Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0C049305.432ON49640820920.0
NCAS0F033605.432ON50942615150.0
KAFR0E039205.432ON49741215140.0
Skud_15.2825.432ON48540814870.0
YOR119C (RIO1)5.432ON48440814820.0
Suva_8.1725.432ON48640814800.0
Smik_15.2975.432ON48640814580.0
Kpol_1062.315.432ON51342314460.0
SAKL0G02486g5.432ON50041614370.0
KLLA0E21121g5.432ON52642314360.0
NDAI0B056505.432ON46237814170.0
CAGL0L11594g5.432ON50740614200.0
Kwal_55.214335.432ON47640914150.0
KLTH0F16104g5.432ON54040914210.0
TBLA0A037605.432ON50440714000.0
TPHA0E017805.432ON50842113980.0
AER257W5.432ON47740913840.0
TDEL0E019305.432ON50240213790.0
Ecym_47635.432ON53840913181e-178
ZYRO0F09988g5.432ON46040512651e-171
CAGL0H08019g2.44ON4253251232e-06
Kwal_23.45632.44ON4252741053e-04
NCAS0G015802.44ON4243141053e-04
Kpol_400.72.44ON425314970.003
NDAI0F036002.44ON421243930.008
KAFR0A077602.44ON425243920.010
Suva_14.1362.44ON426308920.011
TPHA0H009202.44ON429243920.012
Smik_14.1252.44ON420243910.015
TDEL0A008602.44ON419319900.021
ABL166W2.44ON414244850.087
KLTH0B07722g2.44ON428310830.13
ZYRO0C10340g2.44ON416244820.16
Skud_14.1292.44ON425243820.20
Ecym_11191.104ON79149790.52
KNAG0F010602.44ON428313770.80
SAKL0E13552g2.44ON419243741.7
YNL207W (RIO2)2.44ON425243732.1
TDEL0F047008.346ON72869706.3
NDAI0I002506.371ON897101706.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0C04930
         (496 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0C04930 Chr3 (951832..953322) [1491 bp, 496 aa] {ON} Anc_5.4...   810   0.0  
NCAS0F03360 Chr6 complement(679314..680843) [1530 bp, 509 aa] {O...   588   0.0  
KAFR0E03920 Chr5 complement(775345..776838) [1494 bp, 497 aa] {O...   587   0.0  
Skud_15.282 Chr15 complement(505219..506676) [1458 bp, 485 aa] {...   577   0.0  
YOR119C Chr15 complement(548792..550246) [1455 bp, 484 aa] {ON} ...   575   0.0  
Suva_8.172 Chr8 complement(306553..308013) [1461 bp, 486 aa] {ON...   574   0.0  
Smik_15.297 Chr15 complement(509934..511394) [1461 bp, 486 aa] {...   566   0.0  
Kpol_1062.31 s1062 (67759..69300) [1542 bp, 513 aa] {ON} (67759....   561   0.0  
SAKL0G02486g Chr7 complement(206119..207621) [1503 bp, 500 aa] {...   558   0.0  
KLLA0E21121g Chr5 (1886452..1888032) [1581 bp, 526 aa] {ON} simi...   557   0.0  
NDAI0B05650 Chr2 complement(1380239..1381627) [1389 bp, 462 aa] ...   550   0.0  
CAGL0L11594g Chr12 (1239169..1240692) [1524 bp, 507 aa] {ON} hig...   551   0.0  
Kwal_55.21433 s55 (835062..836492) [1431 bp, 476 aa] {ON} YOR119...   549   0.0  
KLTH0F16104g Chr6 (1306436..1308058) [1623 bp, 540 aa] {ON} simi...   551   0.0  
TBLA0A03760 Chr1 complement(938917..940431) [1515 bp, 504 aa] {O...   543   0.0  
TPHA0E01780 Chr5 (357819..359345) [1527 bp, 508 aa] {ON} Anc_5.4...   543   0.0  
AER257W Chr5 (1110411..1111844) [1434 bp, 477 aa] {ON} Syntenic ...   537   0.0  
TDEL0E01930 Chr5 (363913..365421) [1509 bp, 502 aa] {ON} Anc_5.4...   535   0.0  
Ecym_4763 Chr4 (1483168..1484784) [1617 bp, 538 aa] {ON} similar...   512   e-178
ZYRO0F09988g Chr6 complement(811306..812688) [1383 bp, 460 aa] {...   491   e-171
CAGL0H08019g Chr8 (781773..783050) [1278 bp, 425 aa] {ON} highly...    52   2e-06
Kwal_23.4563 s23 (768125..769402) [1278 bp, 425 aa] {ON} YNL207W...    45   3e-04
NCAS0G01580 Chr7 (281438..282712) [1275 bp, 424 aa] {ON} Anc_2.44      45   3e-04
Kpol_400.7 s400 complement(15841..17118) [1278 bp, 425 aa] {ON} ...    42   0.003
NDAI0F03600 Chr6 complement(860282..861547) [1266 bp, 421 aa] {O...    40   0.008
KAFR0A07760 Chr1 complement(1560351..1561628) [1278 bp, 425 aa] ...    40   0.010
Suva_14.136 Chr14 (250349..251629) [1281 bp, 426 aa] {ON} YNL207...    40   0.011
TPHA0H00920 Chr8 complement(188834..190123) [1290 bp, 429 aa] {O...    40   0.012
Smik_14.125 Chr14 (234660..235922) [1263 bp, 420 aa] {ON} YNL207...    40   0.015
TDEL0A00860 Chr1 (143723..144982) [1260 bp, 419 aa] {ON} Anc_2.4...    39   0.021
ABL166W Chr2 (88546..89790) [1245 bp, 414 aa] {ON} Syntenic homo...    37   0.087
KLTH0B07722g Chr2 complement(625231..626517) [1287 bp, 428 aa] {...    37   0.13 
ZYRO0C10340g Chr3 complement(793323..794573) [1251 bp, 416 aa] {...    36   0.16 
Skud_14.129 Chr14 (244224..245501) [1278 bp, 425 aa] {ON} YNL207...    36   0.20 
Ecym_1119 Chr1 complement(244327..246702) [2376 bp, 791 aa] {ON}...    35   0.52 
KNAG0F01060 Chr6 (188811..190097) [1287 bp, 428 aa] {ON} Anc_2.4...    34   0.80 
SAKL0E13552g Chr5 complement(1118842..1120101) [1260 bp, 419 aa]...    33   1.7  
YNL207W Chr14 (255353..256630) [1278 bp, 425 aa] {ON}  RIO2Essen...    33   2.1  
TDEL0F04700 Chr6 complement(883407..885593) [2187 bp, 728 aa] {O...    32   6.3  
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...    32   6.3  

>KNAG0C04930 Chr3 (951832..953322) [1491 bp, 496 aa] {ON} Anc_5.432
           YOR119C
          Length = 496

 Score =  810 bits (2092), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/408 (96%), Positives = 393/408 (96%)

