Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0C058002.534ON1671677851e-108
NCAS0F008902.534ON1671676674e-90
YMR071C (TVP18)2.534ON1671676597e-89
Skud_13.2272.534ON1671676553e-88
Suva_13.2482.534ON1671676528e-88
SAKL0A09504g2.534ON1671676345e-85
CAGL0K03025g2.534ON1671676302e-84
NDAI0H013902.534ON1671676232e-83
TDEL0A030802.534ON1671676205e-83
KAFR0A018702.534ON1671676153e-82
Smik_13.2502.534ON1671676093e-81
KLTH0D06864g2.534ON1671676014e-80
TPHA0G035202.534ON2041685975e-79
TBLA0G022402.534ON1671675623e-74
AGL072W2.534ON1671675042e-65
Ecym_72542.534ON1671674722e-60
Kpol_348.92.534ON1301304458e-57
ZYRO0B02024g2.534ON1661574419e-56
KLLA0E18525g2.534ON1711654229e-53
Kwal_26.80252.534ON64642556e-29
CAGL0L12210g8.260ON298157672.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0C05800
         (167 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0C05800 Chr3 (1126605..1127108) [504 bp, 167 aa] {ON} Anc_2....   306   e-108
NCAS0F00890 Chr6 (179151..179654) [504 bp, 167 aa] {ON} Anc_2.53...   261   4e-90
YMR071C Chr13 complement(410762..411265) [504 bp, 167 aa] {ON}  ...   258   7e-89
Skud_13.227 Chr13 complement(385097..385600) [504 bp, 167 aa] {O...   256   3e-88
Suva_13.248 Chr13 complement(392000..392503) [504 bp, 167 aa] {O...   255   8e-88
SAKL0A09504g Chr1 complement(833526..833958,834035..834105) [504...   248   5e-85
CAGL0K03025g Chr11 complement(283076..283579) [504 bp, 167 aa] {...   247   2e-84
NDAI0H01390 Chr8 (338958..339461) [504 bp, 167 aa] {ON} Anc_2.53...   244   2e-83
TDEL0A03080 Chr1 complement(550148..550651) [504 bp, 167 aa] {ON...   243   5e-83
KAFR0A01870 Chr1 complement(389508..390011) [504 bp, 167 aa] {ON...   241   3e-82
Smik_13.250 Chr13 complement(394856..395359) [504 bp, 167 aa] {O...   239   3e-81
KLTH0D06864g Chr4 complement(599324..599756,599835..599905) [504...   236   4e-80
TPHA0G03520 Chr7 complement(751783..752397) [615 bp, 204 aa] {ON...   234   5e-79
TBLA0G02240 Chr7 complement(581646..582149) [504 bp, 167 aa] {ON...   221   3e-74
AGL072W Chr7 (574009..574512) [504 bp, 167 aa] {ON} Syntenic hom...   198   2e-65
Ecym_7254 Chr7 (536391..536894) [504 bp, 167 aa] {ON} similar to...   186   2e-60
Kpol_348.9 s348 complement(17797..18189) [393 bp, 130 aa] {ON} c...   176   8e-57
ZYRO0B02024g Chr2 complement(163601..164101) [501 bp, 166 aa] {O...   174   9e-56
KLLA0E18525g Chr5 (1647606..1648121) [516 bp, 171 aa] {ON} simil...   167   9e-53
Kwal_26.8025 s26 complement(615707..615901) [195 bp, 64 aa] {ON}...   102   6e-29
CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981 a...    30   2.7  

>KNAG0C05800 Chr3 (1126605..1127108) [504 bp, 167 aa] {ON} Anc_2.534
           YMR071C
          Length = 167

 Score =  306 bits (785), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 153/167 (91%), Positives = 153/167 (91%)

Query: 1   MALSIKQFFNTAGMLKDLRSFNFSVYGRWFGFINIILCVALGIANLFHVSGVIAFGIVSI 60
           MALSIKQFFNTAGMLKDLRSFNFSVYGRWFGFINIILCVALGIANLFHVSGVIAFGIVSI
Sbjct: 1   MALSIKQFFNTAGMLKDLRSFNFSVYGRWFGFINIILCVALGIANLFHVSGVIAFGIVSI 60

