Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0C049405.430ON64263020110.0
KAFR0E039105.430ON62563113501e-179
Smik_4.6325.430ON62759513061e-173
YDR365C (ESF1)5.430ON62859513061e-173
Kpol_1016.85.430ON63759712881e-170
CAGL0L11638g5.430ON60862912841e-170
SAKL0G02442g5.430ON62359312491e-164
TBLA0A065405.430ON65950312091e-158
Skud_4.6355.430ON62959712011e-157
TDEL0E019505.430ON61763011491e-149
NCAS0F033505.430ON63943410931e-140
Suva_2.5385.430ON62943210921e-140
NDAI0B056405.430ON66945210791e-138
ZYRO0F09944g5.430ON61143510511e-134
KLLA0E21165g5.430ON62743810401e-133
TPHA0H017805.430ON62243310231e-130
Kwal_55.214445.430ON64444710061e-127
AER259W5.430ON61943110031e-127
KLTH0F16148g5.430ON6464449941e-125
Ecym_47905.430ON6304339731e-123
YGR145W (ENP2)4.77ON70733771.0
Smik_6.2484.77ON70733771.1
NDAI0D037804.77ON70726771.2
CAGL0E03069g4.77ON75426771.2
TDEL0F027204.77ON69426761.5
Suva_7.4354.77ON70833761.7
Kpol_1041.354.77ON70126761.7
KLTH0H09130g4.77ON69526752.2
Skud_7.4674.77ON70833733.1
KAFR0F036304.77ON69326733.2
NCAS0A018504.77ON70126724.0
KNAG0D037404.77ON69626724.6
TBLA0A088904.77ON69826725.0
Ecym_14124.77ON71926707.5
Ecym_56072.370ON304103698.0
Kwal_14.22584.77ON69926708.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0C04940
         (642 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0C04940 Chr3 (953539..955467) [1929 bp, 642 aa] {ON} Anc_5.4...   779   0.0  
KAFR0E03910 Chr5 complement(773170..775047) [1878 bp, 625 aa] {O...   524   e-179
Smik_4.632 Chr4 complement(1130422..1132305) [1884 bp, 627 aa] {...   507   e-173
YDR365C Chr4 complement(1204497..1206383) [1887 bp, 628 aa] {ON}...   507   e-173
Kpol_1016.8 s1016 (16620..18533) [1914 bp, 637 aa] {ON} (16620.....   500   e-170
CAGL0L11638g Chr12 (1243194..1245020) [1827 bp, 608 aa] {ON} sim...   499   e-170
SAKL0G02442g Chr7 complement(201924..203795) [1872 bp, 623 aa] {...   485   e-164
TBLA0A06540 Chr1 (1602559..1604538) [1980 bp, 659 aa] {ON} Anc_5...   470   e-158
Skud_4.635 Chr4 complement(1133271..1135160) [1890 bp, 629 aa] {...   467   e-157
TDEL0E01950 Chr5 (367743..369596) [1854 bp, 617 aa] {ON} Anc_5.4...   447   e-149
NCAS0F03350 Chr6 complement(677168..679087) [1920 bp, 639 aa] {O...   425   e-140
Suva_2.538 Chr2 complement(960917..962806) [1890 bp, 629 aa] {ON...   425   e-140
NDAI0B05640 Chr2 complement(1377917..1379926) [2010 bp, 669 aa] ...   420   e-138
ZYRO0F09944g Chr6 complement(807207..809042) [1836 bp, 611 aa] {...   409   e-134
KLLA0E21165g Chr5 (1890314..1892197) [1884 bp, 627 aa] {ON} simi...   405   e-133
TPHA0H01780 Chr8 complement(409713..411581) [1869 bp, 622 aa] {O...   398   e-130
Kwal_55.21444 s55 (839767..841701) [1935 bp, 644 aa] {ON} YDR365...   392   e-127
AER259W Chr5 (1113896..1115755) [1860 bp, 619 aa] {ON} Syntenic ...   390   e-127
KLTH0F16148g Chr6 (1310041..1311981) [1941 bp, 646 aa] {ON} simi...   387   e-125
Ecym_4790 Chr4 complement(1534067..1535959) [1893 bp, 630 aa] {O...   379   e-123
YGR145W Chr7 (781767..783890) [2124 bp, 707 aa] {ON}  ENP2Essent...    34   1.0  
Smik_6.248 Chr6 (401099..403222) [2124 bp, 707 aa] {ON} YGR145W ...    34   1.1  
NDAI0D03780 Chr4 complement(895256..897379) [2124 bp, 707 aa] {O...    34   1.2  
CAGL0E03069g Chr5 complement(286341..288485,288759..288878) [226...    34   1.2  
TDEL0F02720 Chr6 complement(498279..500363) [2085 bp, 694 aa] {O...    34   1.5  
Suva_7.435 Chr7 (752189..754315) [2127 bp, 708 aa] {ON} YGR145W ...    34   1.7  
Kpol_1041.35 s1041 complement(87507..89612) [2106 bp, 701 aa] {O...    34   1.7  
KLTH0H09130g Chr8 (783260..785347) [2088 bp, 695 aa] {ON} simila...    33   2.2  
Skud_7.467 Chr7 (764555..766681) [2127 bp, 708 aa] {ON} YGR145W ...    33   3.1  
KAFR0F03630 Chr6 complement(718854..720935) [2082 bp, 693 aa] {O...    33   3.2  
NCAS0A01850 Chr1 complement(356138..358243) [2106 bp, 701 aa] {O...    32   4.0  
KNAG0D03740 Chr4 complement(680549..682639) [2091 bp, 696 aa] {O...    32   4.6  
TBLA0A08890 Chr1 (2183143..2185239) [2097 bp, 698 aa] {ON} Anc_4...    32   5.0  
Ecym_1412 Chr1 (856549..858708) [2160 bp, 719 aa] {ON} similar t...    32   7.5  
Ecym_5607 Chr5 (1229698..1230612) [915 bp, 304 aa] {ON} similar ...    31   8.0  
Kwal_14.2258 s14 (679677..681776) [2100 bp, 699 aa] {ON} YGR145W...    32   8.8  

>KNAG0C04940 Chr3 (953539..955467) [1929 bp, 642 aa] {ON} Anc_5.430
           YDR365C
          Length = 642

 Score =  779 bits (2011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/630 (65%), Positives = 414/630 (65%)

Query: 1   MSDKMSSDPRFSGVYNDPKFRSTKEKKLKVKLDSRFSXXXXXXXXXXXXXXYGRKIKNGD 60
           MSDKMSSDPRFSGVYNDPKFRSTKEKKLKVKLDSRFS              YGRKIKNGD
Sbjct: 1   MSDKMSSDPRFSGVYNDPKFRSTKEKKLKVKLDSRFSKKDLEVKKKAKVDKYGRKIKNGD 60

Query: 61  ANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRARGEVPDDYVXXXXXXXXXXXX 120
           AN                                   RARGEVPDDYV            
Sbjct: 61  ANKKELEDFDKYFEKEDEAKESEDAEAPEAPVKVVVDRARGEVPDDYVSSADEFTSSDSE 120

Query: 121 XXXXXXXXXXXXXXXXXXXXXANSGKPESGDPSKTLAVVNLDWDHVKSVDLMITFTGFIP 180
                                ANSGKPESGDPSKTLAVVNLDWDHVKSVDLMITFTGFIP
Sbjct: 121 SSGSSESESESEQSDVEDEIEANSGKPESGDPSKTLAVVNLDWDHVKSVDLMITFTGFIP 180

Query: 181 KGGKIERICIYPSEFGKERLNREEKEGPPKELFHXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           KGGKIERICIYPSEFGKERLNREEKEGPPKELFH                          
Sbjct: 181 KGGKIERICIYPSEFGKERLNREEKEGPPKELFHKKKSKKNSAAKSKGAESGKSDDDVSD 240

Query: 241 XXXXXLYEEGDAEKDIDSKALRQYQLERLRYFYAVVYCNNVETAKAIYDNCDATEYESTA 300
                LYEEGDAEKDIDSKALRQYQLERLRYFYAVVYCNNVETAKAIYDNCDATEYESTA
Sbjct: 241 VDIKDLYEEGDAEKDIDSKALRQYQLERLRYFYAVVYCNNVETAKAIYDNCDATEYESTA 300

Query: 301 NMFDLRYVPEGMTFDDDPRDECEALPKNYKPLNFATDALQHSNVKLTWDETPADRVEIAK 360
           NMFDLRYVPEGMTFDDDPRDECEALPKNYKPLNFATDALQHSNVKLTWDETPADRVEIAK
Sbjct: 301 NMFDLRYVPEGMTFDDDPRDECEALPKNYKPLNFATDALQHSNVKLTWDETPADRVEIAK 360

Query: 361 RAFSQKEIDDMDFKAYLASDSEDSDAKVDETMKNRLKALVGGTLKASRPKGGAXXXXXXX 420
           RAFSQKEIDDMDFKAYLASDSEDSDAKVDETMKNRLKALVGGTLKASRPKGGA       
Sbjct: 361 RAFSQKEIDDMDFKAYLASDSEDSDAKVDETMKNRLKALVGGTLKASRPKGGAEEDEDDE 420

Query: 421 XXXXXXITFTPGLDXXXXXXXXXXXXXXSTIDXXXXXXXXXXXXXXXXXXXXXXXXXXXX 480
                 ITFTPGLD              STID                            
Sbjct: 421 EGMDMEITFTPGLDEAQVAEQEAAAEEESTIDKIRRKEKERRKNRKQKLKELKKNAEKEK 480

Query: 481 XXXXXXXXXXXXNGEEEPVDDKAKAXXXXXXXXXXXXRDSKSTLNKKMHFNMNEIMRXXX 540
                       NGEEEPVDDKAKA            RDSKSTLNKKMHFNMNEIMR   
Sbjct: 481 RDKLKSLKKGRKNGEEEPVDDKAKAELELLMMDEDEERDSKSTLNKKMHFNMNEIMRSEK 540

Query: 541 XXXXXXXFQDKNRIVEDEFKPDLSDDRFKEVFEDHDFAIDPSRPEFKETPAMQKILQEXX 600
                  FQDKNRIVEDEFKPDLSDDRFKEVFEDHDFAIDPSRPEFKETPAMQKILQE  
Sbjct: 541 EKKKKSKFQDKNRIVEDEFKPDLSDDRFKEVFEDHDFAIDPSRPEFKETPAMQKILQERS 600

Query: 601 XXXXXXXXXXXXAEQSTDTSDKTDISQIVS 630
                       AEQSTDTSDKTDISQIVS
Sbjct: 601 NRARSKGKKRKSAEQSTDTSDKTDISQIVS 630

>KAFR0E03910 Chr5 complement(773170..775047) [1878 bp, 625 aa] {ON}
           Anc_5.430 YDR365C
          Length = 625

 Score =  524 bits (1350), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 301/631 (47%), Positives = 349/631 (55%), Gaps = 29/631 (4%)

Query: 4   KMSSDPRFSGVYNDPKFRSTKEKKLKVKLDSRFSXXXXXXXXXXXXXXYGRKIKNGDANX 63
           K S DPRFS +YNDPKF++ K K LK++LDSRFS              YGRK K+  +  
Sbjct: 6   KKSDDPRFSRIYNDPKFKNAKTKHLKIRLDSRFSKRDLEIRNKAKVDKYGRKTKDEGS-- 63

Query: 64  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRARGEVPDDYVXXXXXXXXXXXXXXX 123
                                             RARGEVP DYV               
Sbjct: 64  --KKELDDFEKYFEKEDEEEKKDTEETEEKPKVDRARGEVPSDYVSSSDEYTSSESEDSE 121

Query: 124 XXXXXXXXXXXXXXXXXXANSGKPESGDPSKTLAVVNLDWDHVKSVDLMITFTGFIPKGG 183
                               + KPE+GD SKTLAVVNLDWDHVKS DLM+TF+ F+PKGG
Sbjct: 122 EEELDSDVESEVE-----IENTKPETGDASKTLAVVNLDWDHVKSADLMVTFSSFVPKGG 176

Query: 184 KIERICIYPSEFGKERLNREEKEGPPKELFHXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 243
           KI RICIYPSEFGKERL REE EGPPKELF                              
Sbjct: 177 KISRICIYPSEFGKERLQREEVEGPPKELFQKKNKKKASHKEDFDSDSDVDIKD------ 230