Query: 1   MSVEEKFEKLSIDHHVKDDTANNKLLDKYAHKIKNDQFSFSKVKKTTKDKANRATVENVL 60
           MSVEEKFEKLSIDHHVKDDTANNKLLDKYAHKIKNDQFSFSKVKKTTKDKANRATVENVL
Sbjct: 1   MSVEEKFEKLSIDHHVKDDTANNKLLDKYAHKIKNDQFSFSKVKKTTKDKANRATVENVL 60

Query: 61  DPRTMRFLQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESLLARLTQ 120
           DPRTMRFLQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESLLARLTQ
Sbjct: 61  DPRTMRFLQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESLLARLTQ 120

Query: 121 EERAVQASVGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKE 180
           EERAVQASVGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKE
Sbjct: 121 EERAVQASVGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKE 180

Query: 181 FRNLKRIYQSGAXXXXXXXXXXXXXXXMEFLNRGDGFASPRLRDYPYKDTDSIRQYYCTL 240
           FRNLKRIYQSGA               MEFLNRGDGFASPRLRDYPYKDTDSIRQYYCTL
Sbjct: 181 FRNLKRIYQSGAVPVPKPVEVKNNVLVMEFLNRGDGFASPRLRDYPYKDTDSIRQYYCTL 240

Query: 241 VAYMRLMYQVCGLVHADLSEYNVLVHNDRLYIIDVSQSVQPEHPMSLDFLRMDIKNVNLY 300
           VAYMRLMYQVCGLVHADLSEYNVLVHNDRLYIIDVSQSVQPEHPMSLDFLRMDIKNVNLY
Sbjct: 241 VAYMRLMYQVCGLVHADLSEYNVLVHNDRLYIIDVSQSVQPEHPMSLDFLRMDIKNVNLY 300

Query: 301 FGKMGIDIFPERIIFQFVISESLDKFEGDYKSSKDLTEYVESNLPVKKTEQDEMEDEVFR 360
           FGKMGIDIFPERIIFQFVISESLDKFEGDYKSSKDLTEYVESNLPVKKTEQDEMEDEVFR
Sbjct: 301 FGKMGIDIFPERIIFQFVISESLDKFEGDYKSSKDLTEYVESNLPVKKTEQDEMEDEVFR 360

Query: 361 SLYLVRNLEGLEERDFDRFTEGKFDLLKSLLAHDMEKNFTAAEQQFEF 408
           SLYLVRNLEGLEERDFDRFTEGKFDLLKSLLAHDMEKNFTAAEQQFEF
Sbjct: 361 SLYLVRNLEGLEERDFDRFTEGKFDLLKSLLAHDMEKNFTAAEQQFEF 408

>NCAS0F03360 Chr6 complement(679314..680843) [1530 bp, 509 aa] {ON}
           Anc_5.432 YOR119C
          Length = 509

 Score =  588 bits (1515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/426 (67%), Positives = 334/426 (78%), Gaps = 23/426 (5%)

Query: 1   MSVEEKFEKLSIDHHVKDDTANNKLLDKYAHKIKNDQFSFSKVKKTTKDKANRATVENVL 60
           MS+E+KF++L+I +  + + ANNK+LDKY HK K D+ SF++  KT KDKANRATVENVL
Sbjct: 1   MSLEDKFDRLNISNEPRTEHANNKILDKYEHKFKTDEMSFTR-SKTNKDKANRATVENVL 59

Query: 61  DPRTMRFLQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRAS--------------- 105
           DPRTMRFL+AL +RG+ISDFNGCLSTGKEANVYHAFAGD    A                
Sbjct: 60  DPRTMRFLKALTSRGVISDFNGCLSTGKEANVYHAFAGDSKLHADVVLEAKEEEDEDEDE 119

Query: 106 -----GTLPDEESLLARLTQEERA--VQASVGGKKEYAIKIFKTSILVFKDRERYVDGEF 158
                  LP + +L  +L  E R   +      KKEYA+KIFKTSILVFKDRERYVDGEF
Sbjct: 120 NEEDEDDLPIDHNLKEKLETELRPEMLTKVSQDKKEYAVKIFKTSILVFKDRERYVDGEF 179

Query: 159 RFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGAXXXXXXXXXXXXXXXMEFLNRGDGFA 218
           RFRNSRSQHNPRKMIKIWAEKEFRNL+RIYQSG                MEFL RGDGFA
Sbjct: 180 RFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDGFA 239

Query: 219 SPRLRDYPYKDTDSIRQYYCTLVAYMRLMYQVCGLVHADLSEYNVLVHNDRLYIIDVSQS 278
           SPRL+D+PYKD + I  YY T+VAYMRLMYQ+C LVHADLSEYN+L+H D++YIIDVSQS
Sbjct: 240 SPRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKDKMYIIDVSQS 299

Query: 279 VQPEHPMSLDFLRMDIKNVNLYFGKMGIDIFPERIIFQFVISESLDKFEGDYKSSKDLTE 338
           V+PEHPMSLDFLRMDIKN+N YF KMGIDIFPER+IFQF+IS++L+ F GDY+   DL +
Sbjct: 300 VEPEHPMSLDFLRMDIKNINFYFEKMGIDIFPERVIFQFIISDTLENFNGDYRDYNDLRD 359

Query: 339 YVESNLPVKKTEQDEMEDEVFRSLYLVRNLEGLEERDFDRFTEGKFDLLKSLLAHDMEKN 398
           YV  NLP+KK+EQDE EDE+FRSLYLVRNLEGLEERDFDR+T+GKFDLLKSL+AHD EKN
Sbjct: 360 YVAQNLPIKKSEQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSLIAHDNEKN 419

Query: 399 FTAAEQ 404
           F+AAEQ
Sbjct: 420 FSAAEQ 425

>KAFR0E03920 Chr5 complement(775345..776838) [1494 bp, 497 aa] {ON}
           Anc_5.432 YOR119C
          Length = 497

 Score =  587 bits (1514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/412 (71%), Positives = 332/412 (80%), Gaps = 11/412 (2%)

Query: 1   MSVEEKFEKLSIDH-HVKDDTANNKLLDKYAHKIKNDQFSFSKVKKTTKDKANRATVENV 59
           MS+E+KF+ L I       D  NN++LDKY HKIK ++FS S+  KT KDKANRATVENV
Sbjct: 1   MSIEDKFDNLKISGGRGSSDHINNQILDKYGHKIKTNEFSLSR-GKTNKDKANRATVENV 59

Query: 60  LDPRTMRFLQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLP----DEESLL 115
           LDPRTM+FLQALM+RG+IS F+GCLSTGKEANVYHAFAG G  R +G +P    +E S+ 
Sbjct: 60  LDPRTMKFLQALMSRGVISSFDGCLSTGKEANVYHAFAGTG--RPAGQVPTLVQEEMSVP 117

Query: 116 ---ARLTQEERAVQASVGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKM 172
              + L+ +E   + S   ++EYAIKI+KTSILVFKDRERYVDGEFRFRN+RSQHNPRKM
Sbjct: 118 VDPSELSAQEDKDENSTDRREEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKM 177

Query: 173 IKIWAEKEFRNLKRIYQSGAXXXXXXXXXXXXXXXMEFLNRGDGFASPRLRDYPYKDTDS 232
           IKIWAEKEFRNLKRIYQS                 MEFLNRGDGFASPRL+D+PYKD + 
Sbjct: 178 IKIWAEKEFRNLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASPRLKDHPYKDREE 237

Query: 233 IRQYYCTLVAYMRLMYQVCGLVHADLSEYNVLVHNDRLYIIDVSQSVQPEHPMSLDFLRM 292
           I  YY TLVAY+RL+YQVC LVHADLSEYN LVH  RLY+IDVSQSV+PEHPMSLDFLRM
Sbjct: 238 IFHYYHTLVAYIRLLYQVCHLVHADLSEYNTLVHQGRLYVIDVSQSVEPEHPMSLDFLRM 297

Query: 293 DIKNVNLYFGKMGIDIFPERIIFQFVISESLDKFEGDYKSSKDLTEYVESNLPVKKTEQD 352
           DIKNVN YF KMGIDIFPERIIFQFVISE+LDKF GDYKSS DL +YV  NLP+K T QD
Sbjct: 298 DIKNVNFYFEKMGIDIFPERIIFQFVISETLDKFNGDYKSSDDLRDYVRQNLPIKATGQD 357

Query: 353 EMEDEVFRSLYLVRNLEGLEERDFDRFTEGKFDLLKSLLAHDMEKNFTAAEQ 404
           E EDE+FRSLYLVRNL GLEERDFDR+TEG+FDLLKSLLAHD EKNF A+EQ
Sbjct: 358 EAEDEIFRSLYLVRNLNGLEERDFDRYTEGRFDLLKSLLAHDNEKNFAASEQ 409

>Skud_15.282 Chr15 complement(505219..506676) [1458 bp, 485 aa] {ON}
           YOR119C (REAL)
          Length = 485

 Score =  577 bits (1487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/408 (69%), Positives = 334/408 (81%), Gaps = 14/408 (3%)

Query: 1   MSVEEKFEKLSIDHHVKDDTANNKLLDKYAHKIKNDQFSFSKVKKTTKDKANRATVENVL 60
           MS+E++F++L++     D   NN+LL+KY+HKIK D+ SFSK K T+KDKANRATVENVL
Sbjct: 1   MSLEDRFDRLTVSQRASDHI-NNQLLEKYSHKIKTDELSFSKAK-TSKDKANRATVENVL 58

Query: 61  DPRTMRFLQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESLLARLTQ 120
           DPRTMRFL++++NRG+I+D NGCLSTGKEANVYHAFAG G       + DEE+       
Sbjct: 59  DPRTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTG----KAPVIDEET------- 107

Query: 121 EERAVQASVGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKE 180
            +  V  + G +KEYAIKI+KTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKE
Sbjct: 108 GQYEVLETDGLRKEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKE 167

Query: 181 FRNLKRIYQSGAXXXXXXXXXXXXXXXMEFLNRGDGFASPRLRDYPYKDTDSIRQYYCTL 240
           FRNLKRI+QSG                MEFL+RG+GFASP+LRDYPY+D + I  YY T+
Sbjct: 168 FRNLKRIHQSGVIPAPRPVEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREEIFHYYHTM 227

Query: 241 VAYMRLMYQVCGLVHADLSEYNVLVHNDRLYIIDVSQSVQPEHPMSLDFLRMDIKNVNLY 300
           VAYMRL+YQVC LVHADLSEYN ++HND+LY+IDVSQSV+PEHPMSLDFLRMDIKNVNLY
Sbjct: 228 VAYMRLLYQVCRLVHADLSEYNTIIHNDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLY 287

Query: 301 FGKMGIDIFPERIIFQFVISESLDKFEGDYKSSKDLTEYVESNLPVKKTEQDEMEDEVFR 360
           F KMG+ IFPER+IFQFVISESL+KF+GDY +  DL  Y+  NLP+K TEQDE EDE+FR
Sbjct: 288 FEKMGVSIFPERVIFQFVISESLEKFKGDYHNVIDLVGYIAKNLPIKSTEQDEAEDEIFR 347

Query: 361 SLYLVRNLEGLEERDFDRFTEGKFDLLKSLLAHDMEKNFTAAEQQFEF 408
           SL+LVR+L GLEERDFDR+T+GKFDLLKSL+AHD E+NF A+E QFEF
Sbjct: 348 SLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERNFAASE-QFEF 394

>YOR119C Chr15 complement(548792..550246) [1455 bp, 484 aa] {ON}
           RIO1Essential serine kinase involved in cell cycle
           progression and processing of the 20S pre-rRNA into
           mature 18S rRNA
          Length = 484

 Score =  575 bits (1482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/408 (69%), Positives = 331/408 (81%), Gaps = 14/408 (3%)

Query: 1   MSVEEKFEKLSIDHHVKDDTANNKLLDKYAHKIKNDQFSFSKVKKTTKDKANRATVENVL 60
           MS+E+KF+ LS+     D   NN+LL+KY+HKIK D+ SFS+ K T+KDKANRATVENVL
Sbjct: 1   MSLEDKFDSLSVSQGASDHI-NNQLLEKYSHKIKTDELSFSRAK-TSKDKANRATVENVL 58

Query: 61  DPRTMRFLQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESLLARLTQ 120
           DPRTMRFL++++ RG+I+D NGCLSTGKEANVYHAFAG G       + DEE+       
Sbjct: 59  DPRTMRFLKSMVTRGVIADLNGCLSTGKEANVYHAFAGTG----KAPVIDEET------- 107

Query: 121 EERAVQASVGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKE 180
            +  V  + G + EYAIKI+KTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKE
Sbjct: 108 GQYEVLETDGSRAEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKE 167

Query: 181 FRNLKRIYQSGAXXXXXXXXXXXXXXXMEFLNRGDGFASPRLRDYPYKDTDSIRQYYCTL 240
           FRNLKRIYQSG                MEFL+RG+GFASP+L+DYPYK+ D I  YY T+
Sbjct: 168 FRNLKRIYQSGVIPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTM 227

Query: 241 VAYMRLMYQVCGLVHADLSEYNVLVHNDRLYIIDVSQSVQPEHPMSLDFLRMDIKNVNLY 300
           VAYMRL+YQVC LVHADLSEYN +VH+D+LY+IDVSQSV+PEHPMSLDFLRMDIKNVNLY
Sbjct: 228 VAYMRLLYQVCRLVHADLSEYNTIVHDDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLY 287