Query: 61  VQGXXXXXXXXXXXXXXCPLSDNFIEFISRFETNGYRAMFYLAMAVIQYCSVILMVTSLL 120
           VQG              CPLSDNFIEFISRFETNGYRAMFYLAMAVIQYCSVILMVTSLL
Sbjct: 61  VQGLIILFIEIPFLLKICPLSDNFIEFISRFETNGYRAMFYLAMAVIQYCSVILMVTSLL 120

Query: 121 VVAICLTVSAVFYAVAFVKHQEFQNTNIIKNPADADFPHEAVVREML 167
           VVAICLTVSAVFYAVAFVKHQEFQNTNIIKNPADADFPHEAVVREML
Sbjct: 121 VVAICLTVSAVFYAVAFVKHQEFQNTNIIKNPADADFPHEAVVREML 167

>NCAS0F00890 Chr6 (179151..179654) [504 bp, 167 aa] {ON} Anc_2.534
           YMR071C
          Length = 167

 Score =  261 bits (667), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 140/167 (83%)

Query: 1   MALSIKQFFNTAGMLKDLRSFNFSVYGRWFGFINIILCVALGIANLFHVSGVIAFGIVSI 60
           MAL IKQF N AGM KDL+SFNFSVYGRWFG+INIILC+ALG+ANLFHV+ VIAFGI+SI
Sbjct: 1   MALDIKQFINFAGMAKDLKSFNFSVYGRWFGYINIILCIALGVANLFHVNAVIAFGIISI 60

Query: 61  VQGXXXXXXXXXXXXXXCPLSDNFIEFISRFETNGYRAMFYLAMAVIQYCSVILMVTSLL 120
           +QG              CPLS+NFIEFI RFETNGYR +FYL MA+IQYCS+ILM TSL+
Sbjct: 61  IQGLVILFIEIPFLLKICPLSENFIEFIKRFETNGYRCLFYLGMAIIQYCSIILMATSLI 120

Query: 121 VVAICLTVSAVFYAVAFVKHQEFQNTNIIKNPADADFPHEAVVREML 167
           VVAI LT+S++ YAVAF  HQEFQNTNIIKNPADADFPHEAVVREM+
Sbjct: 121 VVAIGLTISSMSYAVAFANHQEFQNTNIIKNPADADFPHEAVVREMV 167

>YMR071C Chr13 complement(410762..411265) [504 bp, 167 aa] {ON}
           TVP18Integral membrane protein localized to late Golgi
           vesicles along with the v-SNARE Tlg2p; may interact with
           ribosomes, based on co-purification experiments
          Length = 167

 Score =  258 bits (659), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 139/167 (83%)

Query: 1   MALSIKQFFNTAGMLKDLRSFNFSVYGRWFGFINIILCVALGIANLFHVSGVIAFGIVSI 60
           MALS+ QF N  GM+KDL+SFNFSVYGRWFG+INIILC+ALGIANLFHVSGVIAFGI+SI
Sbjct: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVIAFGIISI 60

Query: 61  VQGXXXXXXXXXXXXXXCPLSDNFIEFISRFETNGYRAMFYLAMAVIQYCSVILMVTSLL 120
           +QG              CPLSDNFIEFI RFETNG+R +FYLAMA+IQY S+ +M TSL+
Sbjct: 61  IQGLVILFIEIPFLLKICPLSDNFIEFIKRFETNGWRCLFYLAMAIIQYISIAVMATSLI 120

Query: 121 VVAICLTVSAVFYAVAFVKHQEFQNTNIIKNPADADFPHEAVVREML 167
           VVA+ LT+S++ YAVA+ KHQEFQNTNIIKNP D DFPHEAVVREML
Sbjct: 121 VVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDFPHEAVVREML 167

>Skud_13.227 Chr13 complement(385097..385600) [504 bp, 167 aa] {ON}
           YMR071C (REAL)
          Length = 167

 Score =  256 bits (655), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 120/167 (71%), Positives = 139/167 (83%)

Query: 1   MALSIKQFFNTAGMLKDLRSFNFSVYGRWFGFINIILCVALGIANLFHVSGVIAFGIVSI 60
           MALS+ QF N  GM+KDL+SFNFSVYGRWFG+INIILC+ALGIANLFHVSGVIAFGI+SI
Sbjct: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVIAFGIISI 60