Query: 244 XXLYEEGDAEKDIDSKALRQYQLERLRYFYAVVYCNNVETAKAIYDNCDATEYESTANMF 303
             LYEEGDAEKD+DSKALRQYQLERLRY+YAVVYCNN++TA+AIY+NCD TEYESTANMF
Sbjct: 231 --LYEEGDAEKDVDSKALRQYQLERLRYYYAVVYCNNIDTARAIYENCDGTEYESTANMF 288

Query: 304 DLRYVPEGMTFDDDPRDECEALPKNYKPLNFATDALQHSNVKLTWDETPADRVEIAKRAF 363
           DLRYVP+GMTFDD+PRDEC +LPKNYKP+ F+TDALQHSNVKLTWDETPADRVE+AKRAF
Sbjct: 289 DLRYVPDGMTFDDEPRDECNSLPKNYKPMQFSTDALQHSNVKLTWDETPADRVEVAKRAF 348

Query: 364 SQKEIDDMDFKAYLASDSEDSDAKVDETMKNRLKALVGGTLKASRPKGGAXXXXXXXXXX 423
           SQKEI+DMDFKAYLASDS++S+ +V+E  KN+LKALVG +L       G           
Sbjct: 349 SQKEIEDMDFKAYLASDSDESEEEVNENSKNKLKALVGESLDF-----GTNGASDGESEV 403

Query: 424 XXXITFTPGLDXXXXXXXXXXXXXXSTIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 483
              ITFTPGLD                +                                
Sbjct: 404 DMEITFTPGLDEAKESEEEKEESTIEKVRRKEKERRKARKDKLKQLKKDAENEKKEKMRS 463

Query: 484 XXXXXXXXXNGEEEPVDDKAKAXXXXXXXXXXXXRDSKSTLNKKMHFNMNEIMRXXXXXX 543
                      E E     AKA             D++ +LNKK HFN+NEI+R      
Sbjct: 464 LHDKKSRKAETENEEA---AKAKAELELLMIEDEDDTEQSLNKKAHFNLNEIIRSEKEKG 520

Query: 544 XXXXFQDKNRIVEDEFKPDLSDDRFKEVFEDHDFAIDPSRPEFKETPAMQKILQEXXXXX 603
               +Q K +IVED+FKPDLSD RFKEVFEDHDFAIDPS+PEFK+T AM++IL E     
Sbjct: 521 KKGKYQRKEKIVEDDFKPDLSDPRFKEVFEDHDFAIDPSQPEFKQTNAMKQILNERSKRS 580

Query: 604 XXXXXXXXXAEQSTDTS----DKTDISQIVS 630
                     ++  DTS     K  IS IV+
Sbjct: 581 KERSKGGKNKKRKLDTSTSKNGKNAISNIVN 611

>Smik_4.632 Chr4 complement(1130422..1132305) [1884 bp, 627 aa] {ON}
           YDR365C (REAL)
          Length = 627

 Score =  507 bits (1306), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 279/595 (46%), Positives = 335/595 (56%), Gaps = 23/595 (3%)

Query: 4   KMSSDPRFSGVYNDPKFRSTKEKKLKVKLDSRFSXXXXXXXXXXXXXXYGRKIKNGDANX 63
           K  +D RF+G+Y+DPKF++T+ K  K+KLDSRFS              YGRKIKN   N 
Sbjct: 8   KEGADTRFAGIYSDPKFKNTRTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKNTQNNK 67

Query: 64  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRARGEVPDDYVXXXXXXXXXXXXXXX 123
                                             RARGE+  DYV               
Sbjct: 68  ELEDFDKYFQKEAENDEDTEASVKTVVD------RARGEISGDYVSSSDEFTSSDSESSE 121

Query: 124 XXXXXXXXXXXXXXXXXXANSGKPESGDPSKTLAVVNLDWDHVKSVDLMITFTGFIPKGG 183
                                 KPE GD SKTLAVVNLDWDHVKS DLMITF+ F+PKGG
Sbjct: 122 QSEVESEVESEVE-----IEDPKPECGDVSKTLAVVNLDWDHVKSEDLMITFSSFVPKGG 176

Query: 184 KIERICIYPSEFGKERLNREEKEGPPKELFHXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 243
           K+ER+ IYPSEFGKER+ REE EGPPKELF                              
Sbjct: 177 KLERVAIYPSEFGKERMQREEVEGPPKELFQKKNKNKVSRKKKSDESDSDIDIGIND--- 233

Query: 244 XXLYEEGDAEKDIDSKALRQYQLERLRYFYAVVYCNNVETAKAIYDNCDATEYESTANMF 303
             LYEEGDA+KD+DS+ALRQYQL+RLRY+YA+VYC+++ T+KAIYDNCD TEYESTANMF
Sbjct: 234 --LYEEGDADKDVDSRALRQYQLDRLRYYYAIVYCSDITTSKAIYDNCDGTEYESTANMF 291

Query: 304 DLRYVPEGMTFDDDPRDECEALPKNYKPLNFATDALQHSNVKLTWDETPADRVEIAKRAF 363
           DLRYVP+GMTFDD  RDEC  LPKNY+P  F+TDALQHSNVKLTWDETPADR+E+AKRAF
Sbjct: 292 DLRYVPDGMTFDDAVRDECTLLPKNYRPHQFSTDALQHSNVKLTWDETPADRLEVAKRAF 351

Query: 364 SQKEIDDMDFKAYLASDSEDSDAKVDETMKNRLKALVGGTLKASRPKGGAXXXXXXXXXX 423
           +QKEIDDMDFKAYLASDS++SD ++DE  KN+LK+LVGG    S+ +             
Sbjct: 352 TQKEIDDMDFKAYLASDSDESDEQIDEDAKNKLKSLVGGINFNSKKEN----VKDSDEEV 407

Query: 424 XXXITFTPGLDXXXXXXXXXXXXXXSTIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 483
              ITFTP L+              +TI+                               
Sbjct: 408 DMEITFTPALE--GGNEQPSEEQEETTIEKIRRKEKERRKARKQKVKELKQQSEKDKKTK 465

Query: 484 XXXXXXXXXNGEEEPVDDKAKAXXXXXXXXXXXXRDSKSTLNKKMHFNMNEIMRXXXXXX 543
                     GEE+ + + AKA             +++ T+N K HFNMNEI+R      
Sbjct: 466 LKSINKKYAEGEED-IKNNAKAKAELELLMDDDDAEAQGTINNKAHFNMNEILRSEKEKN 524

Query: 544 XXXXFQDKNRIVEDEFKPDLSDDRFKEVFEDHDFAIDPSRPEFKETPAMQKILQE 598
               +Q+K RIVED F PDL+D RFKEVFEDHDFAIDP++PE+K T AM KIL+E
Sbjct: 525 KKSRYQNKERIVEDNFTPDLNDPRFKEVFEDHDFAIDPTQPEYKSTQAMNKILKE 579

>YDR365C Chr4 complement(1204497..1206383) [1887 bp, 628 aa] {ON}
           ESF1Nucleolar protein involved in pre-rRNA processing;
           depletion causes severely decreased 18S rRNA levels
          Length = 628

 Score =  507 bits (1306), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 284/595 (47%), Positives = 330/595 (55%), Gaps = 22/595 (3%)

Query: 4   KMSSDPRFSGVYNDPKFRSTKEKKLKVKLDSRFSXXXXXXXXXXXXXXYGRKIKNGDANX 63
           K   D RF+G+Y+DPKF++TK K  K+KLDSRFS              YGRKIKN   N 
Sbjct: 8   KEGVDARFAGIYSDPKFKNTKTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKNAQNNR 67

Query: 64  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRARGEVPDDYVXXXXXXXXXXXXXXX 123
                                             RARGEVPDDYV               
Sbjct: 68  ELEDFDKYFEKEAENDEDSEVNAKTVVD------RARGEVPDDYVSSSDEFTSSDSESSG 121

Query: 124 XXXXXXXXXXXXXXXXXXANSGKPESGDPSKTLAVVNLDWDHVKSVDLMITFTGFIPKGG 183
                               + KPESGD SK LAVVNLDWDHVKS DLMITF+ F+PKGG
Sbjct: 122 ESEVESEEENEVE-----IENAKPESGDISKNLAVVNLDWDHVKSEDLMITFSSFVPKGG 176

Query: 184 KIERICIYPSEFGKERLNREEKEGPPKELFHXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 243
           KIER+ IYPSEFGKER+ REE EGPPKELF                              
Sbjct: 177 KIERVAIYPSEFGKERMQREEVEGPPKELFQKKNKNKTSKKKKTDDSDSDMDIGIKD--- 233

Query: 244 XXLYEEGDAEKDIDSKALRQYQLERLRYFYAVVYCNNVETAKAIYDNCDATEYESTANMF 303
             LYEEGDA+KD+DS+ALRQYQL+RLRY+YA+VYC++  T+KAIYDNCD TEYESTANMF
Sbjct: 234 --LYEEGDADKDVDSRALRQYQLDRLRYYYAIVYCSDTTTSKAIYDNCDGTEYESTANMF 291

Query: 304 DLRYVPEGMTFDDDPRDECEALPKNYKPLNFATDALQHSNVKLTWDETPADRVEIAKRAF 363
           DLRYVP+GMTFDDD RDEC  LPKNY+P  F+TDALQHS+VKLTWDETPADRVE+AKRAF
Sbjct: 292 DLRYVPDGMTFDDDVRDECSILPKNYRPHQFSTDALQHSSVKLTWDETPADRVEVAKRAF 351

Query: 364 SQKEIDDMDFKAYLASDSEDSDAKVDETMKNRLKALVGGTLKASRPKGGAXXXXXXXXXX 423
           +QKEIDDMDFKAYLASDS++SD +VDE  KN+LK+LVG     S+ +             
Sbjct: 352 TQKEIDDMDFKAYLASDSDESDGQVDEEAKNKLKSLVGDFGFNSKKE----TPNDEDEEV 407

Query: 424 XXXITFTPGLDXXXXXXXXXXXXXXSTIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 483
              ITFTP L+              +TI+                               
Sbjct: 408 DMEITFTPALE--GGNEKSSEDKEETTIEKIRRKEKERRKARKQKVKELKQQSEKDKKSK 465

Query: 484 XXXXXXXXXNGEEEPVDDKAKAXXXXXXXXXXXXRDSKSTLNKKMHFNMNEIMRXXXXXX 543
                    N EEE   +                 +++ T+N K HFNMNEI+R      
Sbjct: 466 LKSVNKKHTNDEEEIEKNAKSKAELELLMDDDDDTETQGTINNKAHFNMNEILRSEKEKH 525

Query: 544 XXXXFQDKNRIVEDEFKPDLSDDRFKEVFEDHDFAIDPSRPEFKETPAMQKILQE 598
               +Q K RIVED F PDL D RFKEVFEDHDFAIDP++PEFK T AM KIL+E
Sbjct: 526 KKGRYQKKERIVEDTFTPDLEDPRFKEVFEDHDFAIDPTQPEFKGTQAMSKILKE 580

>Kpol_1016.8 s1016 (16620..18533) [1914 bp, 637 aa] {ON}
           (16620..18533) [1914 nt, 638 aa]
          Length = 637

 Score =  500 bits (1288), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 284/597 (47%), Positives = 340/597 (56%), Gaps = 14/597 (2%)

Query: 4   KMSSDPRFSGVYNDPKFRSTKEKKLKVKLDSRFSXXXXXXXXXXXXXXYGRKIKNGDANX 63
           K SSDPRFSG+Y+DPKF+++K K +K+KLD RF               YGRK+K+   N 
Sbjct: 8   KQSSDPRFSGIYSDPKFKNSKRKNIKIKLDDRFDKSDLQIKHKSKVDKYGRKLKDVKDNK 67

Query: 64  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRARGEVPDDYVXXXXXXXXXXXXXXX 123
                                             RARGEVP DY                
Sbjct: 68  ELEDFDKYFEKEDEEDKEEEIGTEAKVKVLD---RARGEVPSDY-----ESSSEEFTSSD 119

