H A  H L
Sbjct: 44  HLCPILGCNKSFSRTDELKRHMKVHPASTHNL 75

>AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML081W and
           YJR127C (ZMS1)
          Length = 1191

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 39/64 (60%), Gaps = 1/64 (1%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLDELKN 497
           C +C + F R+  LKRH  SH+ E+ +LC +C     R+D +L+H +  H++ L+D+ K+
Sbjct: 82  CPVCTRGFARQEHLKRHQRSHTNEKPFLCAFCGRCFARRDLVLRHQQKLHAS-LMDQDKD 140

Query: 498 ANVS 501
              S
Sbjct: 141 LRES 144

>KNAG0G01870 Chr7 (417774..420401) [2628 bp, 875 aa] {ON} Anc_8.234
           YER169W
          Length = 875

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 435 IHKCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKLK 486
           ++ C  C++ F     L RH  S HS E+ Y CP C  R KR+D++LQH+  K
Sbjct: 759 VYVCQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKRFKRRDHVLQHLNKK 811

>KAFR0C02980 Chr3 (595202..595879) [678 bp, 225 aa] {ON} Anc_8.144
           YER130C
          Length = 225

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 438 CHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMK 484
           C  C + F+R+  +KRH+ S H AE+ Y C  C     R DNL QH K
Sbjct: 173 CQYCHRRFRRQEHMKRHIRSLHIAEKPYSCQICSKAFSRNDNLKQHRK 220

>NDAI0J02850 Chr10 complement(707859..712472) [4614 bp, 1537 aa]
           {ON} Anc_4.351
          Length = 1537

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 30/54 (55%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYL 491
           C  C + F R   LKRH  SH+ E+ YLC +C     R+D +L+H    HS+ L
Sbjct: 47  CPTCTRGFVRLEHLKRHERSHTQEKPYLCIFCGRCFARRDLVLRHQTKLHSSIL 100

>Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON}
           complement(28325..32557) [4233 nt, 1411 aa]
          Length = 1410

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 27/45 (60%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQH 482
           C +C ++F R+  L RH  SH+ E+ Y C  C  +  R+D LL+H
Sbjct: 120 CSICTRAFARQEHLTRHERSHTKEKPYCCGICQRKFSRRDLLLRH 164

>CAGL0E04884g Chr5 complement(469532..474001) [4470 bp, 1489 aa]
           {ON} weakly similar to uniprot|P07248 Saccharomyces
           cerevisiae YDR216w ADR1 zinc-finger transcription factor
          Length = 1489

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKH 487
           C  C ++F R+  L RH  SH+ E+ Y C  C  R  R+D LL+H    H
Sbjct: 32  CQTCTRAFARQEHLTRHERSHTKEKPYCCGICDRRFTRRDLLLRHAHKVH 81

>TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144
           YER130C
          Length = 687

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 435 IHKCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMK 484
           I  C  C + FKR+  LKRH  S H  E+ + C  C  +  R DNL QH+K
Sbjct: 633 IFICPYCNRRFKRQEHLKRHNRSLHMGEKPFDCHICNKKFSRSDNLAQHIK 683

>TDEL0A01300 Chr1 complement(225813..228326) [2514 bp, 837 aa] {ON}
           Anc_8.234 YER169W
          Length = 837

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 38/71 (53%), Gaps = 5/71 (7%)

Query: 417 KLTITTLTNSDNSSPSNFIHKCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKR 475
           K T + +  S+N      ++ C  C++ F     L RH  S HS E+ Y CP C  + KR
Sbjct: 741 KFTSSEIVMSENGK----VYICQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKKFKR 796

Query: 476 KDNLLQHMKLK 486
           +D++LQH+  K
Sbjct: 797 RDHVLQHLNKK 807

>ZYRO0A09416g Chr1 (756859..760899) [4041 bp, 1346 aa] {ON} similar
           to uniprot|P07248 Saccharomyces cerevisiae YDR216W ADR1
           Positive transcriptional regulator controls the
           expression of ADH2 peroxisomal protein genes and genes
           required for ethanol glycerol and fatty acid utilization
          Length = 1346

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 36/67 (53%), Gaps = 1/67 (1%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHM-KLKHSNYLLDELK 496
           C +C ++F R+  L RH  SH+ E+ Y C  C  +  R+D LL+H  K+   NY    +K
Sbjct: 88  CQVCTRAFARQEHLTRHERSHTKEKPYCCGICNRKFSRRDLLLRHAHKIHGGNYGDTIIK 147

Query: 497 NANVSFN 503
             NV  N
Sbjct: 148 QNNVKEN 154

>Kpol_1032.52 s1032 (118186..120660) [2475 bp, 824 aa] {ON}
           (118186..120660) [2475 nt, 825 aa]
          Length = 824

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 435 IHKCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKLK 486
           ++ C  C++ F     L RH  S HS E+ + CP C  R KR+D++LQH+  K
Sbjct: 686 VYICQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 738

>CAGL0A01628g Chr1 (161327..162601) [1275 bp, 424 aa] {ON} similar
           to uniprot|P27705 Saccharomyces cerevisiae YGL035c MIG1
           transcriptional repressor
          Length = 424

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 3/58 (5%)

Query: 436 HKCHLCEKSFKRRSWLKRHLLSHSAERHYLC--PWCLSRHKRKDNLLQHMKLKHSNYL 491
           H C +C ++F R     RH+ +H+ E+ + C  P C+ R  R D L +H ++ H+N L
Sbjct: 43  HVCPICGRAFHRLEHQTRHMRTHTGEKPHACDFPGCVKRFSRSDELTRHRRI-HTNPL 99

>NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON}
           Anc_8.425
          Length = 1350

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 33/56 (58%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLD 493
           C +C ++F R+  L RH  SH+ E+ Y C  C  +  R+D L++H +  H+  ++D
Sbjct: 118 CEICTRAFARQEHLVRHERSHTKEKPYNCGICSKKFTRRDLLIRHAQKVHNGNVVD 173

>NCAS0A06250 Chr1 complement(1234566..1238591) [4026 bp, 1341 aa]
           {ON} Anc_4.351
          Length = 1341

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 34/59 (57%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLDELK 496
           C  C + F R+  LKRH  SH+ E+ +LC +C     R+D +L+H    H+  + +EL+
Sbjct: 74  CPTCTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRHQHKLHAALIGNELQ 132

>Suva_7.240 Chr7 complement(423254..423364,423482..424918) [1548 bp,
           515 aa] {ON} YGL035C (REAL)
          Length = 515

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 436 HKCHLCEKSFKRRSWLKRHLLSHSAERHYLC--PWCLSRHKRKDNLLQHMKLKHSN 489
           H C +C+++F R     RH+  H+ E+ + C  P C+ R  R D L +H ++ H+N
Sbjct: 38  HACPICQRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRI-HTN 92

>NCAS0G01270 Chr7 (228699..229523) [825 bp, 274 aa] {ON} Anc_6.256
          Length = 274

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 29/58 (50%)

Query: 441 CEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLDELKNA 498
           C  +F R   L RH+  H+ E+ + C  CL R  R DNL QH +  H+  +    KN 
Sbjct: 27  CHMAFTRAEHLARHIRKHTGEKPFQCDVCLKRFSRVDNLKQHRESVHATVVNAASKNV 84

>Kpol_472.10 s472 (31069..33561) [2493 bp, 830 aa] {ON}
           (31069..33561) [2493 nt, 831 aa]
          Length = 830

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 34/65 (52%)

Query: 430 SPSNFIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSN 489
           S +N+ H C  C ++F R     RH  SH+  + Y C  CL    R+D L +H++  H +
Sbjct: 3   SSTNWKHICSYCNRAFSRSEHKARHERSHTGTKPYECKVCLREFVRRDLLQRHIRTVHKS 62

Query: 490 YLLDE 494
            LL +
Sbjct: 63  LLLSK 67

>KLTH0D18062g Chr4 (1493355..1496741) [3387 bp, 1128 aa] {ON}
           similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1128

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 32/52 (61%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSN 489
           C +C + F R+  LKRH  +H+ E+ +LC +C     R+D +L+H +  HS+
Sbjct: 34  CSICTRGFARQEHLKRHQRAHTNEKPFLCAFCGRCFARRDLVLRHQQKLHSS 85

>Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {ON}
           YML081W - Hypothetical ORF [contig 376] FULL
          Length = 1178

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 31/51 (60%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHS 488
           C +C + F R+  LKRH  +H+ E+ +LC +C     R+D +L+H +  HS
Sbjct: 80  CSICTRGFARQEHLKRHQRAHTNEKPFLCAFCGRCFARRDLVLRHQQKLHS 130

>CAGL0E06116g Chr5 complement(604945..606786) [1842 bp, 613 aa] {ON}
           some similarities with uniprot|Q12132 Saccharomyces
           cerevisiae YPL230w USV1 or uniprot|Q00453 Saccharomyces
           cerevisiae YMR182c RGM1
          Length = 613

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 29/57 (50%), Gaps = 3/57 (5%)

Query: 441 CEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLDELKN 497
           CE SF R   L RH+  H+ E+ + C  CL    R DNL QH    H+    D +KN
Sbjct: 33  CEMSFSRAEHLARHIRRHTGEKPFKCDICLKYFSRIDNLKQHKDTVHAK---DNVKN 86

>CAGL0L11880g Chr12 (1274920..1277862) [2943 bp, 980 aa] {ON} some
           similarities with uniprot|P39956 Saccharomyces
           cerevisiae YER169w
          Length = 980