Query: 61  VQGXXXXXXXXXXXXXXCPLSDNFIEFISRFETNGYRAMFYLAMAVIQYCSVILMVTSLL 120
           +QG              CPLSDNF+EFI +FETNG+R +FYLAMAVIQY S+ +M TSL+
Sbjct: 61  IQGLVILFIEIPFLLKICPLSDNFVEFIKKFETNGWRCIFYLAMAVIQYVSIAVMATSLI 120

Query: 121 VVAICLTVSAVFYAVAFVKHQEFQNTNIIKNPADADFPHEAVVREML 167
           VVA+ LT+S++ YAVA+ KHQEFQNTNIIKNP D DFPHEAVVREML
Sbjct: 121 VVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDFPHEAVVREML 167

>Suva_13.248 Chr13 complement(392000..392503) [504 bp, 167 aa] {ON}
           YMR071C (REAL)
          Length = 167

 Score =  255 bits (652), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 138/167 (82%)

Query: 1   MALSIKQFFNTAGMLKDLRSFNFSVYGRWFGFINIILCVALGIANLFHVSGVIAFGIVSI 60
           MALS+ QF N  GM+KDL+SFNFSVYGRWFG+INIILC+ALGIANLFHVSGVIAFGI+SI
Sbjct: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVIAFGIISI 60

Query: 61  VQGXXXXXXXXXXXXXXCPLSDNFIEFISRFETNGYRAMFYLAMAVIQYCSVILMVTSLL 120
           +QG              CPLSDNF+EFI RFETNG+R +FYLAMA IQY S+ +M TSL+
Sbjct: 61  IQGLVILFIEIPFLLKICPLSDNFVEFIKRFETNGWRCIFYLAMATIQYISIAVMATSLI 120

Query: 121 VVAICLTVSAVFYAVAFVKHQEFQNTNIIKNPADADFPHEAVVREML 167
           VVA+ LT+S++ YAVA+ KHQEFQNTNI+KNP D DFPHEAVVREML
Sbjct: 121 VVAVGLTISSISYAVAYTKHQEFQNTNILKNPTDDDFPHEAVVREML 167

>SAKL0A09504g Chr1 complement(833526..833958,834035..834105) [504
           bp, 167 aa] {ON} highly similar to uniprot|Q04767
           Saccharomyces cerevisiae YMR071C TVP18 Tlg2-Vesicle
           Protein of 18 kDa Integral membrane vesicle protein
          Length = 167

 Score =  248 bits (634), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 136/167 (81%)

Query: 1   MALSIKQFFNTAGMLKDLRSFNFSVYGRWFGFINIILCVALGIANLFHVSGVIAFGIVSI 60
           MAL IKQF N AG++KDL+SFNFSVYG+WFG+INIILC+ALGIANLFHV+ V+AFG++SI
Sbjct: 1   MALGIKQFINIAGIVKDLKSFNFSVYGQWFGYINIILCLALGIANLFHVNAVVAFGVLSI 60

Query: 61  VQGXXXXXXXXXXXXXXCPLSDNFIEFISRFETNGYRAMFYLAMAVIQYCSVILMVTSLL 120
           +Q               CPLSDNFIEFI RFETNG R +FY AMA+IQ+CS+ LM TSL+
Sbjct: 61  IQSLVILFIEVPFLLKICPLSDNFIEFIKRFETNGKRTLFYTAMAIIQWCSLALMTTSLI 120

Query: 121 VVAICLTVSAVFYAVAFVKHQEFQNTNIIKNPADADFPHEAVVREML 167
           VVAI LT+SA  YAVA+ KHQ+FQNTNIIKNP D DFPHEAVVREML
Sbjct: 121 VVAIGLTISAASYAVAWSKHQQFQNTNIIKNPTDEDFPHEAVVREML 167

>CAGL0K03025g Chr11 complement(283076..283579) [504 bp, 167 aa] {ON}
           highly similar to uniprot|Q04767 Saccharomyces
           cerevisiae YMR071c
          Length = 167

 Score =  247 bits (630), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 131/167 (78%)