Query: 124 XXXXXXXXXXXXXXXXXXANSGKPESGDPSKTLAVVNLDWDHVKSVDLMITFTGFIPKGG 183
                               + KPESGD SKTLAVVNLDWD+VKS DLMITF+ F+PKGG
Sbjct: 120 SESSGESEVDSDEESEDEVETSKPESGDSSKTLAVVNLDWDYVKSQDLMITFSSFLPKGG 179

Query: 184 KIERICIYPSEFGKERLNREEKEGPPKELFHXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 243
           KIE+ICIYPSEFGKER+ REE EGPP+ELF+                             
Sbjct: 180 KIEKICIYPSEFGKERMAREEVEGPPRELFNKKKNKKSSKKSSKDDDEDDESDSDVDIRE 239

Query: 244 XXLYEEGDAEKDIDSKALRQYQLERLRYFYAVVYCNNVETAKAIYDNCDATEYESTANMF 303
             LYEEGDAEKD+DSKALRQYQLERLRY+YAVVYCNN+ +A++IY+NCD TEYES+AN+F
Sbjct: 240 --LYEEGDAEKDVDSKALRQYQLERLRYYYAVVYCNNIASAESIYENCDGTEYESSANIF 297

Query: 304 DLRYVPEGMTFDDDPRDECEALPKNYKPLNFATDALQHSNVKLTWDETPADRVEIAKRAF 363
           DLRYVP+G  FDD+PRDEC  LPKNYK   F TDALQHSNVKLTWDETPADRVEIAKRAF
Sbjct: 298 DLRYVPDGTEFDDEPRDECLQLPKNYKVRQFTTDALQHSNVKLTWDETPADRVEIAKRAF 357

Query: 364 SQKEIDDMDFKAYLASDSEDSDAKVDETMKNRLKALVG-GTLKASRPKGGAXXXXXXXXX 422
           +QKEI++MDFKAYLASDS++S+ + ++ +KN+LK+LV   T    +              
Sbjct: 358 TQKEIEEMDFKAYLASDSDESEEEPNDDVKNKLKSLVSQSTTIGDKSIFDDKGDNNEEDD 417

Query: 423 XXXXITFTPGLDXXXXXXXXXXXXXXSTIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 482
               ITFTPGL               +TI+                              
Sbjct: 418 VDMEITFTPGLGEGGEDGDEDKDNEETTIEKVRRKEKERRKARKDKLKQLKQQSENEKKE 477

Query: 483 XXXXXXXXXX-NGEEEPVDDKAKAXXXXXXXXXXXXRDSKSTLNKKMHFNMNEIMRXXXX 541
                      NG+   VD KAKA             +S STLNKK HFNMNEI+R    
Sbjct: 478 KLKELKKERNGNGKNTNVDAKAKAELELLMMDDET--ESTSTLNKKAHFNMNEIVRSEKE 535

Query: 542 XXXXXXFQDKNRIVEDEFKPDLSDDRFKEVFEDHDFAIDPSRPEFKETPAMQKILQE 598
                 +QDKN+IVED+FKPDL+D RFKE+FEDHDFAIDP++ EFKET AM++IL+E
Sbjct: 536 KGKKSKYQDKNKIVEDDFKPDLNDPRFKEIFEDHDFAIDPTQSEFKETTAMKEILKE 592

>CAGL0L11638g Chr12 (1243194..1245020) [1827 bp, 608 aa] {ON}
           similar to uniprot|Q06344 Saccharomyces cerevisiae
           YDR365c
          Length = 608

 Score =  499 bits (1284), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 286/629 (45%), Positives = 348/629 (55%), Gaps = 31/629 (4%)

Query: 1   MSDKMSSDPRFSGVYNDPKFRSTKEKKLKVKLDSRFSXXXXXXXXXXXXXXYGRKIKNGD 60
           MS++ S+DPRFS +YNDPKF+ +  K+LK+KLD RF               YGRKIK G 
Sbjct: 1   MSEEKSNDPRFSRIYNDPKFKKSNSKQLKIKLDDRFGKKDLEVARRAKVDKYGRKIKEG- 59

Query: 61  ANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRARGEVPDDYVXXXXXXXXXXXX 120
           ++                                   RARGEVP DYV            
Sbjct: 60  SSKDIEDFDKYFEKDEKSAEEESADEGDVAKSKKIVDRARGEVPSDYVSSEDEFTSSDSD 119

Query: 121 XXXXXXXXXXXXXXXXXXXXXANSGKPESGDPSKTLAVVNLDWDHVKSVDLMITFTGFIP 180
                                    K E+GD +KTLA VNLDWDHV+SVD+M+TF+ F+P
Sbjct: 120 TSGDSDYDSEIESGDEAQEEQT---KVETGDATKTLAAVNLDWDHVRSVDMMVTFSSFLP 176

Query: 181 KGGKIERICIYPSEFGKERLNREEKEGPPKELFHXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           KGGKIE+ICIYPSEFGKER+ REE EGPP+ELF                           
Sbjct: 177 KGGKIEKICIYPSEFGKERMKREEVEGPPRELFQKNKKKKKKNSSEDEEESDVDIKD--- 233

Query: 241 XXXXXLYEEGDAEKDIDSKALRQYQLERLRYFYAVVYCNNVETAKAIYDNCDATEYESTA 300
                LYEEG+A+  +D +ALRQYQL+RLRY+YAV+YCNNVE+AKAIY+NCD TEYESTA
Sbjct: 234 -----LYEEGNADDQVDKRALRQYQLDRLRYYYAVIYCNNVESAKAIYENCDGTEYESTA 288

Query: 301 NMFDLRYVPEGMTFDDDPRDECEALPKNYKPLNFATDALQHSNVKLTWDETPADRVEIAK 360
           N+ DLRYVP+GM FDD+P+D+CE LPKNYKP  F+TDALQHSNVKLTWDETP DRVE+AK
Sbjct: 289 NIIDLRYVPDGMDFDDEPKDQCEELPKNYKPHQFSTDALQHSNVKLTWDETPVDRVEVAK 348

Query: 361 RAFSQKEIDDMDFKAYLASDSEDSDAKVDETMKNRLKALVGGTLKASRPKGGAXXXXXXX 420
           RAF+QKEI+DMDFKAYLASDS++S+ +V+E  KN+LK+LVG +LK     G         
Sbjct: 349 RAFTQKEIEDMDFKAYLASDSDESEEEVNEEAKNKLKSLVGESLKIDGKDGS-----DED 403

Query: 421 XXXXXXITFTPGLDXXXXXXXXXXXXXXSTIDXXXXXXXXXXXXXXXXXXXXXXXXXXXX 480
                 ITFTPGLD                 D                            
Sbjct: 404 EGMDMEITFTPGLDEANAEGEDKDGE-----DNEETTIEKVRRKEKERRKARKQKLKELK 458

Query: 481 XXXXXXXXXXXXNGEEEPVDDKAKAXXXXXXXXXXXXRDSKSTLNKKMHFNMNEIMRXXX 540
                       +  +EP+ DK KA             +S S +N K HFNMNEI+R   
Sbjct: 459 QKSEEEKKQKLKSKHDEPLSDKKKAELELLMMDEN---ESNSGINSKAHFNMNEILRSEK 515

Query: 541 XXXXXXXFQDKNRIVEDEFKPDLSDDRFKEVFEDHDFAIDPSRPEFKETPAMQKILQEXX 600
                  FQ K RIVED+FKP+L DDRFKEVFEDHDFAIDPS+PEFKET AM++IL+E  
Sbjct: 516 EKSKKGKFQKKQRIVEDDFKPNLDDDRFKEVFEDHDFAIDPSQPEFKETKAMKEILKERR 575

Query: 601 XXXXXXXXXXXXAEQSTDTSDKTDISQIV 629
                            + +DK DI++IV
Sbjct: 576 KRSRDSKHGKE------EHTDKNDINKIV 598

>SAKL0G02442g Chr7 complement(201924..203795) [1872 bp, 623 aa] {ON}
           similar to uniprot|Q06344 YDR365C Saccharomyces
           cerevisiae ESF1 Nucleolar protein involved in pre-rRNA
           processing
          Length = 623

 Score =  485 bits (1249), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 270/593 (45%), Positives = 333/593 (56%), Gaps = 24/593 (4%)

Query: 6   SSDPRFSGVYNDPKFRSTKEKKLKVKLDSRFSXXXXXXXXXXXXXXYGRKIKNGDANXXX 65
           ++DPRFSG+++DPKF+  K K LK+KLD RFS              YGR++K+ D     
Sbjct: 11  TNDPRFSGIHSDPKFKDAKPKNLKIKLDDRFSKKDLEIKKKAKVDKYGRRLKDVD---NK 67

Query: 66  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRARGEVPDDYVXXXXXXXXXXXXXXXXX 125
                                           RARGEVP DY+                 
Sbjct: 68  ETKDFERYFEKEEESSSPSDEEGESTKVTSLDRARGEVPSDYLSSSEEESSSESEEESEN 127

Query: 126 XXXXXXXXXXXXXXXXANSGKPESGDPSKTLAVVNLDWDHVKSVDLMITFTGFIPKGGKI 185
                               KP +GD ++ LAVVNLDWDHVKS DLM+TF+ F+PKGGKI
Sbjct: 128 SELESEESDLE-----IEESKPPTGDATRMLAVVNLDWDHVKSTDLMVTFSSFVPKGGKI 182

Query: 186 ERICIYPSEFGKERLNREEKEGPPKELFHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 245
            +I IYPSEFGKER+ REE EGPP+ELF                                
Sbjct: 183 LKIAIYPSEFGKERMQREEVEGPPRELFQGKKKKSQRKDGDDSDVDIKD----------- 231

Query: 246 LYEEGDAEKDIDSKALRQYQLERLRYFYAVVYCNNVETAKAIYDNCDATEYESTANMFDL 305
           LYEEGDAEKD DSKALR+YQL+RLRY+YAVV+CNNVETA+AIY NCD TEYESTANMFDL
Sbjct: 232 LYEEGDAEKDYDSKALRRYQLDRLRYYYAVVFCNNVETAEAIYQNCDGTEYESTANMFDL 291

Query: 306 RYVPEGMTFDDDPRDECEALPKNYKPLNFATDALQHSNVKLTWDETPADRVEIAKRAFSQ 365
           RYVPEGM F D+P+DECE +PKNYKP  F+TDALQHSNVKLTWDETPA+RVE++KRAF+Q
Sbjct: 292 RYVPEGMDFSDEPKDECEDVPKNYKPAQFSTDALQHSNVKLTWDETPAERVEMSKRAFTQ 351

Query: 366 KEIDDMDFKAYLASDSEDSDAKVDETMKNRLKALVGGTLKASRPKGGAXXXXXXXXXXXX 425
           KEI+DMDFKAYLASDSE S+ +++E  +N+LK+LV  +++    K               
Sbjct: 352 KEIEDMDFKAYLASDSEGSEEEINEDSRNKLKSLVSESIRIG-DKSLFDKSDNEGGDVDM 410

Query: 426 XITFTPGLDXXXXXXXXXXXXXXSTIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 485
            ITFTPGLD              +TI+                                 
Sbjct: 411 EITFTPGLD--EAKKDDEDGKDETTIEKIRRKEKERRKMRKERVKELKKKAEEKKREKLN 468

Query: 486 XXXXXXXNGEEEPVDDKAKAXXXXXXXXXXXXRDSKSTLNKKMHFNMNEIMRXXXXXXXX 545
                    +E  V+ + K+             D++S LNKK HFNM EI+R        
Sbjct: 469 KSDSQSKTADE--VEKEKKSKAELELLMMDDDNDTESKLNKKAHFNMTEILRSEKEKGKR 526

Query: 546 XXFQDKNRIVEDEFKPDLSDDRFKEVFEDHDFAIDPSRPEFKETPAMQKILQE 598
             +Q++ +IVEDEFKPDL+D RF+EVFEDHDFAIDPS+PEFK T AM++IL+E
Sbjct: 527 TKYQNREKIVEDEFKPDLNDPRFREVFEDHDFAIDPSQPEFKGTTAMKEILKE 579

>TBLA0A06540 Chr1 (1602559..1604538) [1980 bp, 659 aa] {ON}
           Anc_5.430 YDR365C
          Length = 659

 Score =  470 bits (1209), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 254/503 (50%), Positives = 305/503 (60%), Gaps = 33/503 (6%)