Query: 301 FGKMGIDIFPERIIFQFVISESLDKFEGDYKSSKDLTEYVESNLPVKKTEQDEMEDEVFR 360
           F KMGI IFPER+IFQFVISE+L+KF+GDY +   L  Y+ SNLP+K TEQDE EDE+FR
Sbjct: 288 FEKMGISIFPERVIFQFVISETLEKFKGDYNNISALVAYIASNLPIKSTEQDEAEDEIFR 347

Query: 361 SLYLVRNLEGLEERDFDRFTEGKFDLLKSLLAHDMEKNFTAAEQQFEF 408
           SL+LVR+L GLEERDFDR+T+GKFDLLKSL+AHD E+NF A+E QFEF
Sbjct: 348 SLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERNFAASE-QFEF 394

>Suva_8.172 Chr8 complement(306553..308013) [1461 bp, 486 aa] {ON}
           YOR119C (REAL)
          Length = 486

 Score =  574 bits (1480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/408 (69%), Positives = 333/408 (81%), Gaps = 14/408 (3%)

Query: 1   MSVEEKFEKLSIDHHVKDDTANNKLLDKYAHKIKNDQFSFSKVKKTTKDKANRATVENVL 60
           MS E+KFEKL++     D   NN+LLDK++HKIK D+ SFSK K T+KDK+NRATVENVL
Sbjct: 1   MSFEDKFEKLTVSQRASDHI-NNQLLDKFSHKIKTDELSFSKAK-TSKDKSNRATVENVL 58

Query: 61  DPRTMRFLQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESLLARLTQ 120
           DPRTMRFL++++NRG+I+D NGCLSTGKEANVYHAFAG G       + DEE+       
Sbjct: 59  DPRTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTG----KAPVVDEET------- 107

Query: 121 EERAVQASVGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKE 180
            +  V  + G + EYAIKI+KTSILVFKDRE+YVDGEFRFRN+RSQHNPRKMIKIWAEKE
Sbjct: 108 GKYEVLETDGLRAEYAIKIYKTSILVFKDREKYVDGEFRFRNARSQHNPRKMIKIWAEKE 167

Query: 181 FRNLKRIYQSGAXXXXXXXXXXXXXXXMEFLNRGDGFASPRLRDYPYKDTDSIRQYYCTL 240
           FRNLKRI+QSG                MEFL+RGDGFASP+L+DYPYKD + I  YY T+
Sbjct: 168 FRNLKRIHQSGVIPAPKPVEVKNNVLVMEFLSRGDGFASPKLKDYPYKDREEIFHYYYTM 227

Query: 241 VAYMRLMYQVCGLVHADLSEYNVLVHNDRLYIIDVSQSVQPEHPMSLDFLRMDIKNVNLY 300
           VAYMRL+YQVC LVHADLSEYN ++H+D+LY+IDVSQSV+PEHPMSLDFLRMDIKNVNLY
Sbjct: 228 VAYMRLLYQVCRLVHADLSEYNTIIHDDQLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLY 287

Query: 301 FGKMGIDIFPERIIFQFVISESLDKFEGDYKSSKDLTEYVESNLPVKKTEQDEMEDEVFR 360
           F KMGI+IFPER+IFQFVISE L+KF+GDYK+  DL  Y+  NLP+K TEQDE EDE+FR
Sbjct: 288 FEKMGINIFPERVIFQFVISEVLEKFKGDYKNVPDLIGYISKNLPIKSTEQDEAEDEIFR 347

Query: 361 SLYLVRNLEGLEERDFDRFTEGKFDLLKSLLAHDMEKNFTAAEQQFEF 408
           SL+LVR+L GLEERDFDR+T+GKFDLLKSL+AHD E+NF A+E QFEF
Sbjct: 348 SLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERNFAASE-QFEF 394

>Smik_15.297 Chr15 complement(509934..511394) [1461 bp, 486 aa] {ON}
           YOR119C (REAL)
          Length = 486

 Score =  566 bits (1458), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/408 (68%), Positives = 330/408 (80%), Gaps = 14/408 (3%)

Query: 1   MSVEEKFEKLSIDHHVKDDTANNKLLDKYAHKIKNDQFSFSKVKKTTKDKANRATVENVL 60
           MS+E+ F+KL++     D   NN+LL+KY+HKIK D+ SF++ K T+KDKANRATVENVL
Sbjct: 1   MSLEDNFDKLTVSQRASDHI-NNQLLEKYSHKIKTDELSFNRAK-TSKDKANRATVENVL 58

Query: 61  DPRTMRFLQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESLLARLTQ 120
           DPRTMRFL++++NRG+I+D NGCLSTGKEANVYHAFAG G       + DEE+       
Sbjct: 59  DPRTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTG----KAPVIDEET------- 107

Query: 121 EERAVQASVGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKE 180
            +  V  + G + EYAIKI+KTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKE
Sbjct: 108 GKYEVLETDGPRPEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKE 167

Query: 181 FRNLKRIYQSGAXXXXXXXXXXXXXXXMEFLNRGDGFASPRLRDYPYKDTDSIRQYYCTL 240
           FRNLKRIYQSG                MEFL+RG+GFASP+L+DYPY+D   I  YY T+
Sbjct: 168 FRNLKRIYQSGVIPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGEIFHYYYTM 227

Query: 241 VAYMRLMYQVCGLVHADLSEYNVLVHNDRLYIIDVSQSVQPEHPMSLDFLRMDIKNVNLY 300
           VAYMRL+YQVC LVHADLSEYN ++H+D+L++IDVSQSV+PEHPMSLDFLRMDIKNVNLY
Sbjct: 228 VAYMRLLYQVCRLVHADLSEYNTIIHDDKLFMIDVSQSVEPEHPMSLDFLRMDIKNVNLY 287

Query: 301 FGKMGIDIFPERIIFQFVISESLDKFEGDYKSSKDLTEYVESNLPVKKTEQDEMEDEVFR 360
           F KMGI IFPER+IFQFVISESL+KF+ DY +  DL  Y+  NLP+K TEQDE EDE+FR
Sbjct: 288 FEKMGISIFPERVIFQFVISESLEKFKDDYHNVTDLVGYIAKNLPIKSTEQDEAEDEIFR 347

Query: 361 SLYLVRNLEGLEERDFDRFTEGKFDLLKSLLAHDMEKNFTAAEQQFEF 408
           SL+LVR+L GLEERDFDR+T+GKFDLLKSL+AHD E+NF A+E QFEF
Sbjct: 348 SLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERNFAASE-QFEF 394

>Kpol_1062.31 s1062 (67759..69300) [1542 bp, 513 aa] {ON}
           (67759..69300) [1542 nt, 514 aa]
          Length = 513

 Score =  561 bits (1446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/423 (67%), Positives = 329/423 (77%), Gaps = 26/423 (6%)