Query: 1   MALSIKQFFNTAGMLKDLRSFNFSVYGRWFGFINIILCVALGIANLFHVSGVIAFGIVSI 60
           MAL I QF N AG+LKDL+SFNFSVYG+WFG+INI LC+ALGIANLFHVS VIAFGIV I
Sbjct: 1   MALGITQFINIAGLLKDLKSFNFSVYGKWFGYINIFLCIALGIANLFHVSAVIAFGIVGI 60

Query: 61  VQGXXXXXXXXXXXXXXCPLSDNFIEFISRFETNGYRAMFYLAMAVIQYCSVILMVTSLL 120
           VQG              CPLSD FIEFI RFETNGYR +FY  MA++QYCS+ +M TSLL
Sbjct: 61  VQGLIILFIEIPFLLKICPLSDRFIEFIKRFETNGYRCIFYTLMAIVQYCSLAVMTTSLL 120

Query: 121 VVAICLTVSAVFYAVAFVKHQEFQNTNIIKNPADADFPHEAVVREML 167
           V+ I LT+SAV Y +AF KHQEF NTNIIKNP D DFPH+AVVREML
Sbjct: 121 VLGITLTISAVSYGIAFTKHQEFANTNIIKNPTDEDFPHDAVVREML 167

>NDAI0H01390 Chr8 (338958..339461) [504 bp, 167 aa] {ON} Anc_2.534
           YMR071C
          Length = 167

 Score =  244 bits (623), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 133/167 (79%)

Query: 1   MALSIKQFFNTAGMLKDLRSFNFSVYGRWFGFINIILCVALGIANLFHVSGVIAFGIVSI 60
           MAL I QF N AG++KDL+SFNFSVYGRWFG+INIILC+ LGI+NLFHV+ VIAFGIVSI
Sbjct: 1   MALGITQFINIAGIVKDLKSFNFSVYGRWFGYINIILCIGLGISNLFHVNAVIAFGIVSI 60

Query: 61  VQGXXXXXXXXXXXXXXCPLSDNFIEFISRFETNGYRAMFYLAMAVIQYCSVILMVTSLL 120
           +QG              CPLS+ FIEFI RFETNGYR +FYL MA+IQYCS+ LM TSL+
Sbjct: 61  IQGLVILFIEIPFLLKICPLSERFIEFIKRFETNGYRCVFYLVMAIIQYCSIALMATSLI 120

Query: 121 VVAICLTVSAVFYAVAFVKHQEFQNTNIIKNPADADFPHEAVVREML 167
           VVA+ LT+S++ YA+AF  HQEFQNT I+KNP D DFP EAVVREML
Sbjct: 121 VVAVGLTISSISYAIAFTNHQEFQNTQILKNPTDPDFPREAVVREML 167

>TDEL0A03080 Chr1 complement(550148..550651) [504 bp, 167 aa] {ON}
           Anc_2.534 YMR071C
          Length = 167

 Score =  243 bits (620), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 134/167 (80%)

Query: 1   MALSIKQFFNTAGMLKDLRSFNFSVYGRWFGFINIILCVALGIANLFHVSGVIAFGIVSI 60
           MAL ++QF N AG++KDL+SFNFS+YGRWFG+INI LC+ALGIANLFHVS VIAFGIV+I
Sbjct: 1   MALGVRQFINVAGIVKDLKSFNFSLYGRWFGYINIFLCIALGIANLFHVSAVIAFGIVAI 60

Query: 61  VQGXXXXXXXXXXXXXXCPLSDNFIEFISRFETNGYRAMFYLAMAVIQYCSVILMVTSLL 120
           VQG              CPLSDNFIEFI RFETNGYR +FY+ MAVIQ+CS+ +  TSL+
Sbjct: 61  VQGLIILFVEIPFLLKICPLSDNFIEFIKRFETNGYRTLFYVVMAVIQWCSIAVQATSLI 120

Query: 121 VVAICLTVSAVFYAVAFVKHQEFQNTNIIKNPADADFPHEAVVREML 167
           VVA+ LT+SA  YAVA  KHQEFQNT+I+K+P   DFPHEAVVREML
Sbjct: 121 VVAVGLTISACSYAVALTKHQEFQNTHILKDPTSDDFPHEAVVREML 167

>KAFR0A01870 Chr1 complement(389508..390011) [504 bp, 167 aa] {ON}
           Anc_2.534 YMR071C
          Length = 167