Query: 144 SGKPESGDPSKTLAVVNLDWDHVKSVDLMITFTGFIPKGGKIERICIYPSEFGKERLNRE 203
           S KPE+GDPSKT+AVVNLDWDHVKS DLMITF+GFIPKGGKI +I IYPSEFGKER+ RE
Sbjct: 159 SAKPETGDPSKTVAVVNLDWDHVKSTDLMITFSGFIPKGGKINKIAIYPSEFGKERMQRE 218

Query: 204 EKEGPPKELFHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLYEEGDAEKDIDSKALRQ 263
           E EGPPKELF                                LYEEGDA+K+IDSK+LRQ
Sbjct: 219 EIEGPPKELFKKKNKKGKKSTAEDNEDDVSDVDIND------LYEEGDADKNIDSKSLRQ 272

Query: 264 YQLERLRYFYAVVYCNNVETAKAIYDNCDATEYESTANMFDLRYVPEGMTFDDDPRDECE 323
           YQLERLRY+YAVVYCNN+ TA++IY NCD TEYESTAN+FD+RYVP+ MTFDD PRDEC+
Sbjct: 273 YQLERLRYYYAVVYCNNIGTAESIYKNCDGTEYESTANVFDIRYVPDEMTFDDTPRDECD 332

Query: 324 ALPKNYKPLNFATDALQHSNVKLTWDETPADRVEIAKRAFSQKEIDDMDFKAYLASDSED 383
            LPKNYKPL F+TDALQHSNVKLTWDETPADRVEI+KRAFSQKEID+MDFKAYLASDS++
Sbjct: 333 QLPKNYKPLQFSTDALQHSNVKLTWDETPADRVEISKRAFSQKEIDEMDFKAYLASDSDE 392

Query: 384 SDAKVDETMKNRLKALVGGT-------------LKASRPKGGAXXXXXXXXXXXXXITFT 430
           S+++++   KN+LK+LVGG              L  S  + G              ITFT
Sbjct: 393 SESELNNDSKNKLKSLVGGGAFGNVFGKDTEYDLDGSDDEDGV----------DMEITFT 442

Query: 431 PGLDXXXXXXXXXXXXXXSTIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 490
           PGLD              STI+                                      
Sbjct: 443 PGLDEKKEASDNETKKEESTIEKLQRKEKERRKLRKQKVKDLKEKSVQERKEKLNSNRNR 502

Query: 491 XXNGEEEPVDDKAKAXXXXXXXXXXXXRDSK---STLNKKMHFNMNEIMRXXXXXXXXXX 547
                 E + D+ +              D     S +N K HFNMNEI+R          
Sbjct: 503 NKKNNNELLKDEKEKQDKSKAELELLMMDEDDRISGVNNKAHFNMNEILRSEKEKGKKSK 562

Query: 548 FQDKNRIVEDEFKPDLSDDRFKEVFEDHDFAIDPSRPEFKETPAMQKILQEXXXXXXXXX 607
           +QDKN+IV+DEFKP+L+D RF E+FEDH FAIDP++PEFK+T AM++IL E         
Sbjct: 563 YQDKNKIVQDEFKPNLNDSRFDEIFEDHAFAIDPTQPEFKQTSAMKEILNERTKRASKKQ 622

Query: 608 XXXXXAEQSTDTS-DKTDISQIV 629
                 ++  +T+ DK+DIS IV
Sbjct: 623 NKDKDNKKRKNTNEDKSDISNIV 645

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 30/49 (61%)

Query: 8  DPRFSGVYNDPKFRSTKEKKLKVKLDSRFSXXXXXXXXXXXXXXYGRKI 56
          D RF+GV+ DPKFR +K+  LKVKLD+RFS              YGRKI
Sbjct: 9  DARFAGVFTDPKFRRSKKDSLKVKLDNRFSKKDLQVNYKSKVDRYGRKI 57

>Skud_4.635 Chr4 complement(1133271..1135160) [1890 bp, 629 aa] {ON}
           YDR365C (REAL)
          Length = 629

 Score =  467 bits (1201), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 278/597 (46%), Positives = 333/597 (55%), Gaps = 21/597 (3%)

Query: 2   SDKMSSDPRFSGVYNDPKFRSTKEKKLKVKLDSRFSXXXXXXXXXXXXXXYGRKIKNGDA 61
           S+K S D RF+G+ +DPKF++T+ +  K+KLDSRFS              YGRKIK+   
Sbjct: 6   SEKESIDARFAGISSDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKDARN 65

Query: 62  NXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRARGEVPDDYVXXXXXXXXXXXXX 121
           N                                   RARGEVP DYV             
Sbjct: 66  NKELEDFDKYFEKEAEHDEDSEVAAKIVVD------RARGEVPSDYVSSSDEFTSSDSES 119

Query: 122 XXXXXXXXXXXXXXXXXXXXANSGKPESGDPSKTLAVVNLDWDHVKSVDLMITFTGFIPK 181
                               A     ESGD SKTLAVVNLDWDHVKS DLMITF+ F+P+
Sbjct: 120 SGESEVESEVEGEVETEDVAA-----ESGDVSKTLAVVNLDWDHVKSEDLMITFSSFVPR 174

Query: 182 GGKIERICIYPSEFGKERLNREEKEGPPKELFHXXXXXXXXXXXXXXXXXXXXXXXXXXX 241
           GGKIERI I+PSEFG+ER+ REE EGPPKELF                            
Sbjct: 175 GGKIERIAIFPSEFGRERMEREEVEGPPKELFQKKNKNKHAKEKNSVGTDSDGDIGIND- 233

Query: 242 XXXXLYEEGDAEKDIDSKALRQYQLERLRYFYAVVYCNNVETAKAIYDNCDATEYESTAN 301
               LYEEGDA+KD+DS+ALRQYQL+RLRY+YAVV C++  +AKAIYDNCD TEYESTAN
Sbjct: 234 ----LYEEGDADKDVDSRALRQYQLDRLRYYYAVVCCSDTTSAKAIYDNCDGTEYESTAN 289

Query: 302 MFDLRYVPEGMTFDDDPRDECEALPKNYKPLNFATDALQHSNVKLTWDETPADRVEIAKR 361
           MFDLRYVP+GMTFDD  RDEC +LPKNY+P  F+TDALQHSNVKLTWDETPADR+E+AKR
Sbjct: 290 MFDLRYVPDGMTFDDAARDECTSLPKNYRPHQFSTDALQHSNVKLTWDETPADRLEVAKR 349

Query: 362 AFSQKEIDDMDFKAYLASDSEDSDAKVDETMKNRLKALVGGTLKASRPKGGAXXXXXXXX 421
           AF+QKEIDDMDFKAYLASDS++SD +VDE  KN+LK+LVGG L  +  K GA        
Sbjct: 350 AFTQKEIDDMDFKAYLASDSDESDEQVDEDAKNKLKSLVGG-LDFNMKKKGA-NDGKEEG 407

Query: 422 XXXXXITFTPGLDXXXXXXXXXXXXXXSTIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 481
                ITFTP L+              +TI+                             
Sbjct: 408 EVDMEITFTPALE--GENEKPIEGQDETTIEKIRRKEKERRKARKQKVKELKQQSEKDKK 465

Query: 482 XXXXXXXXXXXNGEEEPVDDKAKAXXXXXXXXXXXXRDSKSTLNKKMHFNMNEIMRXXXX 541
                        EEE + + AK+             +++ ++N K HF+M EI+R    
Sbjct: 466 SKLKSVNKKHVADEEE-IKNNAKSKAELELLMDEDDAETEGSMNSKAHFSMKEILRSEKE 524

Query: 542 XXXXXXFQDKNRIVEDEFKPDLSDDRFKEVFEDHDFAIDPSRPEFKETPAMQKILQE 598
                 +Q K RIVED F PDL D RFKEVFEDHDFAIDP++PE+K T AM  IL+E
Sbjct: 525 KHKRGRYQKKERIVEDTFAPDLEDPRFKEVFEDHDFAIDPTQPEYKNTQAMSTILKE 581

>TDEL0E01950 Chr5 (367743..369596) [1854 bp, 617 aa] {ON} Anc_5.430
           YDR365C
          Length = 617

 Score =  447 bits (1149), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 274/630 (43%), Positives = 341/630 (54%), Gaps = 26/630 (4%)

Query: 1   MSDKMSSDPRFSGVYNDPKFRSTKEKKLKVKLDSRFSXXXXXXXXXXXXXXYGRKIKNGD 60
           MS+K S DPRFS +Y+DPKF + K K  KVKLD RFS              YGR++++  
Sbjct: 1   MSEKRSKDPRFSKIYDDPKFNNVKTKGFKVKLDDRFSKKDLEIKRKTKVDKYGRRMRD-- 58

Query: 61  ANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRARGEVPDDYVXXXXXXXXXXXX 120
                                                RARGEVP DYV            
Sbjct: 59  ----VEDSKESKDFDKYFEQSDEEKKKDKDTEILTVDRARGEVPSDYVSSSDEFTSSDSE 114

Query: 121 XXXXXXXXXXXXXXXXXXXXXANSGKPESGDPSKTLAVVNLDWDHVKSVDLMITFTGFIP 180
                                    +P SGD SKTLAVVNLDWD+V+S DLMITF+ F+P
Sbjct: 115 VSDNEVESESESEVELEKT------EPSSGDSSKTLAVVNLDWDNVRSSDLMITFSSFLP 168

Query: 181 KGGKIERICIYPSEFGKERLNREEKEGPPKELFHXXXXXXXXXXXXXXXXXXXXXXXXXX 240
            GG+IE+I IYPSEFGKER+ REE EGPPKELF                           
Sbjct: 169 AGGRIEKIAIYPSEFGKERMQREEVEGPPKELFQKKKKKSKKGQQEDSDSDIDVKD---- 224

Query: 241 XXXXXLYEEGDAEKDIDSKALRQYQLERLRYFYAVVYCNNVETAKAIYDNCDATEYESTA 300
                LYEEGDA+K++D+KALRQYQL+RLRY+YAVVYCNNV  A++IY+NCD TEYESTA
Sbjct: 225 -----LYEEGDADKNVDNKALRQYQLDRLRYYYAVVYCNNVAAAESIYNNCDGTEYESTA 279

Query: 301 NMFDLRYVPEGMTFDDDPRDECEALPKNYKPLNFATDALQHSNVKLTWDETPADRVEIAK 360
           N+FD+RYVP+GM FD  P+D C  LPKNYKPL F+TDALQHSNVKLTWDETPADR+++AK
Sbjct: 280 NIFDIRYVPDGMDFDGKPKDSCTELPKNYKPLQFSTDALQHSNVKLTWDETPADRLDVAK 339

Query: 361 RAFSQKEIDDMDFKAYLASDSEDSDAKVDETMKNRLKALVGGTLKASRPKGGAXXXXXXX 420
           RAF+QKEI+DMDFKAYLASDS+DS+ +VD   K++LK+LV G+      +  A       
Sbjct: 340 RAFTQKEIEDMDFKAYLASDSDDSEDEVDAQSKSKLKSLVTGSSAFDFTRKNADEVDGND 399

Query: 421 XXXXXXITFTPGLDXXXXXXXXXXXXXXSTIDXXXXXXXXXXXXXXXXXXXXXXXXXXXX 480
                 ITFTPGLD              STID                            
Sbjct: 400 EEVDMEITFTPGLD-EANKDGQEGQEEESTIDKVRRKEKERRKARKAKVKELKHQAEQDK 458

Query: 481 XXXXXXXXXXXXNGEEEPVDDKAKAXXXXXXXXXXXXRDSKSTLNKKMHFNMNEIMRXXX 540
                       +  E+  D K+KA             D++ ++NKK HFNM EI++   
Sbjct: 459 KVKLKKGRGKQTSDIEQ--DPKSKAELELLMMDDED--DTEKSINKKAHFNMKEILKSEK 514

Query: 541 XXXXXXXFQDKNRIVEDEFKPDLSDDRFKEVFEDHDFAIDPSRPEFKETPAMQKILQEXX 600
                  +QDKN+IV D+FKPDL D RFKE+FE HDFAIDP++ EF+ T AM+++L +  
Sbjct: 515 EKKKKNKYQDKNKIVVDDFKPDLEDPRFKEMFEGHDFAIDPTQSEFRGTKAMKEMLNKRS 574