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 430 SPSNFIHKCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKLK 486
           S S  I+ C  C++ F     L RH  S HS E+ + CP C  R KR+D++LQH+  K
Sbjct: 896 SDSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 953

>Skud_4.354 Chr4 (614004..616754) [2751 bp, 916 aa] {ON} YDR096W
           (REAL)
          Length = 916

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 435 IHKCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLD 493
           I+ C  C + F     L RH  S HS E+ + CP C  R KR+D++LQH+  K       
Sbjct: 849 IYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKKIP--CTQ 906

Query: 494 ELKNANVS 501
           E++NA V+
Sbjct: 907 EMENAKVA 914

>KAFR0F03600 Chr6 (714010..715017) [1008 bp, 335 aa] {ON} Anc_4.80
           YGL035C
          Length = 335

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 33/56 (58%), Gaps = 3/56 (5%)

Query: 436 HKCHLCEKSFKRRSWLKRHLLSHSAERHYLC--PWCLSRHKRKDNLLQHMKLKHSN 489
           H C +C+++F R     RH+ +H+ E+ + C  P C+ R  R D L +H ++ H+N
Sbjct: 21  HVCPICQRAFHRLEHQTRHMRTHTGEKPHACDFPGCVKRFSRSDELTRHRRI-HTN 75

>ZYRO0B11770g Chr2 (932841..935444) [2604 bp, 867 aa] {ON} similar
           to uniprot|P39956 Saccharomyces cerevisiae YER169W RPH1
           Transcriptional repressor of PHR1 which is a photolyase
           induced by DNA damage binds to AG(4) (C(4)T) sequence
           upstream of PHR1 Rph1p phosphorylation during DNA damage
           is under control of the MEC1-RAD53 pathway
          Length = 867

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 435 IHKCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKLK 486
           ++ C  C++ F     L RH  S HS E+ Y CP C  + KR+D++LQH+  K
Sbjct: 787 VYVCQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKKFKRRDHVLQHLNKK 839

>Suva_13.363 Chr13 complement(604738..605373) [636 bp, 211 aa] {ON}
           YMR182C (REAL)
          Length = 211

 Score = 45.4 bits (106), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 28/56 (50%)

Query: 441 CEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLDELK 496
           C  SF R   L RH+  H+ E+ + C  CL    R DNL QH    HS+  L  L+
Sbjct: 27  CNMSFNRAEHLARHIRKHTGEKPFQCNICLKFFSRIDNLRQHQSSVHSDIDLVSLR 82

>NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {ON}
           Anc_8.425
          Length = 1152

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKH 487
           C +C ++F R+  L RH  SH+ E+ Y C  C  +  R+D LL+H +  H
Sbjct: 80  CDVCSRAFARQEHLDRHARSHTNEKPYQCGICTKKFTRRDLLLRHAQKVH 129

>Ecym_3520 Chr3 complement(980315..982774) [2460 bp, 819 aa] {ON}
           similar to Ashbya gossypii AGR117C
          Length = 819

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 52/112 (46%), Gaps = 16/112 (14%)

Query: 387 NILKKGTGAN----------DITGIVNNGTI-PSEQDTSNNKLTITTLTNSDNSSPSNFI 435
           +I+K  TG N           IT  V  GTI P    +  +K++   +  S+        
Sbjct: 696 SIVKNATGVNTNTLNLLATDSITNAVMTGTIKPDRPASPISKISAEEIIISEKGKA---- 751

Query: 436 HKCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKLK 486
           + C  C++ F     L RH  S HS E+ + CP C  + KR+D++LQH+  K
Sbjct: 752 YICQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 803

>KLLA0F10109g Chr6 complement(939195..941066) [1872 bp, 623 aa] {ON}
           weakly similar to uniprot|Q00947 Saccharomyces
           cerevisiae YDR463W STP1 Transcription factor activated
           by proteolytic processing in response to signals from
           the SPS sensor system for external amino acids activates
           transcription of amino acid permease genes and may have
           a role in tRNA processing
          Length = 623

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 57/125 (45%), Gaps = 16/125 (12%)

Query: 387 NILKKGTGANDITGIVNNGTIPSEQDTSNNKLTITTLTNSDNSSPSNFIHKCHLCEKSFK 446
           +++K    +   T  V++G +P     S +++       SD    ++    CH C+  FK
Sbjct: 196 DVIKSEDSSVGSTPEVSSGIVPVSSTDSESQVPTD---KSDEKKETDMKFVCHYCDAEFK 252

Query: 447 RRSWLKRHLLSHSAERHYLCPW----------CLSR--HKRKDNLLQHMKLKHSNYLLDE 494
            R +L RH+  H+ E+ Y CP+          C S     R+D+   H++ +H  Y  D 
Sbjct: 253 MRGYLTRHIKKHAIEKAYHCPFWDASLPSEKRCHSTGGFSRRDSYKTHLRSRHFIY-PDN 311

Query: 495 LKNAN 499
           +KN +
Sbjct: 312 VKNVD 316

>Skud_5.308 Chr5 (508459..510867) [2409 bp, 802 aa] {ON} YER169W
           (REAL)
          Length = 802

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 51/110 (46%), Gaps = 8/110 (7%)

Query: 381 NGNGTDNILKKGTGANDITGIVN-NGTIPSEQDTS--NNKLTITTLTNSDNSSPSNFIHK 437
            G+G++ IL K   A       N N  +  EQ  S   +K     +  S      N I+ 
Sbjct: 662 EGSGSNPILSKVASAFQEDSFTNDNSDLDKEQGFSPQTSKFAPEEIVLSGK----NKIYV 717

Query: 438 CHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKLK 486
           C  C++ F     L RH  S HS E+ + CP C  R KR+D++LQH+  K
Sbjct: 718 CKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 767

>KAFR0A00800 Chr1 complement(144493..146754) [2262 bp, 753 aa] {ON}
           Anc_1.326 YJL056C
          Length = 753

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 30/54 (55%)

Query: 437 KCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNY 490
           KCHLC+KSF   + LK H+ +H+ E+   C  C  R     NL +HMK    N+
Sbjct: 669 KCHLCDKSFSVSTSLKIHIRTHTGEKPLECKVCGRRFNESSNLSKHMKTHEHNF 722

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 22/47 (46%)

Query: 439 HLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKL 485
           H C K F +R  + RHL  HS  + Y C  C       + L QH ++
Sbjct: 615 HGCNKEFSQRQKIVRHLKVHSGFKPYKCEVCSKCFSSDETLKQHSRV 661

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 18/34 (52%)

Query: 436 HKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWC 469
           +KC +C K F     LK+H   HS E+ + C  C
Sbjct: 640 YKCEVCSKCFSSDETLKQHSRVHSGEKPFKCHLC 673

>TBLA0E04210 Chr5 (1066141..1067505) [1365 bp, 454 aa] {ON} 
          Length = 454

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 438 CHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKLK 486
           C+ C +SF     L RH  + H  E+ + CP C  R KR+D++LQH+  K
Sbjct: 392 CYECCRSFSSSHHLTRHKKTVHLNEKPFSCPRCRKRFKRRDHVLQHLNKK 441

>KLTH0G01826g Chr7 (135376..136299) [924 bp, 307 aa] {ON} some
           similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 307

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 437 KCHLCEKSFKRRSWLKRHLLSHSAERHYLC--PWCLSRHKRKDNLLQHMK 484
           KC +C K F R    +RH+ +H+ E+ + C  P C+ R  R D L +H++
Sbjct: 14  KCDMCGKGFHRLEHKRRHIRTHTGEKPHACNFPGCVKRFSRSDELKRHVR 63

>KNAG0B06710 Chr2 complement(1325084..1328245) [3162 bp, 1053 aa]
           {ON} Anc_4.351 YJR127C
          Length = 1053

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 29/54 (53%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYL 491
           C +C + F R   LKRH  SH+ E+ YLC +C     RKD +L+H    H   L
Sbjct: 24  CPVCSRGFVRLEHLKRHQRSHTREKPYLCVFCGRCFARKDLVLRHQGKLHPEVL 77

>Smik_7.251 Chr7 complement(423105..424622) [1518 bp, 505 aa] {ON}
           YGL035C (REAL)
          Length = 505

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 436 HKCHLCEKSFKRRSWLKRHLLSHSAERHYLC--PWCLSRHKRKDNLLQHMKLKHSN 489
           H C +C ++F R     RH+  H+ E+ + C  P C+ R  R D L +H ++ H+N
Sbjct: 38  HACPICHRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRI-HTN 92

>KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa]
           {ON} some similarities with uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 285

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPW--CLSRHKRKDNLLQHMKL 485
           C  C K F R S L+ H+L HS ++ + C W  C  +   K NL++H+KL
Sbjct: 234 CAQCGKQFTRPSALRTHMLVHSGDKPFECTWEGCNKKFNVKSNLIRHLKL 283

>KNAG0B00590 Chr2 (96235..97554) [1320 bp, 439 aa] {ON} Anc_3.518
           YGL209W
          Length = 439

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 47/93 (50%), Gaps = 10/93 (10%)

Query: 413 TSNNKLTITTLTNSDNSSPSNFIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLC--PWCL 470
           T+NN   + +L  +D + P    +KC +C + F R    KRHL +H+ E+ + C  P C 
Sbjct: 4   TANN---VDSLPENDENRP----YKCGICSRGFHRLEHKKRHLRTHTGEKPHKCVFPGCT 56