 Score =  241 bits (615), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 137/167 (82%)

Query: 1   MALSIKQFFNTAGMLKDLRSFNFSVYGRWFGFINIILCVALGIANLFHVSGVIAFGIVSI 60
           MALSIKQF N AG++KDL+SFNFSVYGRWFG+INIILC+ALGI+NLFHV+ VIAFGI+SI
Sbjct: 1   MALSIKQFINVAGIVKDLKSFNFSVYGRWFGYINIILCIALGISNLFHVNAVIAFGIISI 60

Query: 61  VQGXXXXXXXXXXXXXXCPLSDNFIEFISRFETNGYRAMFYLAMAVIQYCSVILMVTSLL 120
           +QG              CPLSDNF+EFI RFETNGYR +FYL MA+IQYCS+ILM TSL+
Sbjct: 61  IQGLIILFIEIPFLLKICPLSDNFVEFIKRFETNGYRCVFYLVMAIIQYCSIILMATSLI 120

Query: 121 VVAICLTVSAVFYAVAFVKHQEFQNTNIIKNPADADFPHEAVVREML 167
           VVAICLTVS   Y +A  K QEFQNTNIIKNP D DFPHEAVVREML
Sbjct: 121 VVAICLTVSCASYGIAAFKKQEFQNTNIIKNPTDTDFPHEAVVREML 167

>Smik_13.250 Chr13 complement(394856..395359) [504 bp, 167 aa] {ON}
           YMR071C (REAL)
          Length = 167

 Score =  239 bits (609), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 120/167 (71%), Positives = 139/167 (83%)

Query: 1   MALSIKQFFNTAGMLKDLRSFNFSVYGRWFGFINIILCVALGIANLFHVSGVIAFGIVSI 60
           MALS+ QF N  GM+KDL+SFNFSVYGRWFG+INIILC+ALGIANLFHVSGVIAFGI+SI
Sbjct: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVIAFGIISI 60

Query: 61  VQGXXXXXXXXXXXXXXCPLSDNFIEFISRFETNGYRAMFYLAMAVIQYCSVILMVTSLL 120
           +QG              CPLSDNFIEFI +FETNG+R +FYLAMA+IQY S+ +M TSL+
Sbjct: 61  IQGLIILFIEIPFLLKICPLSDNFIEFIKKFETNGWRCIFYLAMAIIQYISIAVMATSLI 120

Query: 121 VVAICLTVSAVFYAVAFVKHQEFQNTNIIKNPADADFPHEAVVREML 167
           VVA+ LT+S++ YAVA+ KHQEFQNTNIIKNP D DFPHEAVVREML
Sbjct: 121 VVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDFPHEAVVREML 167

>KLTH0D06864g Chr4 complement(599324..599756,599835..599905) [504
           bp, 167 aa] {ON} highly similar to uniprot|Q04767
           Saccharomyces cerevisiae YMR071C TVP18 Tlg2-Vesicle
           Protein of 18 kDa Integral membrane vesicle protein
          Length = 167

 Score =  236 bits (601), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 132/167 (79%)

Query: 1   MALSIKQFFNTAGMLKDLRSFNFSVYGRWFGFINIILCVALGIANLFHVSGVIAFGIVSI 60
           MAL+IKQF N AG+++DL+SFNFSVYG+WFG+INI LCVALGIANLFHVS VI FGI++I
Sbjct: 1   MALNIKQFINVAGLVRDLKSFNFSVYGQWFGYINIFLCVALGIANLFHVSAVIVFGIIAI 60

Query: 61  VQGXXXXXXXXXXXXXXCPLSDNFIEFISRFETNGYRAMFYLAMAVIQYCSVILMVTSLL 120
           VQG              CPLSDNFI FI RFETNG R +FY+ MA +Q+CS+ +M TSL+
Sbjct: 61  VQGLVILFVEVPFLLRICPLSDNFIAFIKRFETNGKRTLFYVGMAAVQWCSLAVMATSLI 120

Query: 121 VVAICLTVSAVFYAVAFVKHQEFQNTNIIKNPADADFPHEAVVREML 167
            VAI LT+SA  Y VAF KHQ+FQ T++IK+PAD DFPHEAVVREML
Sbjct: 121 AVAIGLTISAASYGVAFFKHQQFQGTSVIKSPADDDFPHEAVVREML 167