Query: 601 XXXXXXXXXXXXAEQSTDTSDKTDISQIVS 630
                       A Q  DT++  DI+ IV+
Sbjct: 575 KQAHRVNSKRKIATQENDTNENGDIANIVA 604

>NCAS0F03350 Chr6 complement(677168..679087) [1920 bp, 639 aa] {ON}
           Anc_5.430 YDR365C
          Length = 639

 Score =  425 bits (1093), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 224/434 (51%), Positives = 267/434 (61%), Gaps = 15/434 (3%)

Query: 2   SDKMSSDPRFSGVYNDPKFRSTKEKKLKVKLDSRFSXXXXXXXXXXXXXXYGRKIKNGDA 61
           S K + D RFSG+YNDPKFR TK K LK+KLD RFS              YGRKI + D 
Sbjct: 6   STKGTDDSRFSGIYNDPKFRKTKNKNLKIKLDERFSKKDLEIRRKAKVDKYGRKI-HEDN 64

Query: 62  NXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRARGEVPDDYVXXXXXXXXXXXXX 121
           +                                   RARGEVP DYV             
Sbjct: 65  DMNNKELKDFDKYFEKEGESADEKKEEEEIETVTVDRARGEVPADYVSSSDEYTSSESED 124

Query: 122 XXXXXXXXXXXXXXXXXXXXANSGKPESGDPSKTLAVVNLDWDHVKSVDLMITFTGFIPK 181
                                +   PE+GD +KTLAVVNLDWDHV+S DLMITF+GF+PK
Sbjct: 125 SGESDLESEGESEIE-----VDEATPETGDATKTLAVVNLDWDHVRSSDLMITFSGFLPK 179

Query: 182 GGKIERICIYPSEFGKERLNREEKEGPPKELFHXXXXXXXXXXXXXXXXXXXXXXXXXXX 241
           GGKIE+I + PSEFGKER+ REE EGPP+ELF                            
Sbjct: 180 GGKIEKIVVLPSEFGKERMQREETEGPPRELFQKKKKKGKRASVESDSDDSDVDIKD--- 236

Query: 242 XXXXLYEEGDAEKDIDSKALRQYQLERLRYFYAVVYCNNVETAKAIYDNCDATEYESTAN 301
               LYEEGDA+KD+D++ALRQYQLERLRY+YAVVYCN+VE A+AIY+NCD TEYESTAN
Sbjct: 237 ----LYEEGDADKDVDTRALRQYQLERLRYYYAVVYCNSVEAARAIYENCDGTEYESTAN 292

Query: 302 MFDLRYVPEGMTFDDDPRDECEALPKNYKPLNFATDALQHSNVKLTWDETPADRVEIAKR 361
           MFDLRYVP+GM FDD+PRD+C +LPKNYKP  F+TDALQHSNVKLTWDETPA+RVE+AKR
Sbjct: 293 MFDLRYVPDGMDFDDEPRDQCSSLPKNYKPHQFSTDALQHSNVKLTWDETPAERVEVAKR 352

Query: 362 AFSQKEIDDMDFKAYLASDSEDSDAKVDETMKNRLKALVGGTLK-ASRPK-GGAXXXXXX 419
           AF+QKEI+DMDFKAYLASDS+ S+ +V++  KN+LK+LVG +L+  ++P  G        
Sbjct: 353 AFTQKEIEDMDFKAYLASDSDGSEDEVNQDAKNKLKSLVGDSLRIGNQPIFGSKDTLEGE 412

Query: 420 XXXXXXXITFTPGL 433
                  ITF PGL
Sbjct: 413 DEEVDMEITFDPGL 426

 Score =  119 bits (297), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 61/114 (53%), Positives = 75/114 (65%), Gaps = 2/114 (1%)

Query: 519 DSKSTLNKKMHFNMNEIMRXXXXXXXXXXFQDKNRIVEDEFKPDLSDDRFKEVFEDHDFA 578
           D+++ +NKK HFNM EI+R          +QDK RIVED FKPDL+D RFKEVFEDHDFA
Sbjct: 509 DTETGINKKAHFNMKEILRSEKEKSKKGKYQDKRRIVEDNFKPDLNDPRFKEVFEDHDFA 568

Query: 579 IDPSRPEFKETPAMQKILQEXXXXXXXXXXXXXXAEQSTD--TSDKTDISQIVS 630
           IDPSRPEFKETPAM++IL+E              +    D   ++ +DIS IVS
Sbjct: 569 IDPSRPEFKETPAMKEILKERSKRSSKNAQKKKRSHSLMDNQANETSDISNIVS 622

>Suva_2.538 Chr2 complement(960917..962806) [1890 bp, 629 aa] {ON}
           YDR365C (REAL)
          Length = 629

 Score =  425 bits (1092), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 225/432 (52%), Positives = 265/432 (61%), Gaps = 19/432 (4%)

Query: 3   DKMSSDPRFSGVYNDPKFRSTKEKKLKVKLDSRFSXXXXXXXXXXXXXXYGRKIKNGDAN 62
           +K S D RF+G+YNDPKF++T+ +  K+KLDSRFS              YGRKIK+    
Sbjct: 7   EKESVDARFAGIYNDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKDA--- 63

Query: 63  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRARGEVPDDYVXXXXXXXXXXXXXX 122
                                              RARGEVP+DYV              
Sbjct: 64  ---HNTKELEDFDKYFEKEAENEEDTEADVKATVDRARGEVPNDYVSSGDEFTSSDSESS 120

Query: 123 XXXXXXXXXXXXXXXXXXXANSGKPESGDPSKTLAVVNLDWDHVKSVDLMITFTGFIPKG 182
                              A   KPESGD SKTLAVVNLDWDHVKS DLMITF+GF+PKG
Sbjct: 121 GESEIESEEESEVE-----AEDAKPESGDASKTLAVVNLDWDHVKSEDLMITFSGFVPKG 175

Query: 183 GKIERICIYPSEFGKERLNREEKEGPPKELFHXXXXXXXXXXXXXXXXXXXXXXXXXXXX 242
           GKIERI +YPSEFGKER+ REE EGPPKELF                             
Sbjct: 176 GKIERISVYPSEFGKERMQREEIEGPPKELFQRKKQVKASKKENADDSDSDIDIGIKD-- 233

Query: 243 XXXLYEEGDAEKDIDSKALRQYQLERLRYFYAVVYCNNVETAKAIYDNCDATEYESTANM 302
              LYEEGDA+KD+DS+ALRQYQL+RLRY+YA+V C+++ TA+AIY+NCD TEYESTANM
Sbjct: 234 ---LYEEGDADKDVDSRALRQYQLDRLRYYYAIVDCSDISTARAIYENCDGTEYESTANM 290

Query: 303 FDLRYVPEGMTFDDDPRDECEALPKNYKPLNFATDALQHSNVKLTWDETPADRVEIAKRA 362
           FDLRYVP+GMTFDD  RD C  LPKNY+P  F+TDALQHSNVKLTWDETPADRVE+AKRA
Sbjct: 291 FDLRYVPDGMTFDDTARDACSTLPKNYRPHQFSTDALQHSNVKLTWDETPADRVEVAKRA 350

Query: 363 FSQKEIDDMDFKAYLASDSEDSDAKVDETMKNRLKALVGGTLKASRPKGGAXXXXXXXXX 422
           F+QKEIDDMDFKAYLASDS++SD +V+E  K++LK+LVGG    S+ +            
Sbjct: 351 FTQKEIDDMDFKAYLASDSDESDEEVNEDAKSKLKSLVGGLGFNSKKENA---NDGDEEE 407

Query: 423 XXXXITFTPGLD 434
               ITFTP L+
Sbjct: 408 VDMEITFTPALE 419

 Score =  104 bits (259), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 59/80 (73%)

Query: 519 DSKSTLNKKMHFNMNEIMRXXXXXXXXXXFQDKNRIVEDEFKPDLSDDRFKEVFEDHDFA 578
           +++S++N K HFNMNEI+R          +Q K RIVED F PDL D RFKEVFEDHDFA
Sbjct: 502 EAESSINSKAHFNMNEILRSEKEKHKKSRYQKKERIVEDNFTPDLEDPRFKEVFEDHDFA 561

Query: 579 IDPSRPEFKETPAMQKILQE 598
           IDP++PE+K T AM KIL+E
Sbjct: 562 IDPTQPEYKGTQAMNKILKE 581

>NDAI0B05640 Chr2 complement(1377917..1379926) [2010 bp, 669 aa]
           {ON} Anc_5.430 YDR365C
          Length = 669

 Score =  420 bits (1079), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 225/452 (49%), Positives = 262/452 (57%), Gaps = 28/452 (6%)

Query: 3   DKMSSDPRFSGVYNDPKFRSTKEKKLKVKLDSRFSXXXXXXXXXXXXXXYGRKIKNGDAN 62
           +K S+DPRF+ +YNDPKFR TK K LK+KLD RFS              YGRK+ +   N
Sbjct: 8   NKESTDPRFAKIYNDPKFRKTKNKDLKIKLDDRFSKKDLEIRRKSKVDKYGRKLADSKGN 67

Query: 63  XXXXX------------------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRARGEVP 104
                                                                RARG+VP
Sbjct: 68  EKEMNDFDKYFEKDDEKKESEEIATEKSVSVEEKEDEEEERKETELEDDTNIDRARGDVP 127

Query: 105 DDYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXANSGKPESGDPSKTLAVVNLDWD 164
            DYV                                   + +PESG+PSKTLAVVNLDWD
Sbjct: 128 ADYVSSSDEYTSSESEASDEEELDSDVESGEE-----VTTQEPESGEPSKTLAVVNLDWD 182

Query: 165 HVKSVDLMITFTGFIPKGGKIERICIYPSEFGKERLNREEKEGPPKELFHXXXXXXXXXX 224
           HVKS DLMITF+ F+P+GG+IE I IYPSEFGKER+ RE+ EGPPKELF           
Sbjct: 183 HVKSSDLMITFSSFLPEGGRIENIAIYPSEFGKERMQREDVEGPPKELFQKRKKKTSKSK 242

Query: 225 XXXXXXXXXXXXXXXXXXXXXLYEEGDAEKDIDSKALRQYQLERLRYFYAVVYCNNVETA 284
                                LYEEGDA+KD+D+KALRQYQLERLRY+YAVVYCNN+ETA
Sbjct: 243 KISDEANDSDVSDVDIKD---LYEEGDADKDVDTKALRQYQLERLRYYYAVVYCNNIETA 299

Query: 285 KAIYDNCDATEYESTANMFDLRYVPEGMTFDDDPRDECEALPKNYKPLNFATDALQHSNV 344
            AIY NCD TEYESTANMFDLRYVP+GM F D+PRD+C++LPKNYKP  F+TDALQHSNV
Sbjct: 300 TAIYQNCDGTEYESTANMFDLRYVPDGMDFTDEPRDQCDSLPKNYKPHQFSTDALQHSNV 359

Query: 345 KLTWDETPADRVEIAKRAFSQKEIDDMDFKAYLASDSEDSDAKVDETMKNRLKALVGGTL 404
           KLTWDETP +R E+AKRAF+QKEIDDMDFKAYLASDS+ S+ +++E  KN+LKALVGG  
Sbjct: 360 KLTWDETPVERQEVAKRAFTQKEIDDMDFKAYLASDSDGSEDELNEDAKNKLKALVGGGG 419

Query: 405 KASRP--KGGAXXXXXXXXXXXXXITFTPGLD 434
             SR    G               ITF P LD
Sbjct: 420 FGSREIFGGKGAKAGEDEDEVDMEITFNPALD 451

 Score =  114 bits (286), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 53/77 (68%), Positives = 63/77 (81%)

Query: 522 STLNKKMHFNMNEIMRXXXXXXXXXXFQDKNRIVEDEFKPDLSDDRFKEVFEDHDFAIDP 581
           ST+N K HFNMNEI+R          +Q+K++IVEDEFKPDL+D RFKEVFEDHDFAIDP
Sbjct: 539 STINNKAHFNMNEILRSEKEKGKRGKYQNKDKIVEDEFKPDLNDPRFKEVFEDHDFAIDP 598