Query: 471 SRHKRKDNLLQHMKLKHSNYLLDELKNANVSFN 503
               R D L +H++  H+      +KN   +F+
Sbjct: 57  KGFSRGDELKRHLRT-HTGISSRNMKNQARNFH 88

>CAGL0L05786g Chr12 complement(638173..639219) [1047 bp, 348 aa]
           {ON} some similarities with uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 348

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 35/70 (50%), Gaps = 2/70 (2%)

Query: 418 LTITTLTNSDNSSPSNFIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPW--CLSRHKR 475
           +T T++T S     S    +C +C K   R S LK H L H+ +  + CPW  C      
Sbjct: 267 VTPTSITVSAIDELSKLRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNV 326

Query: 476 KDNLLQHMKL 485
           K N+L+H+K 
Sbjct: 327 KSNMLRHLKC 336

>Suva_2.383 Chr2 (674568..678527) [3960 bp, 1319 aa] {ON} YDR216W
           (REAL)
          Length = 1319

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (58%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHS 488
           C +C ++F R+  LKRH  SH+ E+ Y C  C     R+D L++H +  HS
Sbjct: 106 CEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIHS 156

>CAGL0M01870g Chr13 complement(219813..220760) [948 bp, 315 aa] {ON}
           some similarities with uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 315

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 42/83 (50%), Gaps = 8/83 (9%)

Query: 408 PSEQDTSN---NKLTITTLTNSDNSSPSNFIHKCHLCEKSFKRRSWLKRHLLSHSAERHY 464
           P++ +TSN    K +     N   S  + FI  C +C K FKR S L  H+  H+ E+ Y
Sbjct: 145 PADDETSNAFDEKFSAQAEINK-TSEDTKFI--CKVCLKKFKRPSSLSTHMNIHTGEKPY 201

Query: 465 LCPW--CLSRHKRKDNLLQHMKL 485
            CP+  C      K N+L+H KL
Sbjct: 202 PCPFDNCTKSFNAKSNMLRHYKL 224

>TBLA0B06050 Chr2 (1425041..1427329) [2289 bp, 762 aa] {ON}
           Anc_2.303 YNL027W
          Length = 762

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%)

Query: 435 IHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKL 485
           I+ C LC+K F R   LK HL +H+ ER ++C  C     R+ +  +H  L
Sbjct: 650 IYACELCDKKFTRPYNLKSHLRTHTNERPFICSICNKAFARQHDRKRHEDL 700

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 9/58 (15%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLC--------PW-CLSRHKRKDNLLQHMKLK 486
           C +C K+F R+   KRH   H+ ++ Y+C         W C  +  R D L +H K +
Sbjct: 681 CSICNKAFARQHDRKRHEDLHTGKKRYICGGKLKNGTSWGCGKKFARSDALGRHFKTE 738

>Kwal_47.19045 s47 complement(1074829..1075629) [801 bp, 266 aa]
           {ON} YGL209W (MIG2) - 1:1 [contig 188] FULL
          Length = 266

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 437 KCHLCEKSFKRRSWLKRHLLSHSAERHYLC--PWCLSRHKRKDNLLQHMK 484
           KC +C K F R    +RH+ +H+ E+ + C  P C+ R  R D L +H++
Sbjct: 15  KCDMCGKGFHRLEHKRRHIRTHTGEKPHSCNFPGCVKRFSRSDELKRHVR 64

>YDR216W Chr4 (895035..899006) [3972 bp, 1323 aa] {ON}  ADR1Carbon
           source-responsive zinc-finger transcription factor,
           required for transcription of the glucose-repressed gene
           ADH2, of peroxisomal protein genes, and of genes
           required for ethanol, glycerol, and fatty acid
           utilization
          Length = 1323

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (58%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHS 488
           C +C ++F R+  LKRH  SH+ E+ Y C  C     R+D L++H +  HS
Sbjct: 106 CEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIHS 156

>Skud_10.351 Chr10
           complement(617553..621332,621389..621469,621466..621510,
           621543..621620) [3984 bp, 1327 aa] {ON} YJR127C (REAL)
          Length = 1327

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (58%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHS 488
           C  C + F R+  LKRH  SH+ E+ YLC +C     R+D +L+H +  H+
Sbjct: 106 CPTCTRGFVRQEHLKRHQHSHTREKPYLCIFCGRCFARRDLVLRHQQKLHA 156

>KAFR0E04270 Chr5 complement(859635..863402) [3768 bp, 1255 aa] {ON}
           Anc_4.351 YJR127C
          Length = 1255

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (56%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHS 488
           C  C + F R+  LKRH  SH+ ER +LC  C     RKD +L+H +  H+
Sbjct: 51  CPTCTRGFVRQEHLKRHQRSHTRERPFLCVLCGRCFARKDLVLRHQQKLHA 101

>Smik_4.337 Chr4 (603613..606297) [2685 bp, 894 aa] {ON} YDR096W
           (REAL)
          Length = 894

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 435 IHKCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKLK 486
           I+ C  C + F     L RH  S HS E+ + CP C  R KR+D++LQH+  K
Sbjct: 827 IYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 879

>YDR096W Chr4 (637139..639823) [2685 bp, 894 aa] {ON}  GIS1JmjC
           domain-containing histone demethylase and transcription
           factor; involved in expression of genes during nutrient
           limitation; negatively regulates DPP1 and PHR1; activity
           is modulated by limited proteasome-mediated proteolysis;
           has a JmjC and a JmjN domain in the N-terminal region
           that interact, promoting Gis1p stability and proper
           transcriptional activity; contains transactivating
           domains TAD1 and TAD2 downstream of the Jmj domains and
           a C-terminal DNA binding domain
          Length = 894

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 435 IHKCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKLK 486
           I+ C  C + F     L RH  S HS E+ + CP C  R KR+D++LQH+  K
Sbjct: 827 IYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 879

>Smik_4.463 Chr4 (838900..842874) [3975 bp, 1324 aa] {ON} YDR216W
           (REAL)
          Length = 1324

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (58%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHS 488
           C +C ++F R+  LKRH  SH+ E+ Y C  C     R+D L++H +  HS
Sbjct: 112 CEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIHS 162

>Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON}
           complement(23868..25028) [1161 nt, 387 aa]
          Length = 386

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 43/86 (50%), Gaps = 10/86 (11%)

Query: 417 KLTITTLTNSDNSSPSNFIHK----CHLCEKSFKRRSWLKRHLLSHSAERHYLCPW--CL 470
           K  +T ++N+ ++S    I K    C +C K FKR S L  H+  H+  + + CP+  C 
Sbjct: 282 KKNVTNVSNTTSTSTGGNIEKIKYHCSICGKKFKRPSSLSTHMNIHTGNKPFTCPFTNCT 341

Query: 471 SRHKRKDNLLQ----HMKLKHSNYLL 492
                K N+L+    H KL   NY+L
Sbjct: 342 KSFNAKSNMLRHYKLHFKLSSGNYIL 367

>YER169W Chr5 (523369..525759) [2391 bp, 796 aa] {ON}  RPH1JmjC
           domain-containing histone demethylase; specifically
           demethylates H3K36 tri- and dimethyl modification
           states; associates with actively transcribed (RNA
           polymerase II) regions in vivo and specifically targets
           H3K36 in its trimethylation state as its substrate;
           transcriptional repressor of PHR1; Rph1p phosphorylation
           during DNA damage is under control of the MEC1-RAD53
           pathway
          Length = 796

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 433 NFIHKCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKLK 486
           N I+ C  C++ F     L RH  S HS E+ + CP C  R KR+D++LQH+  K
Sbjct: 706 NKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 760

>Kpol_1023.63 s1023 complement(144388..146058) [1671 bp, 556 aa]
           {ON} complement(144388..146058) [1671 nt, 557 aa]
          Length = 556

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 39/81 (48%), Gaps = 12/81 (14%)

Query: 422 TLTNSDNSSPSNFIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPW----------CLS 471
           T TN    S ++    CH C+ SF+ R +L RH+  H+ ++ Y CP+          C +
Sbjct: 166 TTTNKKLDSKNDGEFVCHYCDASFRIRGYLTRHIKKHAIQKAYCCPFYNKSSPPDIRCHT 225

Query: 472 R--HKRKDNLLQHMKLKHSNY 490
                R+D    H+K++H  Y
Sbjct: 226 SGGFSRRDTYKTHLKVRHFMY 246

>KLTH0H09196g Chr8 complement(789919..791301) [1383 bp, 460 aa] {ON}
           some similarities with uniprot|P27705 Saccharomyces
           cerevisiae YGL035C
          Length = 460

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 42/83 (50%), Gaps = 7/83 (8%)

Query: 409 SEQDTSNNKLTITTLTNSDNSSPSNFIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLC-- 466
           S  DT  NK   +   NS   SP  +I  C +C ++F R     RH+ +H+ E+ + C  
Sbjct: 3   STDDTKGNKKRRSP--NSGPDSPRPYI--CPICSRAFHRLEHQTRHIRTHTGEKPHACDF 58

Query: 467 PWCLSRHKRKDNLLQHMKLKHSN 489
           P C  +  R D L +H ++ H+N
Sbjct: 59  PGCTKKFSRSDELTRHKRI-HTN 80

>YGL035C Chr7 complement(431548..433062) [1515 bp, 504 aa] {ON}
           MIG1Transcription factor involved in glucose repression;
           sequence specific DNA binding protein containing two
           Cys2His2 zinc finger motifs; regulated by the SNF1
           kinase and the GLC7 phosphatase
          Length = 504