>TPHA0G03520 Chr7 complement(751783..752397) [615 bp, 204 aa] {ON}
           Anc_2.534 YMR071C
          Length = 204

 Score =  234 bits (597), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 114/168 (67%), Positives = 136/168 (80%), Gaps = 1/168 (0%)

Query: 1   MALSIKQFFNTAGMLKDLRSFNFSVYGRWFGFINIILCVALGIANLFHVSGVIAFGIVSI 60
           MALSIKQF N AGMLKDL+SFNFSVYG++FG+INIILC+ALGIANLFHV+ VIAFGIV+I
Sbjct: 37  MALSIKQFINGAGMLKDLKSFNFSVYGQYFGYINIILCMALGIANLFHVNAVIAFGIVAI 96

Query: 61  VQGXXXXXXXXXXXXXXCPLSDNFIEFISRFETNGYRAMFYLAMAVIQYCSVILMVTSLL 120
           VQ               CPLSDNF+ F+  FETNG+R +F+  MA++Q+CS+IL VTSL+
Sbjct: 97  VQSLVILFIEIPFLLKICPLSDNFVNFVKYFETNGWRCLFFTGMAIVQWCSLILKVTSLI 156

Query: 121 VVAICLTVSAVFYAVAFVKHQEFQNT-NIIKNPADADFPHEAVVREML 167
           VVAI L++SA FYA+AF K QEFQ+T N+IKNP D DFPHEAVVREML
Sbjct: 157 VVAIGLSISAAFYAIAFFKKQEFQHTSNVIKNPTDDDFPHEAVVREML 204

>TBLA0G02240 Chr7 complement(581646..582149) [504 bp, 167 aa] {ON}
           Anc_2.534 YMR071C
          Length = 167

 Score =  221 bits (562), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 132/167 (79%)

Query: 1   MALSIKQFFNTAGMLKDLRSFNFSVYGRWFGFINIILCVALGIANLFHVSGVIAFGIVSI 60
           M +++++F N  G+++ L+SFNFS+YG+WFG+INI+LCVALGIANLFHV+ VIAFGIVSI
Sbjct: 1   MGVALQEFLNINGIVRGLKSFNFSLYGQWFGYINILLCVALGIANLFHVNPVIAFGIVSI 60

Query: 61  VQGXXXXXXXXXXXXXXCPLSDNFIEFISRFETNGYRAMFYLAMAVIQYCSVILMVTSLL 120
           +Q               CPLSDNFI FI  F+TNG+R +FY+AMA +Q+CS+IL  TSL+
Sbjct: 61  IQSFIILFVEVPFLLKICPLSDNFIAFIKHFQTNGFRCIFYIAMATVQWCSIILKATSLI 120

Query: 121 VVAICLTVSAVFYAVAFVKHQEFQNTNIIKNPADADFPHEAVVREML 167
           VVAI LT+SA+ YAVA+ K+QEFQN +IIKNP D DFP EAVVREML
Sbjct: 121 VVAIGLTISAISYAVAYFKNQEFQNVSIIKNPTDDDFPREAVVREML 167

>AGL072W Chr7 (574009..574512) [504 bp, 167 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR071C (TVP18)
          Length = 167

 Score =  198 bits (504), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 118/167 (70%)

Query: 1   MALSIKQFFNTAGMLKDLRSFNFSVYGRWFGFINIILCVALGIANLFHVSGVIAFGIVSI 60
           MALS K F N  G+L DLRSFNFSVYGRWFG+INI+LC+ALGIAN+FH S VIAF IV+I
Sbjct: 1   MALSWKSFVNVPGILADLRSFNFSVYGRWFGYINILLCLALGIANIFHFSIVIAFAIVAI 60

Query: 61  VQGXXXXXXXXXXXXXXCPLSDNFIEFISRFETNGYRAMFYLAMAVIQYCSVILMVTSLL 120
           VQG              CPLSDNFI  + + +TNG R + Y A+A++QY S+ + VTSLL
Sbjct: 61  VQGLLLIFVEVPILLKICPLSDNFIGLVKKCDTNGRRTLLYTALAIVQYASLSVQVTSLL 120