Query: 1   MSVEEKFEKLSIDHHVKDDTANNKLLDKYAHKIKNDQFSFSKVKKTTKDKANRATVENVL 60
           MS +EKF++L I      +  N ++L+KY HKIK D+ SF+K  KT KDKANRATVENVL
Sbjct: 1   MSFDEKFDRLKI----SGNDVNTRILEKYGHKIKTDELSFTK-GKTNKDKANRATVENVL 55

Query: 61  DPRTMRFLQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESLLARLT- 119
           DPRTMRFL+AL NRG+IS FNGCLSTGKEANVYHAFAGDG S  +  +  E+  L +LT 
Sbjct: 56  DPRTMRFLKALTNRGVISAFNGCLSTGKEANVYHAFAGDGTSSRNTDVKVED--LVKLTS 113

Query: 120 -------QEERAVQASVGG-----------KKEYAIKIFKTSILVFKDRERYVDGEFRFR 161
                  +E+     +V             +KEYAIKI+KTSILVFKDRERYVDGE+RFR
Sbjct: 114 VEVNQDSEEDNGDNNNVADIDGSKPEGVELRKEYAIKIYKTSILVFKDRERYVDGEYRFR 173

Query: 162 NSRSQHNPRKMIKIWAEKEFRNLKRIYQSGAXXXXXXXXXXXXXXXMEFLNRGDGFASPR 221
           NSRSQHNPRKMIKIWAEKEFRNL+RI+QSG                MEFLNRG+GFASPR
Sbjct: 174 NSRSQHNPRKMIKIWAEKEFRNLRRIHQSGVIPAPKPVEVKSNVLVMEFLNRGNGFASPR 233

Query: 222 LRDYPYKDTDSIRQYYCTLVAYMRLMYQVCGLVHADLSEYNVLVHNDRLYIIDVSQSVQP 281
           L+DYPYKD D I  YY  LVAYMRL+YQVC LVHADLSEYN +VH  +LY+IDVSQSV+P
Sbjct: 234 LKDYPYKDRDEIFWYYHILVAYMRLLYQVCRLVHADLSEYNTIVHQGKLYMIDVSQSVEP 293

Query: 282 EHPMSLDFLRMDIKNVNLYFGKMGIDIFPERIIFQFVISESLDKFEGDYKSSKDLTEYVE 341
           EHPMSLDFLRMDIKNVN YF KMGIDIFPERIIFQFVISE L+ F+GD  S+ DL E+V+
Sbjct: 294 EHPMSLDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISEKLETFKGDLNSADDLREFVK 353

Query: 342 SNLPVKKTEQDEMEDEVFRSLYLVRNLEGLEERDFDRFTEGKFDLLKSLLAHDMEKNFTA 401
           +NLP+K T++DE EDEVFRSL+LVRNL GLEERDFDRFT+GKFDLLK+L+A D +KNFTA
Sbjct: 354 NNLPIKSTDEDEAEDEVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKTLIASDNQKNFTA 413

Query: 402 AEQ 404
           +EQ
Sbjct: 414 SEQ 416

>SAKL0G02486g Chr7 complement(206119..207621) [1503 bp, 500 aa] {ON}
           similar to uniprot|Q12196 YOR119C Saccharomyces
           cerevisiae RIO1 Essential protein that plays a role in
           cell cycle progression
          Length = 500

 Score =  558 bits (1437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/416 (67%), Positives = 329/416 (79%), Gaps = 28/416 (6%)

Query: 1   MSVEEKFEKLSIDHHVKD------DTANNKLLDKYAHKIKNDQFSFSKVKKTTKDKANRA 54
           MSVE  F KL    H++D      D  N+++LDKY+H+IK D+ S ++  KT KDKANRA
Sbjct: 1   MSVEASFSKL----HLRDGPDEHRDHVNSRILDKYSHRIKTDELSLTR-GKTNKDKANRA 55

Query: 55  TVENVLDPRTMRFLQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESL 114
           TVENVLDPRTMRFL+ L++RG++SD NGCLSTGKEANVYHAFAG+         P EE+ 
Sbjct: 56  TVENVLDPRTMRFLRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNA------NQPSEEA- 108

Query: 115 LARLTQEERAVQASVGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIK 174
             + +++E         K+EYA+KI+KTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIK
Sbjct: 109 -EKDSKDELV-------KREYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIK 160

Query: 175 IWAEKEFRNLKRIYQSGAXXXXXXXXXXXXXXXMEFLNRGDGFASPRLRDYPYKDTDSIR 234
           IWAEKEFRNLKRI+QSG                MEFLNRG+GFASPRL+D+PYKD + I+
Sbjct: 161 IWAEKEFRNLKRIHQSGVIPCPQPIEVRSNVLVMEFLNRGNGFASPRLKDHPYKDREEIK 220

Query: 235 QYYCTLVAYMRLMYQVCGLVHADLSEYNVLVHNDRLYIIDVSQSVQPEHPMSLDFLRMDI 294
            YY T+VAYMRL+YQVC LVHADLSEYN +VH+DRLY+IDVSQSVQPEHPMSLDFLRMDI
Sbjct: 221 YYYHTMVAYMRLLYQVCQLVHADLSEYNTIVHHDRLYMIDVSQSVQPEHPMSLDFLRMDI 280

Query: 295 KNVNLYFGKMGIDIFPERIIFQFVISESLDKFEGDYKSSKDLTEYVESNLPVKKTEQDEM 354
           KN+N YF K GIDIFPER+IFQF+ISE+LDKF+GDY + +DL +YV  NLP+K T +DE 
Sbjct: 281 KNINSYFEKTGIDIFPERVIFQFIISETLDKFQGDYHNDQDLRDYVSKNLPLKSTAEDEA 340

Query: 355 EDEVFRSLYLVRNLEGLEERDFDRFTEGKFDLLKSLLAHDMEKNFT--AAEQQFEF 408
           EDEVFRSL+LVRNL GLEERDFDRFT+GKFDLLKSL+AHD +KN T   A +QFE 
Sbjct: 341 EDEVFRSLHLVRNLNGLEERDFDRFTDGKFDLLKSLIAHDNKKNATNFNASEQFEI 396

>KLLA0E21121g Chr5 (1886452..1888032) [1581 bp, 526 aa] {ON} similar
           to uniprot|Q12196 YOR119C Saccharomyces cerevisiae RIO1
           Essential protein that plays a role in cell cycle
           progression
          Length = 526

 Score =  557 bits (1436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/423 (66%), Positives = 333/423 (78%), Gaps = 22/423 (5%)

Query: 1   MSVEEKFEKLSIDHHVKDDTANNKLLDKYAHKIKNDQFSFSKVKKTTKDKANRATVENVL 60
           M++++K EKL++ +  +D+  N ++L++YA+ IK D+ S ++  KT+KDKANRATVENVL
Sbjct: 2   MNIDDKLEKLNLAN--RDEHVNTQILERYANSIKTDELSLTR-GKTSKDKANRATVENVL 58