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 436 HKCHLCEKSFKRRSWLKRHLLSHSAERHYLC--PWCLSRHKRKDNLLQHMKLKHSN 489
           H C +C ++F R     RH+  H+ E+ + C  P C+ R  R D L +H ++ H+N
Sbjct: 38  HACPICHRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRI-HTN 92

>KLTH0G10802g Chr7 (908386..909966) [1581 bp, 526 aa] {ON} some
           similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 526

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 47/97 (48%), Gaps = 2/97 (2%)

Query: 389 LKKGTGANDITGIVNNGTIPSEQDTSNNKLTITTLTNSDNSSPSNFIHKCHLCEKSFKRR 448
           LK     ND +   ++G   +E+D+    ++  T   S   +P+  ++ C LC+K F R 
Sbjct: 363 LKPSKSHNDRSEEQSDGYDFTEEDSLPMNVSGVTRRKSIQKNPA--VYACELCDKKFTRP 420

Query: 449 SWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKL 485
             LK HL +H+ ER + C  C     R+ +  +H  L
Sbjct: 421 YNLKSHLRTHTDERPFACAICGKAFARQHDRKRHEDL 457

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 9/58 (15%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCP--------W-CLSRHKRKDNLLQHMKLK 486
           C +C K+F R+   KRH   H+ ++ Y C         W C  +  R D L +H K +
Sbjct: 438 CAICGKAFARQHDRKRHEDLHTGKKRYTCKGKLKDGTQWGCGKKFARSDALGRHFKTE 495

>Skud_4.478 Chr4 (849367..853338) [3972 bp, 1323 aa] {ON} YDR216W
           (REAL)
          Length = 1323

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (58%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHS 488
           C +C ++F R+  LKRH  SH+ E+ Y C  C     R+D L++H +  HS
Sbjct: 106 CEVCTRAFARQEHLKRHHRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIHS 156

>Kpol_1026.8 s1026 (16151..16525,16527..17390) [1239 bp, 412 aa]
           {ON} (16151..16525,16527..17390) [1239 nt, 413 aa]
          Length = 412

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 436 HKCHLCEKSFKRRSWLKRHLLSHSAERHYLC--PWCLSRHKRKDNLLQHMKLKHSN 489
           H C +C ++F R     RH+ +H+ E+ + C  P C+ +  R D L +H ++ H+N
Sbjct: 39  HVCPICNRAFHRLEHQTRHMRTHTGEKPHECDFPGCVKKFSRSDELTRHRRI-HTN 93

>CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa]
           {ON} weakly similar to uniprot|Q03125 Saccharomyces
           cerevisiae YDR043c NRG1
          Length = 463

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 37/70 (52%), Gaps = 3/70 (4%)

Query: 417 KLTITTLTNSDNSSPSNFIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPW--CLSRHK 474
           K +I++L NSD+       + C +C K F     L RH   H+ E+ ++CP+  C  R  
Sbjct: 384 KHSISSLCNSDDIELRRK-YLCKVCGKGFTTSGHLARHNRIHTGEKRHVCPYEGCGQRFN 442

Query: 475 RKDNLLQHMK 484
           R DN LQH K
Sbjct: 443 RHDNCLQHYK 452

>Suva_12.218 Chr12 complement(338418..342230) [3813 bp, 1270 aa]
           {ON} YJR127C (REAL)
          Length = 1270

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (58%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHS 488
           C  C + F R+  LKRH  SH+ E+ YLC +C     R+D +L+H +  H+
Sbjct: 38  CPTCTRGFVRQEHLKRHQHSHTREKPYLCIFCGRCFARRDLVLRHQQKLHA 88

>Suva_2.255 Chr2 (436524..439208) [2685 bp, 894 aa] {ON} YDR096W
           (REAL)
          Length = 894

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 435 IHKCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKLK 486
           I+ C  C + F     L RH  S HS E+ + CP C  R KR+D++LQH+  K
Sbjct: 827 IYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 879

>TBLA0E04770 Chr5 complement(1228439..1233406) [4968 bp, 1655 aa]
           {ON} Anc_4.351 YJR127C
          Length = 1655

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 29/50 (58%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKH 487
           C +C + F R+  L+RH  +H+ E+ +LC +C     R+D +L+H    H
Sbjct: 89  CQICTRGFVRQEHLRRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLH 138

>YJR127C Chr10 complement(658917..663059) [4143 bp, 1380 aa] {ON}
           RSF2Zinc-finger protein involved in transcriptional
           control of both nuclear and mitochondrial genes, many of
           which specify products required for glycerol-based
           growth, respiration, and other functions
          Length = 1380

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (58%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHS 488
           C  C + F R+  LKRH  SH+ E+ YLC +C     R+D +L+H +  H+
Sbjct: 153 CPTCTRGFVRQEHLKRHQHSHTREKPYLCIFCGRCFARRDLVLRHQQKLHA 203

>CAGL0H04213g Chr8 (398544..402509) [3966 bp, 1321 aa] {ON} similar
           to uniprot|Q04545 Saccharomyces cerevisiae YML081w
          Length = 1321

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (59%)

Query: 436 HKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQH 482
           H C +C + F R   LKRH  +H+ E+ +LC +C     R+D +L+H
Sbjct: 33  HLCPICTRGFVRLEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRH 79

>Smik_10.420 Chr10
           complement(647997..651776,651798..651836,651840..652019,
           652023..652070) [4047 bp, 1348 aa] {ON} YJR127C (REAL)
          Length = 1348

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (58%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHS 488
           C  C + F R+  LKRH  SH+ E+ YLC +C     R+D +L+H +  H+
Sbjct: 127 CPTCTRGFVRQEHLKRHQHSHTREKPYLCIFCGRCFARRDLVLRHQQKLHA 177

>YDR463W Chr4 (1386816..1388375) [1560 bp, 519 aa] {ON}
           STP1Transcription factor, undergoes proteolytic
           processing by SPS (Ssy1p-Ptr3p-Ssy5p)-sensor component
           Ssy5p in response to extracellular amino acids;
           activates transcription of amino acid permease genes and
           may have a role in tRNA processing
          Length = 519

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 36/75 (48%), Gaps = 14/75 (18%)

Query: 428 NSSPSNFIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWC-------LSRH-----KR 475
           N+    FI  CH C+ +F+ R +L RH+  H+ E+ Y CP+        L  H      R
Sbjct: 154 NNGEEEFI--CHYCDATFRIRGYLTRHIKKHAIEKAYHCPFFNSATPPDLRCHNSGGFSR 211

Query: 476 KDNLLQHMKLKHSNY 490
           +D    H+K +H  Y
Sbjct: 212 RDTYKTHLKARHVLY 226

>Suva_5.303 Chr5 (491206..492999,493030..493629) [2394 bp, 797 aa]
           {ON} YER169W (REAL)
          Length = 797

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 433 NFIHKCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKLK 486
           N I+ C  C++ F     L RH  S HS E+ + CP C  R KR+D++LQH+  K
Sbjct: 707 NKIYVCKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 761

>Smik_5.341 Chr5 (522964..525360) [2397 bp, 798 aa] {ON} YER169W
           (REAL)
          Length = 798

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 430 SPSNFIHKCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKLK 486
           S  N I+ C  C++ F     L RH  S HS E+ + CP C  R KR+D++LQH+  K
Sbjct: 705 SGKNKIYVCKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 762

>KNAG0D03710 Chr4 (675160..676539) [1380 bp, 459 aa] {ON} Anc_4.80
           YGL035C
          Length = 459

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 436 HKCHLCEKSFKRRSWLKRHLLSHSAERHYLC--PWCLSRHKRKDNLLQHMKLKHSN 489
           H C +C ++F R     RH+ +H+ E+ + C  P C  R  R D L +H ++ H+N
Sbjct: 43  HVCPVCGRAFHRLEHQTRHMRTHTGEKPHACDFPGCTKRFSRSDELTRHKRI-HTN 97

>NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON}
           Anc_2.162
          Length = 1064

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 34/68 (50%), Gaps = 3/68 (4%)

Query: 437 KCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNY--LLDE 494
           +C+ C K F +   L+ H   H+ E+ Y C  C  R  RK NL  H KL H +    + +
Sbjct: 629 QCNFCGKRFTQGGNLRTHQRLHTGEKPYRCEICDKRFSRKGNLAAH-KLTHRDVKPFVCK 687

Query: 495 LKNANVSF 502
           L N N +F
Sbjct: 688 LDNCNKTF 695

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 26/50 (52%)

Query: 436 HKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKL 485
           H+C  C + F + + L+ H+ SH   + + C +C  R  +  NL  H +L
Sbjct: 600 HECPYCHRLFSQSTHLEVHIRSHLGYKPFQCNFCGKRFTQGGNLRTHQRL 649

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 28/60 (46%), Gaps = 2/60 (3%)

Query: 436 HKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPW--CLSRHKRKDNLLQHMKLKHSNYLLD 493
           ++C +C+K F R+  L  H L+H   + ++C    C     +  N+  H    H   LL+
Sbjct: 656 YRCEICDKRFSRKGNLAAHKLTHRDVKPFVCKLDNCNKTFTQLGNMKAHQNKFHLQTLLE 715

>KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.162
           YOR113W
          Length = 572

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%)

Query: 436 HKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKL 485
           H+C++C K F + + L+ HL SH  ++ Y C WC     +  NL  H++L
Sbjct: 388 HECNICHKLFIQLTHLEVHLRSHLGDKPYKCTWCGKGFTQGGNLKTHVRL 437