Query: 121 VVAICLTVSAVFYAVAFVKHQEFQNTNIIKNPADADFPHEAVVREML 167
            VAI LT+SA+FY   ++K QEF   N+I+NP D  F  EA VRE+L
Sbjct: 121 AVAIGLTISAIFYGTGYLKKQEFLEGNVIRNPTDPAFMREAAVREVL 167

>Ecym_7254 Chr7 (536391..536894) [504 bp, 167 aa] {ON} similar to
           Ashbya gossypii AGL072W
          Length = 167

 Score =  186 bits (472), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 88/167 (52%), Positives = 116/167 (69%)

Query: 1   MALSIKQFFNTAGMLKDLRSFNFSVYGRWFGFINIILCVALGIANLFHVSGVIAFGIVSI 60
           MA+S+K F N  G++ DL+SFNFSVYGRWFG+INIILC+ALGIAN+FH   VI F I+++
Sbjct: 1   MAVSLKSFINVPGIVSDLKSFNFSVYGRWFGYINIILCIALGIANIFHFGPVIIFSILAL 60

Query: 61  VQGXXXXXXXXXXXXXXCPLSDNFIEFISRFETNGYRAMFYLAMAVIQYCSVILMVTSLL 120
            QG              CPLS+ F+  +  F +N  R M Y  MAVIQ+ S++  VTSL+
Sbjct: 61  GQGFFLLFVEVPFLVKICPLSERFVSNVKIFNSNMKRTMLYGVMAVIQWVSLVFEVTSLV 120

Query: 121 VVAICLTVSAVFYAVAFVKHQEFQNTNIIKNPADADFPHEAVVREML 167
           V+AICLTVSA+FYA  ++  QEF+ +N+++ P    FPHEA VREML
Sbjct: 121 VLAICLTVSAIFYASGWLTKQEFKESNVLRGPGSDTFPHEASVREML 167

>Kpol_348.9 s348 complement(17797..18189) [393 bp, 130 aa] {ON}
           complement(17797..18189) [393 nt, 131 aa]
          Length = 130

 Score =  176 bits (445), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 103/130 (79%), Gaps = 1/130 (0%)

Query: 39  VALGIANLFHVSGVIAFGIVSIVQGXXXXXXXXXXXXXXCPLSDNFIEFISRFETNGYRA 98
           +ALGIANLFHV+ VIAFGIV+IVQ               CPLS+NFI FI  FETNGYR 
Sbjct: 1   MALGIANLFHVNAVIAFGIVAIVQSLIILFVEVPFLLKICPLSENFINFIKNFETNGYRC 60

Query: 99  MFYLAMAVIQYCSVILMVTSLLVVAICLTVSAVFYAVAFVKHQEFQN-TNIIKNPADADF 157
           +FY  MA++Q+CS+ LMVTSL+VVAICLT+SA+FYA+A+ K+QEFQ+ TN+IKNP D DF
Sbjct: 61  IFYTLMAIVQWCSLALMVTSLIVVAICLTISAIFYAIAYFKNQEFQHTTNVIKNPTDDDF 120

Query: 158 PHEAVVREML 167
           PH+AVVREML
Sbjct: 121 PHDAVVREML 130

>ZYRO0B02024g Chr2 complement(163601..164101) [501 bp, 166 aa] {ON}
           similar to uniprot|Q04767 Saccharomyces cerevisiae
           YMR071C TVP18 Tlg2-Vesicle Protein of 18 kDa Integral
           membrane vesicle protein
          Length = 166

 Score =  174 bits (441), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 84/157 (53%), Positives = 114/157 (72%), Gaps = 1/157 (0%)

Query: 12  AGMLKDLRSFNFSVYGRWFGFINIILCVALGIANLFHVSGVIAFGIVSIVQGXXXXXXXX 71
             +++ L+S+NFS+YG++  ++NII C+A GIANLFHV+ VIAFG++SIVQG        
Sbjct: 10  GSLVQGLKSYNFSLYGKYVAYLNIIFCIAFGIANLFHVNAVIAFGVISIVQGAIILFLEV 69