Query: 61  DPRTMRFLQALMNRGIISDFNGCLSTGKEANVYHAFAGD---------GVSRASGTLPDE 111
           DPRTMRFL+++MNRGI+S FNGCLSTGKEANVYHAFAG+         G     G   + 
Sbjct: 59  DPRTMRFLKSMMNRGILSAFNGCLSTGKEANVYHAFAGNHEERHLLVEGHDDTIGAPQNI 118

Query: 112 ESLLAR-LTQE-ERAVQASVG-----GKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSR 164
           ES   + LT E E A   S        KKEYA+KI+KTSILVFKDRERYVDGEFRFRNSR
Sbjct: 119 ESTKQKALTAESEDATSTSTATDEPKNKKEYAVKIYKTSILVFKDRERYVDGEFRFRNSR 178

Query: 165 SQHNPRKMIKIWAEKEFRNLKRIYQSGAXXXXXXXXXXXXXXXMEFLNRGDGFASPRLRD 224
           SQHNPRKMIKIWAEKEFRNLKRIYQSG                MEFLNRGDGFASPRL+D
Sbjct: 179 SQHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPRLKD 238

Query: 225 YPYKDTDSIRQYYCTLVAYMRLMYQVCGLVHADLSEYNVLVHNDRLYIIDVSQSVQPEHP 284
           +PYKD + I+ YY  ++AYMRL+YQVC LVHADLSEYN +VH D+LYIIDVSQSVQPEHP
Sbjct: 239 HPYKDREEIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHEDKLYIIDVSQSVQPEHP 298

Query: 285 MSLDFLRMDIKNVNLYFGKMGIDIFPERIIFQFVISESLDKFEGDYKSSKDLTEYVESNL 344
           MSLDFLRMDIKNVN YF K+GIDIFPER+IFQF+ISE LDKF+GDY+SS DL  YV  NL
Sbjct: 299 MSLDFLRMDIKNVNSYFQKLGIDIFPERVIFQFIISEVLDKFKGDYRSSDDLETYVADNL 358

Query: 345 PVKKTEQDEMEDEVFRSLYLVRNLEGLEERDFDRFTEGKFDLLKSLLAHDMEK---NFTA 401
           P+K T++DE EDEVFRSL+L+RNL GLEERDFDRFT+GKFDLLKSL+A++  K   NFTA
Sbjct: 359 PLKLTDEDEAEDEVFRSLHLIRNLGGLEERDFDRFTDGKFDLLKSLIANENRKYSENFTA 418

Query: 402 AEQ 404
           +EQ
Sbjct: 419 SEQ 421

>NDAI0B05650 Chr2 complement(1380239..1381627) [1389 bp, 462 aa]
           {ON} Anc_5.432 YOR119C
          Length = 462

 Score =  550 bits (1417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/378 (72%), Positives = 306/378 (80%), Gaps = 15/378 (3%)

Query: 38  FSFSKVKKTTKDKANRATVENVLDPRTMRFLQALMNRGIISDFNGCLSTGKEANVYHAFA 97
            SF+K  KT KDKANRATVENVLDPRTM+FL+AL +RG+ISDFNGCLSTGKEANVYHAFA
Sbjct: 1   MSFTK-GKTNKDKANRATVENVLDPRTMKFLKALTSRGVISDFNGCLSTGKEANVYHAFA 59

Query: 98  GDGVSRASGTLP-------DEESLLARL-TQ---EERAVQASVGGKKEYAIKIFKTSILV 146
           GD    +  T         DEE+L  +L TQ   EE  +Q     KKEYA+KIFKTSILV
Sbjct: 60  GDSKLHSDDTDEPHDDNNIDEEALKEKLETQINPEETRLQKD---KKEYAVKIFKTSILV 116

Query: 147 FKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGAXXXXXXXXXXXXXX 206
           FKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL+RIYQS                
Sbjct: 117 FKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPKPIEVKNNVL 176

Query: 207 XMEFLNRGDGFASPRLRDYPYKDTDSIRQYYCTLVAYMRLMYQVCGLVHADLSEYNVLVH 266
            MEFLNRGDGFASPRLRDYPYKD + +  YY   +AYMRLMYQVC LVHADLSEYN+L+H
Sbjct: 177 IMEFLNRGDGFASPRLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRLVHADLSEYNILIH 236

Query: 267 NDRLYIIDVSQSVQPEHPMSLDFLRMDIKNVNLYFGKMGIDIFPERIIFQFVISESLDKF 326
           N+ +YIIDVSQSV+PEHPMSLDFLRMDIKN+N+YF +MGIDIFPER+IFQF+ISE+LDKF
Sbjct: 237 NNLMYIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDRMGIDIFPERVIFQFIISETLDKF 296

Query: 327 EGDYKSSKDLTEYVESNLPVKKTEQDEMEDEVFRSLYLVRNLEGLEERDFDRFTEGKFDL 386
            G+Y    DL +YV   LP+KKT QDE EDE+FRSLYLVRNLEGLEERDFDR+T+GKFDL
Sbjct: 297 TGNYNDYNDLRDYVAKTLPIKKTAQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDL 356

Query: 387 LKSLLAHDMEKNFTAAEQ 404
           LKSL+AHD EKNF+AAEQ
Sbjct: 357 LKSLIAHDNEKNFSAAEQ 374

>CAGL0L11594g Chr12 (1239169..1240692) [1524 bp, 507 aa] {ON} highly
           similar to uniprot|Q12196 Saccharomyces cerevisiae
           YOR119c
          Length = 507

 Score =  551 bits (1420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/406 (67%), Positives = 318/406 (78%), Gaps = 18/406 (4%)

Query: 9   KLSIDHHVKDDTANNKLLDKYAHKIKNDQFSFSKVKKTTKDKANRATVENVLDPRTMRFL 68
           K+S DH       NN+++DKY HKIK D+ S +K K T KDKANRATVENVLDPRTMRFL
Sbjct: 12  KVSTDH------INNQIMDKYGHKIKTDELSINKAK-TNKDKANRATVENVLDPRTMRFL 64

Query: 69  QALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESLLARLT--------Q 120
            AL+NRG+I+  NGCLSTGKEANVYHAFAG  ++    +   +E + A            
Sbjct: 65  NALVNRGVIAGLNGCLSTGKEANVYHAFAGSKMATEQQSDEPKEDIDANAIPSKGNIDIS 124

Query: 121 EERAVQAS---VGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWA 177
           E RA  A      G+KEYAIKI+KTSIL+FKDRERYVDGEFRFRNSRSQHNPRKMIKIWA
Sbjct: 125 ENRAKTAEDLIREGRKEYAIKIYKTSILIFKDRERYVDGEFRFRNSRSQHNPRKMIKIWA 184