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 26/48 (54%)

Query: 436 HKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHM 483
           +KC  C K F +   LK H+  H+ E+ + C +C  R  RK NL  H+
Sbjct: 416 YKCTWCGKGFTQGGNLKTHVRLHTGEKPFSCEFCSKRFSRKGNLTAHL 463

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 26/58 (44%), Gaps = 2/58 (3%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPW--CLSRHKRKDNLLQHMKLKHSNYLLD 493
           C  C K F R+  L  HL++H   R ++C    C+    +  N+  H    H N L +
Sbjct: 446 CEFCSKRFSRKGNLTAHLVTHEKVRPFVCKLNGCMKTFTQLGNMKSHQNRFHQNTLTE 503

>Skud_7.249 Chr7 complement(434181..435689) [1509 bp, 502 aa] {ON}
           YGL035C (REAL)
          Length = 502

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 436 HKCHLCEKSFKRRSWLKRHLLSHSAERHYLC--PWCLSRHKRKDNLLQHMKLKHSN 489
           H C +C ++F R     RH+  H+ E+ + C  P C+ R  R D L +H ++ H+N
Sbjct: 38  HACPICHRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRI-HTN 92

>CAGL0E04312g Chr5 (412800..414866) [2067 bp, 688 aa] {ON} some
           similarities with uniprot|P38704 Saccharomyces
           cerevisiae YHR006w SPT2 or uniprot|Q00947 Saccharomyces
           cerevisiae YDR463w STP1
          Length = 688

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 12/65 (18%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRH------------KRKDNLLQHMKL 485
           CH C+  F+ R +L RH+  H+ E+ Y CP+   +              R+D    HMK 
Sbjct: 200 CHYCDAKFRIRGYLTRHIKKHAIEKAYHCPFYNGQEVPSKRCHNSGGFSRRDTYKTHMKA 259

Query: 486 KHSNY 490
           +H  Y
Sbjct: 260 RHLIY 264

>NDAI0B02250 Chr2 (559530..563000) [3471 bp, 1156 aa] {ON} Anc_8.234
          Length = 1156

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 435  IHKCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKLK 486
            I+ C  C++ F     L RH  S HS E+ + CP C  + KR+D++LQH+  K
Sbjct: 997  IYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 1049

>SAKL0H20988g Chr8 complement(1832478..1834124) [1647 bp, 548 aa]
           {ON} weakly similar to uniprot|P27705 Saccharomyces
           cerevisiae YGL035C MIG1 Transcription factor involved in
           glucose repression; C2H2 zinc finger protein similar to
           mammalian Egr and Wilms tumor proteins
          Length = 548

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 36/67 (53%), Gaps = 5/67 (7%)

Query: 425 NSDNSSPSNFIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLC--PWCLSRHKRKDNLLQH 482
           NS   SP  ++  C +C ++F R     RH+ +H+ E+ + C  P C  R  R D L +H
Sbjct: 25  NSGPDSPRPYV--CPICSRAFHRLEHQTRHIRTHTGEKPHACEFPGCGKRFSRSDELTRH 82

Query: 483 MKLKHSN 489
            ++ H+N
Sbjct: 83  TRI-HTN 88

>ZYRO0B14894g Chr2 complement(1212853..1216212) [3360 bp, 1119 aa]
           {ON} similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1119

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHS 488
           C +C + F R+  LKRH  SH+ E+ +LC +C     R+D +L+H    H+
Sbjct: 77  CSICTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRHQHKLHA 127

>NCAS0H02890 Chr8 complement(564830..566428) [1599 bp, 532 aa] {ON}
           Anc_5.586
          Length = 532

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 12/65 (18%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPW----CLSRHK--------RKDNLLQHMKL 485
           CH C+  F+ R +L RH+  H+ E+ Y CP+     LS  +        R+D    H+K 
Sbjct: 185 CHYCDAKFRIRGYLTRHIKKHAVEKAYHCPFFNSDILSESRCHNTGGFSRRDTYKTHLKA 244

Query: 486 KHSNY 490
           +H  Y
Sbjct: 245 RHFVY 249

>Smik_4.742 Chr4 (1308041..1309627) [1587 bp, 528 aa] {ON} YDR463W
           (REAL)
          Length = 528

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 12/65 (18%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWC-------LSRH-----KRKDNLLQHMKL 485
           CH C+ +F+ R +L RH+  H+ E+ Y CP+        L  H      R+D    H+K 
Sbjct: 162 CHYCDATFRIRGYLTRHIKKHAIEKAYHCPFFNNATPPDLRCHNSGGFSRRDTYKTHLKA 221

Query: 486 KHSNY 490
           +H  Y
Sbjct: 222 RHVLY 226

>TPHA0D03400 Chr4 complement(714580..715596) [1017 bp, 338 aa] {ON}
           Anc_3.518 YGL209W
          Length = 338

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPW--CLSRHKRKDNLLQHMKL 485
           C +C K F+R    KRH+ +H+ E+ + C +  C+ +  R D L +H+K+
Sbjct: 15  CDICSKGFRRLEHKKRHIRTHTGEKPHHCTFKGCVKKFSRSDELKRHLKI 64

>Skud_4.739 Chr4 (1306825..1308369) [1545 bp, 514 aa] {ON} YDR463W
           (REAL)
          Length = 514

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 12/65 (18%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWC-------LSRH-----KRKDNLLQHMKL 485
           CH C+ +F+ R +L RH+  H+ E+ Y CP+        L  H      R+D    H+K 
Sbjct: 162 CHYCDATFRIRGYLTRHIKKHAIEKAYHCPFFNGATPPDLRCHNSGGFSRRDTYKTHLKA 221

Query: 486 KHSNY 490
           +H  Y
Sbjct: 222 RHVLY 226

>TPHA0G00820 Chr7 (153365..154963) [1599 bp, 532 aa] {ON} Anc_2.303
           YNL027W
          Length = 532

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 2/78 (2%)

Query: 408 PSEQDTSNNKLTITTLTNSDNSSPSNFIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCP 467
           P E+  +   L+ TT   +   +PS  I+ C +CEK F R   L+ HL +H+ ER ++C 
Sbjct: 394 PLEEGETPQNLSGTTRRRNSKKNPS--IYDCVICEKKFTRPYNLRSHLRTHTNERPFVCT 451

Query: 468 WCLSRHKRKDNLLQHMKL 485
            C     R+ +  +H  L
Sbjct: 452 VCGKAFAREHDRKRHEDL 469

 Score = 37.4 bits (85), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 9/58 (15%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLC--------PW-CLSRHKRKDNLLQHMKLK 486
           C +C K+F R    KRH   H+ ++ Y+C         W C  +  R D L +H K +
Sbjct: 450 CTVCGKAFAREHDRKRHEDLHTGKKRYICGGKLKSGEAWGCGKKFARSDALGRHFKTE 507

>CAGL0L00583g Chr12 (71544..72710) [1167 bp, 388 aa] {ON} similar to
           uniprot|Q12132 Saccharomyces cerevisiae YPL230w USV1
          Length = 388

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 37/88 (42%), Gaps = 8/88 (9%)

Query: 444 SFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLDELKNANVSFN 503
           +F R     RH+  H+ E+ + C  C+    R DNL QH    HS        N    FN
Sbjct: 2   AFTRAEHHARHIRKHTGEKPFQCDICMKFFSRIDNLKQHKDSVHS-------ANKAKGFN 54

Query: 504 WGTYDGQNSTDSMPKTLSGYPDSSIKKL 531
              Y GQ       K+ S  PDS I KL
Sbjct: 55  -SVYYGQKKVKQNKKSESSSPDSIISKL 81

>TBLA0E02820 Chr5 complement(699189..700127) [939 bp, 312 aa] {ON}
           Anc_5.586 YHR006W
          Length = 312

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 38/80 (47%), Gaps = 14/80 (17%)

Query: 423 LTNSDNSSPSNFIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWC-------LSRH-- 473
           + N +     N+I  CH C+ SF+  S+L RH+  H+ E+ + CP+        L  H  
Sbjct: 2   VKNGEEGVEGNYI--CHYCDASFRLMSYLTRHIKKHAIEKAFKCPFYNEKLPADLRCHVS 59

Query: 474 ---KRKDNLLQHMKLKHSNY 490
               RKD    H+K +H  Y
Sbjct: 60  GGFSRKDTFKMHLKCRHFIY 79

>YGL209W Chr7 (95858..97006) [1149 bp, 382 aa] {ON}  MIG2Zinc finger
           transcriptional repressor; cooperates with Mig1p in
           glucose-induced repression of many genes including SUC2
           (invertase); binds to Mig1p-binding sites in SUC2
           promoter; under low glucose conditions Mig2p relocalizes
           to mitochondrion, where it regulates morphology,
           interacts with Ups1p and antagonizes mitochondrial
           fission factor, Dnm1p, indicative of a role in promoting
           mitochondrial fusion or regulating morphology
          Length = 382

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 3/66 (4%)

Query: 437 KCHLCEKSFKRRSWLKRHLLSHSAERHYLC--PWCLSRHKRKDNLLQHMKLKHSNYLLDE 494
           +C  C + F R    KRHL +H+ E+ + C  P C     R D L +HM+  H+      
Sbjct: 18  RCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRT-HTGQSQRR 76

Query: 495 LKNANV 500
           LK A+V
Sbjct: 77  LKKASV 82

>KLLA0C16005g Chr3 (1397274..1398269) [996 bp, 331 aa] {ON} some
           similarities with uniprot|Q12132 Saccharomyces
           cerevisiae YPL230W USV1 Up in StarVation
          Length = 331