Query: 582 SRPEFKETPAMQKILQE 598
           SRPEFKET AM++IL+E
Sbjct: 599 SRPEFKETKAMKEILKE 615

>ZYRO0F09944g Chr6 complement(807207..809042) [1836 bp, 611 aa] {ON}
           similar to uniprot|Q06344 YDR365C Saccharomyces
           cerevisiae ESF1 Nucleolar protein involved in pre-rRNA
           processing
          Length = 611

 Score =  409 bits (1051), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 219/435 (50%), Positives = 265/435 (60%), Gaps = 36/435 (8%)

Query: 4   KMSSDPRFSGVYNDPKFRSTKEKKLKVKLDSRFSXXXXXXXXXXXXXXYGRKI--KNGDA 61
           K SSDPRF+G+ NDPKFR+ K+K LKVKLD RFS              YGR+I  ++ D 
Sbjct: 8   KGSSDPRFAGIQNDPKFRNFKKKGLKVKLDDRFSKKDLDVRRKAKVDKYGRRITGESKDL 67

Query: 62  NXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRARGEVPDDYVXXXXXXXXXXXXX 121
                                               RARGE+P+ Y              
Sbjct: 68  KDFDKYFEKEGKEGKEDESSSSSEDEEEETESKVVDRARGELPEAYTSSESEDSESDLSE 127

Query: 122 XXXXXXXXXXXXXXXXXXXXANSGKPESGDPSKTLAVVNLDWDHVKSVDLMITFTGFIPK 181
                                   KPESGDPSKTLAVVNLDWDHV++ DLMITF+ F+P 
Sbjct: 128 EESEADVAEA----------VEEAKPESGDPSKTLAVVNLDWDHVRAADLMITFSSFLPS 177

Query: 182 GGKIERICIYPSEFGKERLNREEKEGPPKELFHXXXXXXXXXXXXXXXXXXXXXXXXXXX 241
           GGKIE+ICIYPSEFGKER+ REEKEGPP+E+F+                           
Sbjct: 178 GGKIEKICIYPSEFGKERMQREEKEGPPREIFNKKKKHHDEDSDSDVDIRD--------- 228

Query: 242 XXXXLYEEGDAEKDIDSKALRQYQLERLRYFYAVVYCNNVETAKAIYDNCDATEYESTAN 301
               LYEEGDA+K++D+ ALRQYQLERLRY+YA+VYCNNVET ++IY NCD TEYESTAN
Sbjct: 229 ----LYEEGDADKEVDNAALRQYQLERLRYYYAIVYCNNVETGESIYSNCDGTEYESTAN 284

Query: 302 MFDLRYVPEGMTFDDDPRDECEALPKNYKPLNFATDALQHSNVKLTWDETPADRVEIAKR 361
           +FDLRYVPEGM FDD+P+DEC+ LPKNYKPL F+TDALQHSNVKLTWDETP DR+E++KR
Sbjct: 285 IFDLRYVPEGMEFDDEPKDECKELPKNYKPLEFSTDALQHSNVKLTWDETPTDRLEVSKR 344

Query: 362 AFSQKEIDDMDFKAYLASDSEDSDA--KVDETMKNRLKALVGGTLKASRPKGGAXXXXXX 419
           AFSQKE++DMDF+AYLAS +++SD     +E  KN+LK+LVG +L   + +         
Sbjct: 345 AFSQKELEDMDFQAYLASGTDESDGEENNNEEAKNKLKSLVGQSLAYGKQQ--------- 395

Query: 420 XXXXXXXITFTPGLD 434
                  ITFTPGLD
Sbjct: 396 EEEPDMEITFTPGLD 410

 Score = 92.0 bits (227), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 55/111 (49%), Positives = 71/111 (63%), Gaps = 2/111 (1%)

Query: 519 DSKSTLNKKMHFNMNEIMRXXXXXXXXXXFQDKNRIVEDEFKPDLSDDRFKEVFEDHDFA 578
           D++ +LNKK HFNMNEI++          +QDK +I+EDEFKPDL+D RF EVFE+ DFA
Sbjct: 489 DTEKSLNKKAHFNMNEILKSEKEKKKKGKYQDKGKIMEDEFKPDLNDPRFNEVFENQDFA 548

Query: 579 IDPSRPEFKETPAMQKILQEXXXXXXXXXXXXXXAEQSTDTSDKTDISQIV 629
           IDPS+PE+K T AM++IL+E                 S D  +K DIS IV
Sbjct: 549 IDPSQPEYKSTKAMKEILEERSKRAHKKRKPLADDGDSKD--NKHDISNIV 597

>KLLA0E21165g Chr5 (1890314..1892197) [1884 bp, 627 aa] {ON} similar
           to uniprot|Q06344 YDR365C Saccharomyces cerevisiae ESF1
           Nucleolar protein involved in pre-rRNA processing
          Length = 627

 Score =  405 bits (1040), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 216/438 (49%), Positives = 258/438 (58%), Gaps = 27/438 (6%)

Query: 3   DKMSSDPRFSGVYNDPKFRSTKEKKLKVKLDSRFSXXXXXXXXXXXXXXYGRKIKNGDAN 62
           +K++ DPRFSG++NDPKFRSTK K  K+KLD RFS              YGRKI + + +
Sbjct: 9   EKITEDPRFSGIHNDPKFRSTKSKNFKIKLDDRFSKQDLEVRRKAKVDKYGRKIVDANKD 68

Query: 63  XX------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRARGEVPDDYVXXXXXXXX 116
                                                    RARGE P DYV        
Sbjct: 69  VKDFDRYFTKEKPEDKEDESNSSESSDDQEAEAAVHAKSVDRARGEPPADYVSSSDEESS 128

Query: 117 XXXXXXXXXXXXXXXXXXXXXXXXXANSGKPESGDPSKTLAVVNLDWDHVKSVDLMITFT 176
                                        KP SG+ + TLAVVNLDWDHVKS DL +TF 
Sbjct: 129 SESEEESGDSDIESEEIE-------LEESKPASGNATNTLAVVNLDWDHVKSADLFVTFK 181

Query: 177 GFIPKGGKIERICIYPSEFGKERLNREEKEGPPKELFHXXXXXXXXXXXXXXXXXXXXXX 236
            F+PKGG+I++I IYPSEFGKER+ REE EGPPKELF                       
Sbjct: 182 SFVPKGGEIQKIAIYPSEFGKERMQREEIEGPPKELFQSKKSKKNDKDDDEINVES---- 237

Query: 237 XXXXXXXXXLYEEGDAEKDIDSKALRQYQLERLRYFYAVVYCNNVETAKAIYDNCDATEY 296
                    +YEEGDAE D DSKALR+YQLERLRY+YAVVYC+++ TA++IY NCD TEY
Sbjct: 238 ---------IYEEGDAE-DYDSKALRRYQLERLRYYYAVVYCSDIRTAESIYQNCDGTEY 287

Query: 297 ESTANMFDLRYVPEGMTFDDDPRDECEALPKNYKPLNFATDALQHSNVKLTWDETPADRV 356
           ESTAN+FDLRYVP+GM  DDDPRDEC +LPKNYKP  F+TDALQHS VKLTWDETPADRV
Sbjct: 288 ESTANVFDLRYVPDGMEMDDDPRDECTSLPKNYKPAQFSTDALQHSKVKLTWDETPADRV 347

Query: 357 EIAKRAFSQKEIDDMDFKAYLASDSEDSDAKVDETMKNRLKALVGGTLKASRPKGGAXXX 416
           EI+KRAF+QKEI++MDFKAYLASDSE+S+ + D+ +KN+LKALV  ++K  +        
Sbjct: 348 EISKRAFTQKEIEEMDFKAYLASDSEESEVEHDDQVKNKLKALVMDSVKVGQKSLFDQKE 407

Query: 417 XXXXXXXXXXITFTPGLD 434
                     ITFTPGLD
Sbjct: 408 DEDDNEADMEITFTPGLD 425

 Score =  107 bits (267), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 72/110 (65%)

Query: 519 DSKSTLNKKMHFNMNEIMRXXXXXXXXXXFQDKNRIVEDEFKPDLSDDRFKEVFEDHDFA 578
           + +ST+N K HFNMNEI++          +Q+K +IV+DEF PD++D RFKEVFEDHDFA
Sbjct: 502 EGESTINNKAHFNMNEILKSEKEKSKKAKYQNKEKIVDDEFTPDVNDPRFKEVFEDHDFA 561

Query: 579 IDPSRPEFKETPAMQKILQEXXXXXXXXXXXXXXAEQSTDTSDKTDISQI 628
           IDP++PEFK+TPAM+KIL+E                +  +T    DI++I
Sbjct: 562 IDPTQPEFKKTPAMEKILKERTVRSSKKSRGKKRNHEIANTEHSKDINKI 611

>TPHA0H01780 Chr8 complement(409713..411581) [1869 bp, 622 aa] {ON}
           Anc_5.430 YDR365C
          Length = 622

 Score =  398 bits (1023), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 217/433 (50%), Positives = 258/433 (59%), Gaps = 22/433 (5%)

Query: 2   SDK-MSSDPRFSGVYNDPKFRSTKEKKLKVKLDSRFSXXXXXXXXXXXXXXYGRKIKNGD 60
           SDK +++D RFSGV+NDPKF++ ++K LK+KLDSRFS              YGRKI N +
Sbjct: 3   SDKPVNTDERFSGVFNDPKFKNARKKNLKIKLDSRFSKSDLEVNRKARVDKYGRKISNLN 62

Query: 61  ANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRARGEVPDDYVXXXXXXXXXXXX 120
                                                RARGEVP DY             
Sbjct: 63  --------NQEAKDFDKYFEKEEDGKGEEIAVKPLIDRARGEVPSDY-----QSSLDDYT 109

Query: 121 XXXXXXXXXXXXXXXXXXXXXANSGKPESGDPSKTLAVVNLDWDHVKSVDLMITFTGFIP 180
                                    KPESGD SKT+AVVNLDWDHVK+ DL++TF+ F+P
Sbjct: 110 SSESEDSEDEDLESEGESEAEIEETKPESGDSSKTIAVVNLDWDHVKATDLLVTFSSFVP 169

Query: 181 KGGKIERICIYPSEFGKERLNREEKEGPPKELFHXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           KGGKIERI I+PSEFGK+R+ REE EGPPKELF                           
Sbjct: 170 KGGKIERIAIFPSEFGKQRMEREELEGPPKELFQKKKKKNSKKSNAEFNDDSDVDIND-- 227

Query: 241 XXXXXLYEEGDAEKDIDSKALRQYQLERLRYFYAVVYCNNVETAKAIYDNCDATEYESTA 300
                LYEEGD +K++DSK+LRQYQL+RLRY+YAVV+CNN+ TA+AIY+NCD TEYESTA
Sbjct: 228 -----LYEEGDVDKEVDSKSLRQYQLDRLRYYYAVVFCNNISTAEAIYNNCDGTEYESTA 282

Query: 301 NMFDLRYVPEGMTFDDDPRDECEALPKNYKPLNFATDALQHSNVKLTWDETPADRVEIAK 360
           N+FDLRYVP+GM F+D P DEC  LPKNY PLNF TDALQHSNVKLTWDETPADRVEIAK
Sbjct: 283 NVFDLRYVPDGMDFEDQPYDECTELPKNYTPLNFTTDALQHSNVKLTWDETPADRVEIAK 342

Query: 361 RAFSQKEIDDMDFKAYLASDSEDSDAKVDETMKNRLKALVGGTLKASRPKGGAXXXXXXX 420
           RAF+QKEID+MDFKAYLAS   +     +E +KN+LK+LVG ++K               
Sbjct: 343 RAFTQKEIDEMDFKAYLAS-DSEESEGENEEVKNKLKSLVGLSMKIGDKSIMDNKSDNED 401

Query: 421 XXXXXXITFTPGL 433
                 ITFTPGL
Sbjct: 402 GEVDMEITFTPGL 414

 Score = 97.8 bits (242), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 46/77 (59%), Positives = 58/77 (75%)

Query: 522 STLNKKMHFNMNEIMRXXXXXXXXXXFQDKNRIVEDEFKPDLSDDRFKEVFEDHDFAIDP 581
           ST+NKK HFNM EI+R          FQ+K +IVED FK DL+D RF E+FEDHDFAIDP
Sbjct: 502 STINKKAHFNMKEILRSEKEKTKKSKFQNKEKIVEDNFKADLNDPRFNEMFEDHDFAIDP 561