Query: 178 EKEFRNLKRIYQSGAXXXXXXXXXXXXXXXMEFLNRGDGFASPRLRDYPYKDTDSIRQYY 237
           EKEFRNLKRIYQ G                MEFLNRGDGFASP+LRDYPYKD + I  YY
Sbjct: 185 EKEFRNLKRIYQMGVIPSPEPIEVKNNVLVMEFLNRGDGFASPKLRDYPYKDREEIYYYY 244

Query: 238 CTLVAYMRLMYQVCGLVHADLSEYNVLVHNDRLYIIDVSQSVQPEHPMSLDFLRMDIKNV 297
             LV+YMRL+YQVC LVHADLSEYN +VH ++LY+IDVSQSV+PEHPMSLDFLRMDIKNV
Sbjct: 245 HILVSYMRLLYQVCRLVHADLSEYNTIVHKEKLYMIDVSQSVEPEHPMSLDFLRMDIKNV 304

Query: 298 NLYFGKMGIDIFPERIIFQFVISESLDKFEGDYKSSKDLTEYVESNLPVKKTEQDEMEDE 357
           NLYF KMGI+IF E+ IFQFVI+++LDKF+GD  S +DL +YV +N+P+K+T++DE EDE
Sbjct: 305 NLYFEKMGIEIFQEKAIFQFVITDTLDKFDGDMNSYEDLRKYVATNIPIKRTQEDEAEDE 364

Query: 358 VFRSLYLVRNLEGLEERDFDRFTEGKFDLLKSLLAHDMEKNFTAAE 403
           VFRSL+LVRNLEGLEERDFDRFT+GKFDLLKSLLA D +KN+ AA+
Sbjct: 365 VFRSLHLVRNLEGLEERDFDRFTDGKFDLLKSLLAQDNKKNYIAAQ 410

>Kwal_55.21433 s55 (835062..836492) [1431 bp, 476 aa] {ON} YOR119C
           (RIO1) - similar to a C.elegans ZK632.3 protein [contig
           130] FULL
          Length = 476

 Score =  549 bits (1415), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/409 (67%), Positives = 317/409 (77%), Gaps = 21/409 (5%)

Query: 1   MSVEEKFEKLSI--DHHVKDDTANNKLLDKYAHKIKNDQFSFSKVKKTTKDKANRATVEN 58
           MS++++ + L +  +   +DD  N ++LDK+AH IK D+ S S+  KT+KDKANRATVEN
Sbjct: 1   MSLKDRMDNLRLRDNFEPQDDHINTQILDKHAHNIKADELSVSR-GKTSKDKANRATVEN 59

Query: 59  VLDPRTMRFLQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESLLARL 118
           VLDPRTMRFLQAL +RG+IS FNGC+STGKEANVYHAFA  G               A+ 
Sbjct: 60  VLDPRTMRFLQALTSRGVISQFNGCVSTGKEANVYHAFAEIG---------------AKN 104

Query: 119 TQEERAVQASVGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAE 178
           T+E   V  ++  ++E AIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAE
Sbjct: 105 TEEAGEVLPNLEERRELAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAE 164

Query: 179 KEFRNLKRIYQSGAXXXXXXXXXXXXXXXMEFLNRGDGFASPRLRDYPYKDTDSIRQYYC 238
           KEFRNLKRIYQSG                MEFL+RG+GFASPRL+DYPYKD +    YY 
Sbjct: 165 KEFRNLKRIYQSGLVPAPEPVEVRSNVLVMEFLSRGNGFASPRLKDYPYKDREETAHYYY 224

Query: 239 TLVAYMRLMYQVCGLVHADLSEYNVLVHNDRLYIIDVSQSVQPEHPMSLDFLRMDIKNVN 298
           T+VAY+RL+YQ C LVHADLSEYN +VHN  LYIIDVSQSVQPEHPMSLDFLRMDIKNVN
Sbjct: 225 TMVAYIRLLYQCCQLVHADLSEYNAIVHNKELYIIDVSQSVQPEHPMSLDFLRMDIKNVN 284

Query: 299 LYFGKMGIDIFPERIIFQFVISESLDKFEGDYKSSKDLTEYVESNLPVKKTEQDEMEDEV 358
            YF +M +D+FPER+IFQFVISE+LDKF GDY SS DL +YV  NLPVK   QDE EDEV
Sbjct: 285 NYFERMSVDVFPERVIFQFVISETLDKFSGDYTSSVDLRDYVSKNLPVKSGPQDEAEDEV 344

Query: 359 FRSLYLVRNLEGLEERDFDRFTEGKFDLLKSLLAHDMEK---NFTAAEQ 404
           FRSL+LVRNL GLEERDFDRFT GKFDLLKSL+AHD E+    FTA+EQ
Sbjct: 345 FRSLHLVRNLGGLEERDFDRFTLGKFDLLKSLIAHDNERVASTFTASEQ 393

>KLTH0F16104g Chr6 (1306436..1308058) [1623 bp, 540 aa] {ON} similar
           to uniprot|Q12196 YOR119C Saccharomyces cerevisiae RIO1
           Essential protein that plays a role in cell cycle
           progression
          Length = 540

 Score =  551 bits (1421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/409 (67%), Positives = 319/409 (77%), Gaps = 21/409 (5%)

Query: 1   MSVEEKFEKLSI--DHHVKDDTANNKLLDKYAHKIKNDQFSFSKVKKTTKDKANRATVEN 58
           MS+E+   KLS+   H    D  N ++LDK+AH IK D+ S ++ K T+KDKANRATVEN
Sbjct: 53  MSLEDGLGKLSLHEKHGADRDHINTQILDKHAHNIKTDELSVTRAK-TSKDKANRATVEN 111

Query: 59  VLDPRTMRFLQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESLLARL 118
           VLDPRTMRFLQAL +RG+IS+FNGCLSTGKEANVYHAFAG G               A+ 
Sbjct: 112 VLDPRTMRFLQALKSRGVISEFNGCLSTGKEANVYHAFAGYG---------------AKS 156

Query: 119 TQEERAVQASVGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAE 178
           ++EE+ V  + G ++EYAIKI+KTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAE
Sbjct: 157 SEEEQKVLPNQGERREYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAE 216

Query: 179 KEFRNLKRIYQSGAXXXXXXXXXXXXXXXMEFLNRGDGFASPRLRDYPYKDTDSIRQYYC 238
           KEFRNLKRIYQSG                MEFLNRGDGFASP+L+D+PYKD D    YY 
Sbjct: 217 KEFRNLKRIYQSGVVPAPEPIEVKSNVLVMEFLNRGDGFASPKLKDFPYKDRDETLYYYH 276

Query: 239 TLVAYMRLMYQVCGLVHADLSEYNVLVHNDRLYIIDVSQSVQPEHPMSLDFLRMDIKNVN 298
           T+VAY+RL+YQ C LVHADLSEYN +VHN +LY+IDVSQSVQPEHPMSLDFLRMDIKN+N
Sbjct: 277 TMVAYIRLLYQCCQLVHADLSEYNTIVHNQKLYVIDVSQSVQPEHPMSLDFLRMDIKNIN 336