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query: 441 CEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHS-NYLLDELKNA 498
           C   F R+  L RH+  H+ E+ + C  CL    R DNL QH++  HS +    +LKN+
Sbjct: 28  CRMEFTRQEHLARHIRKHTGEQPFQCHLCLRFFSRLDNLKQHVESVHSVSMATSQLKNS 86

>SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 819

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 26/53 (49%), Gaps = 1/53 (1%)

Query: 437 KCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSN 489
           +C  C K F +   L+ H   H+ E+ Y C  C  R  RK NL  HM L H N
Sbjct: 569 QCEYCGKRFTQGGNLRTHTRLHTGEKPYSCEKCGKRFSRKGNLAAHM-LTHEN 620

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 26/50 (52%)

Query: 436 HKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKL 485
           H+C  C K F + + L+ H+ SH   + + C +C  R  +  NL  H +L
Sbjct: 540 HECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHTRL 589

>TBLA0E04220 Chr5 (1069230..1070789) [1560 bp, 519 aa] {ON}
           Anc_8.234 YER169W
          Length = 519

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 438 CHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKLK 486
           C  C +SF     L RH  + H  E+ + CP C  R KR+D++LQH+  K
Sbjct: 449 CFECRRSFSSSHHLTRHRKTVHLNEKPFSCPKCGKRFKRRDHVLQHLNKK 498

>KNAG0B03350 Chr2 complement(647618..649420) [1803 bp, 600 aa] {ON}
           Anc_5.586 YHR006W
          Length = 600

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 12/65 (18%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWC-------LSRH-----KRKDNLLQHMKL 485
           CH C+ +FK R +L RH+  H+ ++ Y CP+        L  H      R+D    H+K 
Sbjct: 201 CHYCDATFKIRGYLTRHIKKHAIDKAYHCPFFNATLGTELKCHNTGGFSRRDTYKTHLKT 260

Query: 486 KHSNY 490
           +H  Y
Sbjct: 261 RHFVY 265

>KNAG0A04460 Chr1 complement(619911..623783) [3873 bp, 1290 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1290

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 431 PSNFIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKH 487
           P  F+  C +C ++F R   L+RH  SH+ E+ Y C  C     R+D LL+H    H
Sbjct: 72  PRRFV--CKVCTRAFARSEHLERHERSHTNEKPYECGICDRMFTRRDLLLRHALKTH 126

>TPHA0K01770 Chr11 (374701..376257) [1557 bp, 518 aa] {ON} Anc_4.80
           YGL035C
          Length = 518

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 47/90 (52%), Gaps = 6/90 (6%)

Query: 405 GTIPSEQDTSNNKLTITTLTNSDNSSPSNFI---HKCHLCEKSFKRRSWLKRHLLSHSAE 461
            ++ +E+  S N  TI   +++ N+S +N     H C  C ++F R     RH+ +H+ E
Sbjct: 35  ASLNAEKAASTNANTIEKRSSNGNTSATNEKPRPHVCGTCGRAFHRLEHQTRHMRTHTGE 94

Query: 462 RHYLCPW--CLSRHKRKDNLLQHMKLKHSN 489
           + + C +  C  R  R D L +H ++ H+N
Sbjct: 95  KPHACDFQGCTKRFSRSDELTRHKRI-HTN 123

>KAFR0C00490 Chr3 complement(97556..98230) [675 bp, 224 aa] {ON}
           Anc_3.281 YBR066C
          Length = 224

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 436 HKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPW--CLSRHKRKDNLLQHMK 484
           H C +C  +F     L RH   H+ E+ Y+CP+  C  R  R DN +QH K
Sbjct: 158 HVCKVCTMAFTTSGHLSRHNKIHTGEKKYVCPFEGCGQRFSRHDNCVQHHK 208

>TPHA0B02910 Chr2 complement(662998..665151) [2154 bp, 717 aa] {ON}
           Anc_2.162 YOR113W
          Length = 717

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 35/70 (50%), Gaps = 7/70 (10%)

Query: 437 KCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNL----LQHMKLKHSNYLL 492
           +C  C K F +   L+ H   H+ E+ Y C  C  R  RK NL    L H KLK   Y+ 
Sbjct: 438 QCEFCGKRFTQGGNLRTHQRLHTGEKPYNCEMCGKRFSRKGNLAAHALTHQKLKP--YIC 495

Query: 493 DELKNANVSF 502
            +L+N N SF
Sbjct: 496 -KLENCNKSF 504

 Score = 38.5 bits (88), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 26/50 (52%)

Query: 436 HKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKL 485
           H+C  C + F + + L+ H+ SH   + + C +C  R  +  NL  H +L
Sbjct: 409 HECPYCHRFFTQSTHLEVHVRSHIGYKPFQCEFCGKRFTQGGNLRTHQRL 458

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 24/57 (42%), Gaps = 2/57 (3%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPW--CLSRHKRKDNLLQHMKLKHSNYLL 492
           C +C K F R+  L  H L+H   + Y+C    C     +  N+  H    H   L+
Sbjct: 467 CEMCGKRFSRKGNLAAHALTHQKLKPYICKLENCNKSFTQLGNMKAHQNRFHLKTLM 523

>KNAG0F01710 Chr6 (320407..321648) [1242 bp, 413 aa] {ON} Anc_6.256
           YPL230W
          Length = 413

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 33/69 (47%), Gaps = 3/69 (4%)

Query: 423 LTNSDNSSPSNFIHKCH---LCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNL 479
           + N ++ S    + KC     C  +F R   L RH+  H+ E+ + C  CL    R DNL
Sbjct: 30  VKNGESKSKCKKMFKCQGFEDCHMAFTRAEHLARHIRKHTGEKPFQCYICLKHFSRVDNL 89

Query: 480 LQHMKLKHS 488
            QH +  HS
Sbjct: 90  KQHRESVHS 98

>TDEL0D00670 Chr4 (117923..121522) [3600 bp, 1199 aa] {ON} Anc_4.351
           YJR127C
          Length = 1199

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 31/54 (57%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYL 491
           C +C + F R+  LKRH  SH+ E+ +LC +C     R+D +L+H    H + +
Sbjct: 59  CPICTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRHQHKLHGSLV 112

>Kpol_423.15 s423 (33422..34600) [1179 bp, 392 aa] {ON}
           (33422..34600) [1179 nt, 393 aa]
          Length = 392

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPW--CLSRHKRKDNLLQHMKLKHSNYL 491
           C +C K F+R    KRH+ +H+ E+ ++C +  C     R D L +HM +  +  L
Sbjct: 29  CEICTKGFRRLEHKKRHIRTHTGEKPHVCTFQGCPKSFSRSDELKRHMNIHSTGEL 84

>Kpol_1023.100 s1023 (235260..238010) [2751 bp, 916 aa] {ON}
           (235260..238010) [2751 nt, 917 aa]
          Length = 916

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 30/54 (55%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYL 491
           C  C + F RR  LKRH  +H+ E+ ++C +C     R+D +++H    H + L
Sbjct: 43  CPTCSRGFVRREHLKRHQRAHTKEKPFVCVFCGRCFARRDLIIRHQNKLHFDIL 96

>TDEL0F05500 Chr6 (1024045..1027668) [3624 bp, 1207 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1207

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKH 487
           C +C ++F R+  L RH  SH+ E+ Y C  C     R+D LL+H    H
Sbjct: 61  CQICTRAFARQEHLTRHERSHTKEKPYSCGICNRNFSRRDLLLRHAHKVH 110

>TPHA0A04530 Chr1 (1027935..1029440) [1506 bp, 501 aa] {ON} 
          Length = 501

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 38/77 (49%), Gaps = 4/77 (5%)

Query: 435 IHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPW--CLSRHKRKDNLLQHMKLK-HSNYL 491
           IH+C +C +   R   L  H+L H+ ++ + C W  C      K NL +HMK+  H    
Sbjct: 425 IHQCPICNRVTTRSYSLHAHMLVHTKDKPFKCEWQDCGKAFSIKSNLSRHMKIHIHKQKK 484

Query: 492 LD-ELKNANVSFNWGTY 507
           L+ E +  N + N  TY
Sbjct: 485 LNKETRETNDTTNNDTY 501

>Kpol_1072.58 s1072 complement(131384..133768) [2385 bp, 794 aa]
           {ON} complement(131384..133768) [2385 nt, 795 aa]
          Length = 794

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 32/70 (45%), Gaps = 7/70 (10%)

Query: 437 KCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNL----LQHMKLKHSNYLL 492
           +C  C K F +   L+ H   H+ ER Y C  C  +  RK NL    L H KLK     L
Sbjct: 537 QCEYCGKRFTQGGNLRTHQRLHTGERPYSCELCGKKFSRKGNLAAHFLTHQKLKPYVCKL 596

Query: 493 DELKNANVSF 502
           DE    N SF
Sbjct: 597 DE---CNKSF 603

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 26/50 (52%)

Query: 436 HKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKL 485
           H+C  C + F + + L+ H+ SH   + + C +C  R  +  NL  H +L
Sbjct: 508 HECPYCHRFFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHQRL 557

 Score = 38.9 bits (89), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 2/60 (3%)

Query: 436 HKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPW--CLSRHKRKDNLLQHMKLKHSNYLLD 493
           + C LC K F R+  L  H L+H   + Y+C    C     +  N+  H    H N L++
Sbjct: 564 YSCELCGKKFSRKGNLAAHFLTHQKLKPYVCKLDECNKSFTQLGNMKAHQNRFHLNTLME 623