Query: 582 SRPEFKETPAMQKILQE 598
           ++ E+KET AM++IL+E
Sbjct: 562 TQSEYKETAAMKEILKE 578

>Kwal_55.21444 s55 (839767..841701) [1935 bp, 644 aa] {ON} YDR365C -
           Protein required for cell viability [contig 130] FULL
          Length = 644

 Score =  392 bits (1006), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 215/447 (48%), Positives = 253/447 (56%), Gaps = 36/447 (8%)

Query: 6   SSDPRFSGVYNDPKFRSTKEKKLKVKLDSRFSXXXXXXXXXXXXXXYGRKIKNGDANXXX 65
           SSDPRF+ V++DPKFR TK KK K+KLD RFS              YGR +K G  N   
Sbjct: 12  SSDPRFANVHSDPKFRETKAKKFKIKLDDRFSKKDLQFKRKARVDKYGRSLK-GQENKDK 70

Query: 66  X-------------------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRARGEVPDD 106
                                                              RARGEVP D
Sbjct: 71  KDFDKYYEKDDKKKEDKVKPDDEEKSDSEAESANEAKDIGDSAAVKPVSLDRARGEVPSD 130

Query: 107 YVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXANSGKPESGDPSKTLAVVNLDWDHV 166
           YV                                     KP+SGD SKTLAVVNLDWDHV
Sbjct: 131 YVSSSEDESSSESEAGSEDSDIESEESEVE-----IEDTKPQSGDSSKTLAVVNLDWDHV 185

Query: 167 KSVDLMITFTGFIPKGGKIERICIYPSEFGKERLNREEKEGPPKELFHXXXXXXXXXXXX 226
           KS DLMITF+ F+P GGKI +I +YPSEFGKERL REE EGPP+E+F             
Sbjct: 186 KSTDLMITFSSFVPSGGKIIKIAVYPSEFGKERLKREEMEGPPREIFKSKNSKKKSHDDD 245

Query: 227 XXXXXXXXXXXXXXXXXXXLYEEGDAEKDIDSKALRQYQLERLRYFYAVVYCNNVETAKA 286
                              LYEEGDAE D D+K+LR+YQL+RLRYFYAVVYCNNV TA+A
Sbjct: 246 SDSDVDVRD----------LYEEGDAE-DYDAKSLRRYQLDRLRYFYAVVYCNNVATAEA 294

Query: 287 IYDNCDATEYESTANMFDLRYVPEGMTFDDDPRDECEALPKNYKPLNFATDALQHSNVKL 346
           IY NCD TE+ESTANMFDLRYVP+GMTFDD+ RDEC ++PKNY+P  F+TDALQHS VKL
Sbjct: 295 IYKNCDGTEFESTANMFDLRYVPDGMTFDDEARDECTSIPKNYQPSQFSTDALQHSKVKL 354

Query: 347 TWDETPADRVEIAKRAFSQKEIDDMDFKAYLASDSEDSDAKVDETMKNRLKALVGGTLKA 406
           TWDETPADRV ++KRAF+QKEI+DMDFKAYLASDSE+S+ + ++ +K +LK+LV  ++K 
Sbjct: 355 TWDETPADRVAMSKRAFTQKEIEDMDFKAYLASDSEESEPENNQDLKTKLKSLVSQSVKV 414

Query: 407 SRPKGGAXXXXXXXXXXXXXITFTPGL 433
                               ITF PGL
Sbjct: 415 GDKSIFDQAPEEGESDVDMQITFAPGL 441

 Score =  108 bits (271), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 62/80 (77%)

Query: 519 DSKSTLNKKMHFNMNEIMRXXXXXXXXXXFQDKNRIVEDEFKPDLSDDRFKEVFEDHDFA 578
           +S S LNKK HFNMNEI+R          +Q+K++IVEDEFKPDL+D RF EVFED DFA
Sbjct: 522 NSSSKLNKKAHFNMNEIVRSEKEKGKKSRYQNKDKIVEDEFKPDLNDPRFAEVFEDRDFA 581

Query: 579 IDPSRPEFKETPAMQKILQE 598
           IDPS+PEFK T AM++ILQE
Sbjct: 582 IDPSQPEFKGTAAMKQILQE 601

>AER259W Chr5 (1113896..1115755) [1860 bp, 619 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR365C (ESF1)
          Length = 619

 Score =  390 bits (1003), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 215/431 (49%), Positives = 252/431 (58%), Gaps = 24/431 (5%)

Query: 4   KMSSDPRFSGVYNDPKFRSTKEKKLKVKLDSRFSXXXXXXXXXXXXXXYGRKIKNGDANX 63
           K S D RF+ + +DPKFR+ K+K LK+KLD RFS              YGR+I       
Sbjct: 10  KDSIDKRFARIESDPKFRAPKQKNLKIKLDDRFSKQDLEYKRKAKVDKYGRRIGTAPGKE 69

Query: 64  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRARGEVPDDYVXXXXXXXXXXXXXXX 123
                                             RARGEVP DYV               
Sbjct: 70  EKDFEKYFTKESSESAAEESDKEDSSVAKLD---RARGEVPADYVSSSDEESSSESEADS 126

Query: 124 XXXXXXXXXXXXXXXXXXANSGKPESGDPSKTLAVVNLDWDHVKSVDLMITFTGFIPKGG 183
                                 KPESGDPSK LAVVNLDWDHVK  DL++ F  F+P+GG
Sbjct: 127 DDATAESDEEVE------IEEEKPESGDPSKVLAVVNLDWDHVKCADLLVAFNSFVPEGG 180

Query: 184 KIERICIYPSEFGKERLNREEKEGPPKELFHXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 243
           KIER+ IYPSEFGKER+ REE EGPP+E+F                              
Sbjct: 181 KIERVAIYPSEFGKERMQREEVEGPPREVFKSKKDKKAKQDDDDEIGLKD---------- 230

Query: 244 XXLYEEGDAEKDIDSKALRQYQLERLRYFYAVVYCNNVETAKAIYDNCDATEYESTANMF 303
             LYE+GDAEKD DSKALR+YQLERLRY+YAVVYCNNV TA+AIY NCD TEYESTANMF
Sbjct: 231 --LYEQGDAEKDYDSKALRRYQLERLRYYYAVVYCNNVATAEAIYQNCDGTEYESTANMF 288

Query: 304 DLRYVPEGMTFDDDPRDECEALPKNYKPLNFATDALQHSNVKLTWDETPADRVEIAKRAF 363
           DLRYVPEG+TFDD+PR+EC ++PK+YKP+ F+T ALQH  VKLTWDETPADRVE+AKRAF
Sbjct: 289 DLRYVPEGVTFDDEPREECASVPKDYKPVQFSTSALQHLQVKLTWDETPADRVEMAKRAF 348

Query: 364 SQKEIDDMDFKAYLASDSEDSDAKVDETMKNRLKALVGGTLKASRPKGGAXXXXXXXXXX 423
           SQKEI+DMDFKAYLASDSE+S+A  +   KN+L++LV     A +P              
Sbjct: 349 SQKEIEDMDFKAYLASDSEESEADDNSEAKNKLRSLVSSVKVADKP---LFADESDEEEA 405

Query: 424 XXXITFTPGLD 434
              ITFTPGL+
Sbjct: 406 DVQITFTPGLE 416

 Score = 94.7 bits (234), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 47/80 (58%), Positives = 61/80 (76%)

Query: 519 DSKSTLNKKMHFNMNEIMRXXXXXXXXXXFQDKNRIVEDEFKPDLSDDRFKEVFEDHDFA 578
           ++  ++N   HFNMN+I+R          +Q K++IVED+FKPDL+D RFKEVFED DFA
Sbjct: 495 ENSQSINSSAHFNMNDILRSEKERGKKSKYQKKDKIVEDDFKPDLNDPRFKEVFEDRDFA 554

Query: 579 IDPSRPEFKETPAMQKILQE 598
           IDPS+PEFKET AM++ILQE
Sbjct: 555 IDPSQPEFKETAAMKQILQE 574

>KLTH0F16148g Chr6 (1310041..1311981) [1941 bp, 646 aa] {ON} similar
           to uniprot|Q06344 YDR365C Saccharomyces cerevisiae ESF1
           Nucleolar protein involved in pre-rRNA processing
          Length = 646

 Score =  387 bits (994), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 207/444 (46%), Positives = 252/444 (56%), Gaps = 32/444 (7%)

Query: 6   SSDPRFSGVYNDPKFRSTKEKKLKVKLDSRFSXXXXXXXXXXXXXXYGRKIKNGDANXXX 65
           SSDPRF+GV NDPKFR T+ KK K+KLD RFS              YGR++K  ++    
Sbjct: 12  SSDPRFAGVENDPKFRETRAKKFKIKLDDRFSKKDLEFKRKARVDKYGRRLKGQESKDKR 71

Query: 66  X----------------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRARGEVPDDYVX 109
                                                           RARGEV  DYV 
Sbjct: 72  DFDKYYEKEKSGKTAPDSELVGKPSEEDSEGGSSDEEGAASAKTVSLDRARGEVHSDYVS 131

Query: 110 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXANSGKPESGDPSKTLAVVNLDWDHVKSV 169
                                              G+ +SGD SKTLAVVNLDWDHVKS 
Sbjct: 132 SSDEESSSESEEDSADSDLESEESEVQ-----IEEGEVKSGDSSKTLAVVNLDWDHVKST 186

Query: 170 DLMITFTGFIPKGGKIERICIYPSEFGKERLNREEKEGPPKELFHXXXXXXXXXXXXXXX 229
           DLM+TF+ F+PKGGKI R+ IYPSEFGKERL +EE EGPP+E+F                
Sbjct: 187 DLMVTFSSFVPKGGKINRVAIYPSEFGKERLAKEETEGPPREIFKSKEKGKKSHGDDSDE 246

Query: 230 XXXXXXXXXXXXXXXXLYEEGDAEKDIDSKALRQYQLERLRYFYAVVYCNNVETAKAIYD 289
                           LYEEGDA+ D D+K+LR+YQLERLRY+YAVVYCNN +TA++IY 
Sbjct: 247 ELTVKD----------LYEEGDAD-DFDAKSLRRYQLERLRYYYAVVYCNNKQTAESIYK 295

Query: 290 NCDATEYESTANMFDLRYVPEGMTFDDDPRDECEALPKNYKPLNFATDALQHSNVKLTWD 349
           NCD TEYESTANMFDLRYVP+GM FDD+ RDEC+++PKNY+P  F+TDALQHS VK TWD
Sbjct: 296 NCDGTEYESTANMFDLRYVPDGMDFDDEARDECDSVPKNYRPSEFSTDALQHSKVKFTWD 355

Query: 350 ETPADRVEIAKRAFSQKEIDDMDFKAYLASDSEDSDAKVDETMKNRLKALVGGTLKASRP 409
           ETPADR  +AKRAF+Q+EI+DMDFKAYLASDSEDS+ + ++ +KN+LK+LV  +++    
Sbjct: 356 ETPADRTAMAKRAFTQREIEDMDFKAYLASDSEDSEPENNQELKNKLKSLVNQSVQVGEK 415

Query: 410 KGGAXXXXXXXXXXXXXITFTPGL 433
                            ITF P L
Sbjct: 416 SIFDQDPKDGESDVDMQITFAPAL 439

 Score =  118 bits (296), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 63/80 (78%)

Query: 519 DSKSTLNKKMHFNMNEIMRXXXXXXXXXXFQDKNRIVEDEFKPDLSDDRFKEVFEDHDFA 578
           ++ S LNKK HFNMNEI+R          FQDKNRIVEDEFKPDL+D RF EVFEDHDFA
Sbjct: 521 EANSKLNKKAHFNMNEIVRSEKEKGKKAKFQDKNRIVEDEFKPDLNDPRFSEVFEDHDFA 580

Query: 579 IDPSRPEFKETPAMQKILQE 598
           IDPS+PEFK T AM++ILQE
Sbjct: 581 IDPSQPEFKGTAAMKQILQE 600

>Ecym_4790 Chr4 complement(1534067..1535959) [1893 bp, 630 aa] {ON}
           similar to Ashbya gossypii AER259W + AER260C
          Length = 630