Query: 72  XXXXXXCPLSDNFIEFISRFETNGYRAMFYLAMAVIQYCSVILMVTSLLVVAICLTVSAV 131
                 CPLSDNFIEF+SRFETNG+R +FY+  AV+Q+ S+ L +TSL+VVA+ LT+SA 
Sbjct: 70  PFLLRICPLSDNFIEFVSRFETNGWRTIFYIFNAVLQWASLALKITSLIVVAVGLTISAA 129

Query: 132 FYAVAFVKHQEFQNTNIIKNP-ADADFPHEAVVREML 167
           FY VA+ KHQ FQN++ IK P  +    +E  VREML
Sbjct: 130 FYGVAYFKHQNFQNSSHIKEPVGEGVEANEQNVREML 166

>KLLA0E18525g Chr5 (1647606..1648121) [516 bp, 171 aa] {ON} similar
           to uniprot|Q04767 Saccharomyces cerevisiae YMR071C TVP18
           Tlg2-Vesicle Protein of 18 kDa Integral membrane vesicle
           protein
          Length = 171

 Score =  167 bits (422), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 112/165 (67%), Gaps = 2/165 (1%)

Query: 5   IKQFFNTAGMLKDLRSFNFSVYGRWFGFINIILCVALGIANLFHVSGVIAFGIVSIVQGX 64
           +K  FN +GM+ DL+S NFS+YG+W  ++NII C+A GIAN+FH S VI F I++IVQG 
Sbjct: 7   LKSMFNVSGMVADLKSSNFSIYGQWISYLNIIFCLAFGIANIFHFSAVIVFSIIAIVQGL 66

Query: 65  XXXXXXXXXXXXXCPLSDNFIEFISRFETNGYRAMFYLAMAVIQYCSVILMVTSLLVVAI 124
                        CPLSDNFI F+S+F+TN  RA+FYL M  IQ+CS+I+  TSL+VVA+
Sbjct: 67  IILFIEVPFLLKICPLSDNFIGFVSKFDTNLRRALFYLVMCAIQWCSIIVQSTSLIVVAV 126

Query: 125 CLTVSAVFYAVAFVKHQEFQNTNIIKNPAD--ADFPHEAVVREML 167
            L+++A  YA+     QEF+N+ I+ +     A   +EAVVR+ML
Sbjct: 127 GLSITATVYALGAAAGQEFKNSAILSDRGRVAASVTNEAVVRDML 171

>Kwal_26.8025 s26 complement(615707..615901) [195 bp, 64 aa] {ON}
           YMR071C - Hypothetical ORF [contig 55] FULL
          Length = 64

 Score =  102 bits (255), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 46/64 (71%), Positives = 56/64 (87%)

Query: 104 MAVIQYCSVILMVTSLLVVAICLTVSAVFYAVAFVKHQEFQNTNIIKNPADADFPHEAVV 163
           MA +Q+CS+ LMVTSL+VVA+ LT+SA  Y+VAF KHQ+FQ T++IKNPAD DFPHEAVV
Sbjct: 1   MAAVQWCSIALMVTSLIVVAVGLTISAASYSVAFFKHQQFQGTSVIKNPADEDFPHEAVV 60

Query: 164 REML 167
           REML
Sbjct: 61  REML 64

>CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981
          aa] {ON} similar to uniprot|Q12150 Saccharomyces
          cerevisiae YLR087c
          Length = 2981

 Score = 30.4 bits (67), Expect = 2.7,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 6/57 (10%)

Query: 8  FFNTAGMLKDLRSF--NFSVYGRWFGFINIILCVALGIANLFHVSGVIAFGIVSIVQ 62
          F ++AG   +   F  NFS    W   ++ IL V L +A LF++S   A+G+  I++
Sbjct: 4  FQSSAGFRGESLGFKRNFS----WVFLVDWILTVILTLATLFYLSRAFAYGVTFILE 56

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.333    0.143    0.430 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 14,194,629
Number of extensions: 438965
Number of successful extensions: 1925
Number of sequences better than 10.0: 26
Number of HSP's gapped: 1942
Number of HSP's successfully gapped: 26
Length of query: 167
Length of database: 53,481,399
Length adjustment: 101
Effective length of query: 66
Effective length of database: 41,900,133
Effective search space: 2765408778
Effective search space used: 2765408778
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.6 bits)
S2: 61 (28.1 bits)