>NDAI0I00990 Chr9 complement(236716..237945) [1230 bp, 409 aa] {ON}
           Anc_6.256
          Length = 409

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 23/47 (48%)

Query: 441 CEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKH 487
           C   F R   L RH+  H+ E+ + C  CL    R DNL QH +  H
Sbjct: 23  CSMVFTREEHLARHIRKHTGEKPFQCDICLRFFSRVDNLKQHRETVH 69

>SAKL0H17842g Chr8 complement(1584215..1586659) [2445 bp, 814 aa]
           {ON} similar to uniprot|P39956 Saccharomyces cerevisiae
           YER169W RPH1 Transcriptional repressor of PHR1 which is
           a photolyase induced by DNA damage binds to AG(4)
           (C(4)T) sequence upstream of PHR1 Rph1p phosphorylation
           during DNA damage is under control of the MEC1-RAD53
           pathway
          Length = 814

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 435 IHKCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKLK 486
           ++ C  C++ F     L RH  S HS E+ + CP C  + KR+D++LQH+  K
Sbjct: 717 VYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 769

>NCAS0F00910 Chr6 (183289..184341) [1053 bp, 350 aa] {ON} 
          Length = 350

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 435 IHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPW--CLSRHKRKDNLLQHMK 484
           +H C +C KS  R + L+ H+L H+  R + C W  C +    K N+ +H K
Sbjct: 284 LHICVVCGKSLTRSTSLRTHMLIHTGSRPFKCSWPNCKASSSVKSNITRHFK 335

>KAFR0F04150 Chr6 complement(816551..817801) [1251 bp, 416 aa] {ON}
           Anc_3.518 YGL209W
          Length = 416

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 437 KCHLCEKSFKRRSWLKRHLLSHSAERHYLC--PWCLSRHKRKDNLLQHMK 484
           KC +C + F R     RH+++H+ E+ + C  P C+ +  R D L +H K
Sbjct: 19  KCDICSRGFHRLEHKNRHIMTHTGEKPHQCSFPGCVKKFSRGDELKRHAK 68

>KLLA0F23782g Chr6 (2219920..2222268) [2349 bp, 782 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 782

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 32/67 (47%), Gaps = 1/67 (1%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLDELKN 497
           C  C K F +   L+ H+  H+ E+ Y C  C  +  RK NL  H KL H N    E K 
Sbjct: 553 CEFCGKRFTQGGNLRTHIRLHTGEKPYECERCGRKFSRKGNLAAH-KLTHDNLKPFECKL 611

Query: 498 ANVSFNW 504
            + + N+
Sbjct: 612 DDCNKNF 618

>KNAG0H03010 Chr8 (560630..562984) [2355 bp, 784 aa] {ON} Anc_8.234
           YER169W
          Length = 784

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 430 SPSNFIHKCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKLK 486
           SP    + C  C+++F     L RH  S HS E+ + CP C  + KR+D++LQH+  K
Sbjct: 719 SPQGKTYICVDCKRTFSSGHHLTRHKKSVHSFEKPHSCPKCGKKFKRRDHVLQHLNKK 776

>CAGL0K06413g Chr11 (628640..629719) [1080 bp, 359 aa] {ON} some
           similarities with uniprot|Q00947 Saccharomyces
           cerevisiae YDR463w STP1
          Length = 359

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 38/92 (41%), Gaps = 14/92 (15%)

Query: 411 QDTSNNKLTITTLTNSDNSSPSNFIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWC- 469
           +D    KL      +        F+  CH C+  FK R +L RH+  H+ ++ Y CP+  
Sbjct: 18  KDVVGRKLVKEEEVSKTRHEQEEFV--CHYCDARFKIRGYLTRHIKKHALQKAYYCPYYN 75

Query: 470 ------LSRH-----KRKDNLLQHMKLKHSNY 490
                 L  H      R+D    HMK +H  Y
Sbjct: 76  EKAPPDLRCHNNGGFSRRDTYKAHMKTRHIMY 107

>SAKL0H20416g Chr8 (1789596..1790549) [954 bp, 317 aa] {ON} weakly
           similar to uniprot|Q6Q5F4 Saccharomyces cerevisiae
           YPR015C Hypothetical ORF
          Length = 317

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 49/104 (47%), Gaps = 11/104 (10%)

Query: 388 ILKKGTGANDITGIVNNGTIPSEQDTSNNKLTITTLTNSDNSSPSNFI-----HKCHLCE 442
           I  + T  N  T  V++ T    Q +++N +     T ++NS P++ +      +C +C 
Sbjct: 209 IQPRETVYNSPTNSVSSNT----QASTSNYVPFQETTAANNSGPTDSLSARLKRQCPICG 264

Query: 443 KSFKRRSWLKRHLLSHSAERHYLCPW--CLSRHKRKDNLLQHMK 484
           K   R S LK H L H+    + CPW  C      K N+L+H K
Sbjct: 265 KLCSRPSTLKTHFLIHTGATPFKCPWLNCNKSFNVKSNMLRHYK 308

>TBLA0B01280 Chr2 complement(271520..273991) [2472 bp, 823 aa] {ON}
           Anc_2.162 YOR113W
          Length = 823

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 34/71 (47%), Gaps = 7/71 (9%)

Query: 436 HKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNL----LQHMKLKHSNYL 491
           ++C+ C K F +   LK H   H+ E+ Y C  C  R  RK NL    L H KLK     
Sbjct: 545 YQCNFCGKKFTQGGNLKTHQRLHTGEKPYSCKICNKRFSRKGNLTAHVLTHKKLKP---Y 601

Query: 492 LDELKNANVSF 502
             +L N N +F
Sbjct: 602 FCKLDNCNKTF 612

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 45/99 (45%), Gaps = 7/99 (7%)

Query: 388 ILKKGTGANDITGIVNNGTIP-SEQDTSNNKLTITTLTNSDNSSPSNFIHKCHLCEKSFK 446
           I ++ T AN IT  + +  +  S Q   NN L+ T       S      H+C  C + F 
Sbjct: 474 IKQETTAANTITSPMGSPLLSTSPQTPVNNDLSPT------RSRTKKKTHQCPYCHRFFS 527

Query: 447 RRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKL 485
           + + L+ H+ SH   + Y C +C  +  +  NL  H +L
Sbjct: 528 QSTHLEVHIRSHIGYKPYQCNFCGKKFTQGGNLKTHQRL 566

>Kwal_56.23453 s56 complement(545262..547748) [2487 bp, 828 aa] {ON}
           YER169W (RPH1) - Repressor of PHR1 transcription; binds
           to PHR1 URS [contig 177] FULL
          Length = 828

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 435 IHKCHLCEKSFKRRSWLKRHLLS-HSAERHYLCPWCLSRHKRKDNLLQHMKLK 486
           ++ C  C + F     L RH  S HS E+ + CP C  + KR+D++LQH+  K
Sbjct: 734 VYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 786

>Ecym_4128 Chr4 (270876..271814) [939 bp, 312 aa] {ON} similar to
           Ashbya gossypii AGR186C
          Length = 312

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 434 FIHK-CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKL 485
           F+ K C LC KSF RRS L+ HLL H+  + + C +C      K NL +H ++
Sbjct: 168 FVSKICPLCGKSFTRRSTLQIHLLIHTNLKPFKCSFCEKEFNVKSNLNRHERI 220

>KLTH0G14454g Chr7 (1263253..1265751) [2499 bp, 832 aa] {ON} some
           similarities with uniprot|P39956 Saccharomyces
           cerevisiae YER169W RPH1 Transcriptional repressor of
           PHR1 which is a photolyase induced by DNA damage binds
           to AG(4) (C(4)T) sequence upstream of PHR1 Rph1p
           phosphorylation during DNA damage is under control of
           the MEC1-RAD53 pathway
          Length = 832

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 40/79 (50%), Gaps = 5/79 (6%)

Query: 409 SEQDTSNNKLTITTLTNSDNSSPSNFIHKCHLCEKSFKRRSWLKRHLLS-HSAERHYLCP 467
           S +  + +K++   +  SD       ++ C  C + F     L RH  S HS E+ + CP
Sbjct: 716 SRRPVTQSKISSEEIIVSDKGK----VYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCP 771

Query: 468 WCLSRHKRKDNLLQHMKLK 486
            C  + KR+D++LQH+  K
Sbjct: 772 KCGKKFKRRDHVLQHLNKK 790

>Suva_2.200 Chr2 complement(341892..342590) [699 bp, 232 aa] {ON}
           YDR043C (REAL)
          Length = 232

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 2/49 (4%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPW--CLSRHKRKDNLLQHMK 484
           C +C + F     L RH   H+ E+++ CP+  C  R  R DN LQH +
Sbjct: 177 CKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYR 225

>KLLA0E08713g Chr5 (777005..778795) [1791 bp, 596 aa] {ON} some
           similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 596

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 35/74 (47%), Gaps = 6/74 (8%)

Query: 435 IHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKL---KHSNYL 491
           ++ C +C+K F R   LK HL SH+ ER Y+C  C     R  +  +H  L   K     
Sbjct: 468 VYACDICDKKFTRPYNLKSHLRSHTDERPYVCSVCGKAFARMHDKNRHEDLHTGKRRYVC 527

Query: 492 LDELKNANVSFNWG 505
              LKN N   +WG
Sbjct: 528 GGILKNGN---SWG 538

>SAKL0E07216g Chr5 complement(592229..593875) [1647 bp, 548 aa] {ON}
           some similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 548