 Score =  379 bits (973), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 202/433 (46%), Positives = 249/433 (57%), Gaps = 19/433 (4%)

Query: 3   DKMSSDPRFSGVYNDPKFRSTKEKKLKVKLDSRFSXXXXXXXXXXXXXXYGRKIKNGDAN 62
           D +++D RF+G++NDPKFR  K  KLK+ LD RFS              YGR+I + D  
Sbjct: 9   DPVTNDSRFAGIHNDPKFRKPKVNKLKITLDDRFSKKDLEFKRKAKVDKYGRRIGSYDEK 68

Query: 63  XXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXRARGEVPDDYVXXXXXXXXXXXXX 121
                                               RARGEVP DY              
Sbjct: 69  EAKDFDRYFSKNESVEKIQSDDEEGETEDIAVSALDRARGEVPLDYESSSDENSSSESEE 128

Query: 122 XXXXXXXXXXXXXXXXXXXXANSGKPESGDPSKTLAVVNLDWDHVKSVDLMITFTGFIPK 181
                                   KPE+GDP+K  AVVNLDWDHV+SVDL+ TF  F+P 
Sbjct: 129 ESEDSALDPDSELE------IEESKPETGDPTKVFAVVNLDWDHVRSVDLLATFNSFVPN 182

Query: 182 GGKIERICIYPSEFGKERLNREEKEGPPKELFHXXXXXXXXXXXXXXXXXXXXXXXXXXX 241
           GG I+++ IYPSEFGKER+ REE EGPP+ELF                            
Sbjct: 183 GGSIKKVAIYPSEFGKERMKREEVEGPPRELF----------KRKQSKKEKDSDDENSDI 232

Query: 242 XXXXLYEEGDAEKDIDSKALRQYQLERLRYFYAVVYCNNVETAKAIYDNCDATEYESTAN 301
               LYE  DAEKD DSKALR+YQL+RLRY+YAVVYC++V TAKAIY NCD TE+ESTAN
Sbjct: 233 DINDLYEVDDAEKDYDSKALRRYQLDRLRYYYAVVYCSDVLTAKAIYQNCDGTEFESTAN 292

Query: 302 MFDLRYVPEGMTFDDDPRDECEALPKNYKPLNFATDALQHSNVKLTWDETPADRVEIAKR 361
           MFDLRYVP+ M F+DDPRD+C ++PK+YKP  F+T ALQHS VKLTWDETPADRVEI+KR
Sbjct: 293 MFDLRYVPDNMKFEDDPRDQCVSVPKDYKPTQFSTSALQHSQVKLTWDETPADRVEISKR 352

Query: 362 AFSQKEIDDMDFKAYLASDSEDSDAKVDETMKNRLKALVGGTLKASRPKGGAXXXXXXXX 421
           AF+QKEI++MDFKAYLASDS+ S+ + +E  KN L++LV  +++ +              
Sbjct: 353 AFNQKEIEEMDFKAYLASDSDSSEGETNEKTKNALRSLVNDSIQVAH--KSVFDKHGSEE 410

Query: 422 XXXXXITFTPGLD 434
                ITFTPGL+
Sbjct: 411 EADVEITFTPGLE 423

 Score =  110 bits (275), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 62/78 (79%)

Query: 521 KSTLNKKMHFNMNEIMRXXXXXXXXXXFQDKNRIVEDEFKPDLSDDRFKEVFEDHDFAID 580
           KSTLN   HFNMNEI++          +Q+KN IV+D FKPDL+D RFKEVFEDHDFAID
Sbjct: 506 KSTLNNNAHFNMNEIIKSQKEKTKKSRYQNKNVIVDDNFKPDLNDPRFKEVFEDHDFAID 565

Query: 581 PSRPEFKETPAMQKILQE 598
           PS+PEFK+TPAM++IL+E
Sbjct: 566 PSQPEFKKTPAMKEILEE 583

>YGR145W Chr7 (781767..783890) [2124 bp, 707 aa] {ON}  ENP2Essential
           nucleolar protein, required for biogenesis of the small
           ribosomal subunit; contains WD repeats, interacts with
           Mpp10p and Bfr2p, and has homology to Spb1p
          Length = 707

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 23/33 (69%)

Query: 563 LSDDRFKEVFEDHDFAIDPSRPEFKETPAMQKI 595
           L+DDRFKE+FED +F +D    +FK+   ++ I
Sbjct: 477 LTDDRFKEMFEDEEFQVDEDDYDFKQLNPVKSI 509

>Smik_6.248 Chr6 (401099..403222) [2124 bp, 707 aa] {ON} YGR145W
           (REAL)
          Length = 707

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 23/33 (69%)

Query: 563 LSDDRFKEVFEDHDFAIDPSRPEFKETPAMQKI 595
           L+DDRFKE+FED +F +D    +FK+   ++ I
Sbjct: 477 LTDDRFKEMFEDEEFQVDEDDYDFKQLNPVKSI 509

>NDAI0D03780 Chr4 complement(895256..897379) [2124 bp, 707 aa] {ON}
           Anc_4.77 YGR145W
          Length = 707

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 20/26 (76%)

Query: 563 LSDDRFKEVFEDHDFAIDPSRPEFKE 588
           L+DDRFKE+FED DF +D    ++K+
Sbjct: 477 LTDDRFKEMFEDEDFQVDEDAYDYKQ 502

>CAGL0E03069g Chr5 complement(286341..288485,288759..288878) [2265
           bp, 754 aa] {ON} highly similar to uniprot|P48234
           Saccharomyces cerevisiae YGR145w ENP2
          Length = 754

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 21/26 (80%)

Query: 563 LSDDRFKEVFEDHDFAIDPSRPEFKE 588
           L+DDRFKE+FED DF +D +  ++K+
Sbjct: 538 LTDDRFKEMFEDEDFKVDENDYDYKQ 563

>TDEL0F02720 Chr6 complement(498279..500363) [2085 bp, 694 aa] {ON}
           Anc_4.77 YGR145W
          Length = 694

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 20/26 (76%)

Query: 563 LSDDRFKEVFEDHDFAIDPSRPEFKE 588
           L+DDRFKE+FED DF +D    ++K+
Sbjct: 477 LTDDRFKEMFEDEDFQVDEDAYDYKQ 502

>Suva_7.435 Chr7 (752189..754315) [2127 bp, 708 aa] {ON} YGR145W
           (REAL)
          Length = 708

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 22/33 (66%)

Query: 563 LSDDRFKEVFEDHDFAIDPSRPEFKETPAMQKI 595
           L+DDRFKE+FED  F +D    +FK+   ++ I
Sbjct: 477 LTDDRFKEMFEDEQFQVDEDDYDFKQLNPVKSI 509

>Kpol_1041.35 s1041 complement(87507..89612) [2106 bp, 701 aa] {ON}
           complement(87507..89612) [2106 nt, 702 aa]
          Length = 701

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 20/26 (76%)

Query: 563 LSDDRFKEVFEDHDFAIDPSRPEFKE 588
           L+DDRFKE+FED DF +D    ++K+
Sbjct: 481 LTDDRFKEMFEDEDFQVDEEDYDYKQ 506

>KLTH0H09130g Chr8 (783260..785347) [2088 bp, 695 aa] {ON} similar
           to uniprot|P48234 Saccharomyces cerevisiae YGR145W ENP2
           Essential nucleolar protein of unknown function contains
           WD repeats interacts with Mpp10p and Bfr2p and has
           homology to Spb1p
          Length = 695

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 20/26 (76%)

Query: 563 LSDDRFKEVFEDHDFAIDPSRPEFKE 588
           L+DDRFKE+FED DF +D    ++K+
Sbjct: 480 LADDRFKEMFEDEDFQVDEDDYDYKQ 505

>Skud_7.467 Chr7 (764555..766681) [2127 bp, 708 aa] {ON} YGR145W
           (REAL)
          Length = 708

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 24/33 (72%)

Query: 563 LSDDRFKEVFEDHDFAIDPSRPEFKETPAMQKI 595
           L+DDRFKE+FE+ +F +D +  +FK+   ++ +
Sbjct: 477 LTDDRFKEMFENEEFQVDETDYDFKQLNPVKSL 509

>KAFR0F03630 Chr6 complement(718854..720935) [2082 bp, 693 aa] {ON}
           Anc_4.77 YGR145W
          Length = 693

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 21/26 (80%)

Query: 563 LSDDRFKEVFEDHDFAIDPSRPEFKE 588
           L+DDRFKE+FED +F +D +  ++K+
Sbjct: 478 LTDDRFKEMFEDEEFQVDENDYDYKQ 503

>NCAS0A01850 Chr1 complement(356138..358243) [2106 bp, 701 aa] {ON}
           Anc_4.77 YGR145W
          Length = 701

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 20/26 (76%)

Query: 563 LSDDRFKEVFEDHDFAIDPSRPEFKE 588
           L+DDRFKE+FED +F +D    ++K+
Sbjct: 477 LTDDRFKEMFEDEEFQVDEDAYDYKQ 502

>KNAG0D03740 Chr4 complement(680549..682639) [2091 bp, 696 aa] {ON}
           Anc_4.77 YGR145W
          Length = 696

 Score = 32.3 bits (72), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 20/26 (76%)

Query: 563 LSDDRFKEVFEDHDFAIDPSRPEFKE 588
           ++DDRFKE+FED DF +D    ++++
Sbjct: 477 VTDDRFKEMFEDEDFQVDEESYDYRQ 502

>TBLA0A08890 Chr1 (2183143..2185239) [2097 bp, 698 aa] {ON} Anc_4.77
           YGR145W
          Length = 698

 Score = 32.3 bits (72), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 19/26 (73%)

Query: 563 LSDDRFKEVFEDHDFAIDPSRPEFKE 588
           L DDRFKE+FED DF I+    ++K+
Sbjct: 477 LQDDRFKEMFEDEDFQINEDDYDYKQ 502

>Ecym_1412 Chr1 (856549..858708) [2160 bp, 719 aa] {ON} similar to
           Ashbya gossypii AFR468W
          Length = 719

 Score = 31.6 bits (70), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 19/26 (73%)

Query: 563 LSDDRFKEVFEDHDFAIDPSRPEFKE 588
           L DDRFKE+FED +F ID    ++K+
Sbjct: 505 LDDDRFKEMFEDENFQIDEDDYDYKQ 530

>Ecym_5607 Chr5 (1229698..1230612) [915 bp, 304 aa] {ON} similar to
           Ashbya gossypii ADR271W
          Length = 304

 Score = 31.2 bits (69), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 48/103 (46%), Gaps = 8/103 (7%)

Query: 306 RYVPEGMTFDDDPRDECEALPKNYKPLNFATDALQHSNVKLTWDETPADRVEIAKRAFSQ 365
           R V +G+T+ D  R+    L K  K  N     +Q +  KL  + TP +R  I       
Sbjct: 81  RNVKKGLTYPDFEREYYAVLNKFIKDCN---GQIQTALKKL--EHTPEERARIK---LVT 132

Query: 366 KEIDDMDFKAYLASDSEDSDAKVDETMKNRLKALVGGTLKASR 408
           KE+D +D K  L     D   + DE +K  +++L   TL+ +R
Sbjct: 133 KELDVVDSKIALMIQEIDVLTRSDEVVKAMVQSLKLQTLRKNR 175

>Kwal_14.2258 s14 (679677..681776) [2100 bp, 699 aa] {ON} YGR145W -
           Protein required for cell viability [contig 227] FULL
          Length = 699

 Score = 31.6 bits (70), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 19/26 (73%)

Query: 563 LSDDRFKEVFEDHDFAIDPSRPEFKE 588
           L+DDRFKE+FED  F +D    ++K+
Sbjct: 480 LTDDRFKEMFEDEAFQVDEQDYDYKQ 505

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.132    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 46,673,417
Number of extensions: 1699635
Number of successful extensions: 3433
Number of sequences better than 10.0: 42
Number of HSP's gapped: 3479
Number of HSP's successfully gapped: 100
Length of query: 642
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 526
Effective length of database: 40,180,143
Effective search space: 21134755218
Effective search space used: 21134755218
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 69 (31.2 bits)