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 33/68 (48%)

Query: 418 LTITTLTNSDNSSPSNFIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKD 477
           L +T  T    S  +  I+ C LC+K F R   LK HL +H+ ER + C  C     R+ 
Sbjct: 406 LNLTGNTKRKTSQKNPAIYACELCDKKFTRPYNLKSHLRTHTDERPFACNVCGKAFARQH 465

Query: 478 NLLQHMKL 485
           +  +H  L
Sbjct: 466 DRKRHEDL 473

 Score = 37.7 bits (86), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 9/56 (16%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLC--------PW-CLSRHKRKDNLLQHMK 484
           C++C K+F R+   KRH   H+ ++ Y+C         W C  +  R D L +H K
Sbjct: 454 CNVCGKAFARQHDRKRHEDLHTGKKRYICGGNLKDGTSWGCGKKFARSDALGRHFK 509

>KNAG0C06030 Chr3 (1176811..1177755) [945 bp, 314 aa] {ON} Anc_5.586
           YHR006W
          Length = 314

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 14/77 (18%)

Query: 426 SDNSSPSNFIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWC-------LSRH----- 473
           S +S+   F+  CH C+  F+ R +L RH+  H+ E+ + CP+        L  H     
Sbjct: 53  SSSSAMEPFV--CHYCDARFRMRGYLTRHIKKHAIEKAFRCPFFQRGQPRDLQCHPSGGF 110

Query: 474 KRKDNLLQHMKLKHSNY 490
            R+D    H+K+KH  Y
Sbjct: 111 SRRDTYKTHLKVKHVLY 127

>ZYRO0D13992g Chr4 (1178918..1180681) [1764 bp, 587 aa] {ON} similar
           to uniprot|Q00947 Saccharomyces cerevisiae YDR463W STP1
           and uniprot|P38704 Saccharomyces cerevisiae YHR006W STP2
           Transcription factor
          Length = 587

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 30/65 (46%), Gaps = 12/65 (18%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSR------------HKRKDNLLQHMKL 485
           CH C+  FK R +L RH+  H+ ++ Y CP+ +                R+D    H++ 
Sbjct: 206 CHYCDAKFKIRGYLTRHIKKHAIQKAYHCPFFMGEAPPELRCHNSGGFSRRDTYKTHLRT 265

Query: 486 KHSNY 490
           +H  Y
Sbjct: 266 RHFIY 270

>CAGL0G08107g Chr7 (768772..770649) [1878 bp, 625 aa] {ON} weakly
           similar to uniprot|Q03833 Saccharomyces cerevisiae
           YDR096w GIS1 DNA damage-responsive repressor of PHR1
          Length = 625

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 46/88 (52%), Gaps = 2/88 (2%)

Query: 401 IVNNGTIPSEQDTSNNKLTITTLTNSDNSSPSNFIH-KCHLCEKSFKRRSWLKRHLLS-H 458
           +V   T  S+ ++S N  ++  + NS       F +  C +C+ +F     L RH  S H
Sbjct: 526 LVPEETFLSDDESSKNVESLGQIFNSKIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVH 585

Query: 459 SAERHYLCPWCLSRHKRKDNLLQHMKLK 486
           SAE+ Y CP C    KRKD++ QH+K K
Sbjct: 586 SAEKPYNCPICSKGFKRKDHVSQHLKKK 613

>Kpol_505.15 s505 (42259..43791) [1533 bp, 510 aa] {ON}
           (42259..43791) [1533 nt, 511 aa]
          Length = 510

 Score = 43.9 bits (102), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 34/77 (44%), Gaps = 14/77 (18%)

Query: 421 TTLTNSDNSSPSNFI--------------HKCHLCEKSFKRRSWLKRHLLSHSAERHYLC 466
           ++LTNS+NS     +              HKC  C+K F +   L  H   H+ ER Y C
Sbjct: 348 SSLTNSENSGFDLLVPKQELMEEVVDKRQHKCAYCDKRFSQTGNLNTHQRLHTGERPYEC 407

Query: 467 PWCLSRHKRKDNLLQHM 483
             C  R  RK NL  H+
Sbjct: 408 HICNKRFSRKGNLTAHV 424

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 36/68 (52%), Gaps = 2/68 (2%)

Query: 436 HKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLDEL 495
           ++CH+C K F R+  L  H+++H   + Y+C   +    +K   L +MK+  + +  + +
Sbjct: 405 YECHICNKRFSRKGNLTAHVITHKKLKPYICK--VDGCNKKFTQLGNMKVHQNKFHYETI 462

Query: 496 KNANVSFN 503
              + SFN
Sbjct: 463 LRLSDSFN 470

>NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON}
           Anc_3.298
          Length = 370

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLCPW--CLSRHKRKDNLLQHMKL 485
           C  C K FKR S L  H+  H+  + Y+CP+  C      K N+L+H KL
Sbjct: 260 CKHCNKRFKRPSSLNTHMNIHTGNKPYVCPYEECRKSFNAKSNMLRHYKL 309

>Skud_8.55 Chr8 (100188..101795) [1608 bp, 535 aa] {ON} YHR006W
           (REAL)
          Length = 535

 Score = 43.9 bits (102), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 46/105 (43%), Gaps = 12/105 (11%)

Query: 398 ITGIVNNGTIPSEQDTSNNKLTITTLTNSDNSSPSNFIHKCHLCEKSFKRRSWLKRHLLS 457
           IT I +  T  S++    + L+      + + S     + CH C+  F+ R +L RH+  
Sbjct: 167 ITPISSVITPASKKSVDESPLSDEVPQGTADESSETLPYVCHYCDARFRIRGYLTRHIKK 226

Query: 458 HSAERHYLCPWC-------LSRH-----KRKDNLLQHMKLKHSNY 490
           H+  + Y CP+        L  H      R+D    H+K +H NY
Sbjct: 227 HAKRKAYHCPFFDDSISQELRCHTSGGFSRRDTYKTHLKSRHFNY 271

>ZYRO0C13508g Chr3 complement(1068164..1068733) [570 bp, 189 aa]
           {ON} weakly similar to uniprot|P38082 Saccharomyces
           cerevisiae YBR066C
          Length = 189

 Score = 42.4 bits (98), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 33/63 (52%), Gaps = 4/63 (6%)

Query: 424 TNSDNSSPSNFIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPW--CLSRHKRKDNLLQ 481
           TNS N+S     H C +C K F     L RH   H+ E+++ CP+  C  +  R DN +Q
Sbjct: 100 TNSSNNSERR--HVCRICYKGFTTSGHLARHNRIHTGEKNHECPYEGCDQKFSRHDNCIQ 157

Query: 482 HMK 484
           H +
Sbjct: 158 HYR 160

>TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 436 HKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPW--CLSRHKRKDNLLQHMKL 485
           + C++C K FKR S L  H+  H+ ++ Y CP   C      K N+L+H KL
Sbjct: 270 YDCNICGKKFKRPSSLNTHMNIHTGQKPYRCPHISCSKAFNAKSNMLRHYKL 321

>TBLA0C04880 Chr3 complement(1187913..1188932) [1020 bp, 339 aa]
           {ON} Anc_3.518 YGL209W
          Length = 339

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 43/94 (45%), Gaps = 9/94 (9%)

Query: 438 CHLCEKSFKRRSWLKRHLLSHSAERHYLC--PWCLSRHKRKDNLLQHMKL-KHSNYLLDE 494
           C +C + F R    KRH+ +H+ E+ + C  P C+    R D L +H++     N   ++
Sbjct: 22  CEICHRGFHRLEHKKRHIRTHTGEKPHKCVFPGCIKSFSRSDELKRHLRTHTRPNSRNNK 81

Query: 495 LKNAN------VSFNWGTYDGQNSTDSMPKTLSG 522
            K AN      V        G NS + +P+ LS 
Sbjct: 82  SKKANSKNSNSVITTASNSSGDNSPNHLPQNLSS 115

>KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.162
           YOR113W
          Length = 796

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 31/68 (45%), Gaps = 3/68 (4%)

Query: 437 KCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNY--LLDE 494
           +C  C K F +   L+ H   H+ E+ Y C  C  R  RK NL  H +L H      L +
Sbjct: 501 ECQFCGKRFTQGGNLRTHQRLHTGEKPYACQHCSKRFSRKGNLAAH-QLTHREVKPFLCK 559

Query: 495 LKNANVSF 502
           L N   +F
Sbjct: 560 LDNCGKTF 567

 Score = 37.7 bits (86), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 36/85 (42%), Gaps = 10/85 (11%)

Query: 436 HKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPW--CLSRHKRKDNLLQHMKLKHSNYLLD 493
           + C  C K F R+  L  H L+H   + +LC    C     +  N+  H    HS  +L 
Sbjct: 528 YACQHCSKRFSRKGNLAAHQLTHREVKPFLCKLDNCGKTFAQLGNMKNHQNRFHSQTVL- 586

Query: 494 ELKNANVSFNWGTYDGQNSTDSMPK 518
           EL N    +N         TDS+PK
Sbjct: 587 ELSNKLAHWNP-------QTDSIPK 604

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.130    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,645,794
Number of extensions: 2356323
Number of successful extensions: 9630
Number of sequences better than 10.0: 655
Number of HSP's gapped: 9569
Number of HSP's successfully gapped: 794
Length of query: 554
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 439
Effective length of database: 40,294,809
Effective search space: 17689421151
Effective search space used: 17689421151
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)