Query: 299 LYFGKMGIDIFPERIIFQFVISESLDKFEGDYKSSKDLTEYVESNLPVKKTEQDEMEDEV 358
            YF +M IDIFPER IFQFVIS+ L+KFEG+Y +++DL +YV   L  K   +DE EDEV
Sbjct: 337 SYFERMSIDIFPERAIFQFVISDKLEKFEGEYTNAEDLRQYVAKTLRPKSGPEDEAEDEV 396

Query: 359 FRSLYLVRNLEGLEERDFDRFTEGKFDLLKSLLAHDMEK---NFTAAEQ 404
           FRSL+LVRNL GLEERDFDRFT GKFDLLKSL+AHD +K   NFTA+EQ
Sbjct: 397 FRSLHLVRNLGGLEERDFDRFTLGKFDLLKSLIAHDNQKVASNFTASEQ 445

>TBLA0A03760 Chr1 complement(938917..940431) [1515 bp, 504 aa] {ON}
           Anc_5.432 YOR119C
          Length = 504

 Score =  543 bits (1400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/407 (66%), Positives = 319/407 (78%), Gaps = 8/407 (1%)

Query: 1   MSVEEKFEKLSIDHHVKDDTANNKLLDKYAHKIKNDQFSFSKVKKTTKDKANRATVENVL 60
           M +++ F+KL +     ++  NN++LDK+ HKIK D+FS S+  KT KDKANRATVENVL
Sbjct: 1   MVLDDDFQKLDL----SNNHDNNRILDKHGHKIKTDEFSISR-GKTNKDKANRATVENVL 55

Query: 61  DPRTMRFLQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDE-ESLLARLT 119
           DPRTMRFL+AL +RGIISDFNGC+STGKEANVYHAFAGD +S       D  E+L+    
Sbjct: 56  DPRTMRFLKALTSRGIISDFNGCISTGKEANVYHAFAGDTISPFEPKTHDSFENLVNTYD 115

Query: 120 --QEERAVQASVGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWA 177
                      +  +KEYAIKI+KTSILVFKDRERYVDGE+RFRNSRSQHNPRKMIKIWA
Sbjct: 116 PYSNPNNNDTILEPRKEYAIKIYKTSILVFKDRERYVDGEYRFRNSRSQHNPRKMIKIWA 175

Query: 178 EKEFRNLKRIYQSGAXXXXXXXXXXXXXXXMEFLNRGDGFASPRLRDYPYKDTDSIRQYY 237
           EKEFRNLKRIYQS                 MEFLNRGDGFASPRL+DYPYKD + I  YY
Sbjct: 176 EKEFRNLKRIYQSKVIPVPKPIEVKNNVLVMEFLNRGDGFASPRLKDYPYKDHNDIVHYY 235

Query: 238 CTLVAYMRLMYQVCGLVHADLSEYNVLVHNDRLYIIDVSQSVQPEHPMSLDFLRMDIKNV 297
            T++ Y+RL+YQVC LVHADLSEYN LVH ++LY+IDVSQSV+PEHPMSLDFLRMDIKN+
Sbjct: 236 HTMIVYIRLLYQVCRLVHADLSEYNTLVHKNKLYVIDVSQSVEPEHPMSLDFLRMDIKNI 295

Query: 298 NLYFGKMGIDIFPERIIFQFVISESLDKFEGDYKSSKDLTEYVESNLPVKKTEQDEMEDE 357
           N YF +MG+ IF ERIIFQF ISE+LD F G+Y +  DL  YV++NLP+K   +D+ EDE
Sbjct: 296 NNYFERMGVAIFAERIIFQFTISETLDNFNGNYSNEDDLRMYVKNNLPLKVPGKDDAEDE 355

Query: 358 VFRSLYLVRNLEGLEERDFDRFTEGKFDLLKSLLAHDMEKNFTAAEQ 404
           +FRSL+LVRNL GLEERDFDR+T+GKFDLLKSL+AHD EKNF+A+EQ
Sbjct: 356 IFRSLHLVRNLGGLEERDFDRYTDGKFDLLKSLIAHDNEKNFSASEQ 402

>TPHA0E01780 Chr5 (357819..359345) [1527 bp, 508 aa] {ON} Anc_5.432
           YOR119C
          Length = 508

 Score =  543 bits (1398), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/421 (65%), Positives = 325/421 (77%), Gaps = 18/421 (4%)

Query: 1   MSVEEKFEKLSIDHHVKDDTANNKLLDKYAHKIKNDQFSFSKVKKTTKDKANRATVENVL 60
           MS+E KF+KL +    + +  N+K+L+KY HKIK D+ S +K  KT KDKANRATVENVL
Sbjct: 1   MSLEGKFDKLKVH---ESEHINSKILEKYGHKIKTDELSDTK-GKTNKDKANRATVENVL 56

Query: 61  DPRTMRFLQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASG-TLPDEESLLARLT 119
           DPRTM+ L+ L+NRG+I +FNGCLSTGKEANVYHAFAGDG  + +   LP    L   L 
Sbjct: 57  DPRTMKSLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEVLPQISELEDVLN 116

Query: 120 QE------------ERAVQASVGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQH 167
           +E                Q  +  +KEYAIKI+KTSILVFKDRERYVDGEFRFRN+RSQH
Sbjct: 117 KELIPGQIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQH 176

Query: 168 NPRKMIKIWAEKEFRNLKRIYQSGAXXXXXXXXXXXXXXXMEFLNRGDGFASPRLRDYPY 227
           NPRKMIKIWAEKEFRNL+RI+QSG                MEFL RGDGFASPRLRD+ Y
Sbjct: 177 NPRKMIKIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDHQY 236

Query: 228 KDTDSIRQYYCTLVAYMRLMYQVCGLVHADLSEYNVLVHNDRLYIIDVSQSVQPEHPMSL 287
           K  + I  YY TLVAY+RL+YQVC LVHADLSEYN +VH+D+LY+IDVSQSV+PEHPMSL
Sbjct: 237 KTREEIIYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDDKLYVIDVSQSVEPEHPMSL 296

Query: 288 DFLRMDIKNVNLYFGKMGIDIFPERIIFQFVISESLDKFEGDYKSSKDLTEYVESNLPVK 347
           DFLRMDIKNVN YF KMGIDIFPERIIFQFVIS  LDKF GD +SS DL  Y+   LPVK
Sbjct: 297 DFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISSELDKFTGDPRSSVDLRNYIAHYLPVK 356

Query: 348 KTEQDEMEDEVFRSLYLVRNLEGLEERDFDRFTEGKFDLLKSLLAHDMEKNFTAAEQQFE 407
            T++DE++DE+FRSL+LVRNL+GLEERDFDRFT+GKFDLLK+L+A D +KNFTA+  QF+
Sbjct: 357 CTDEDELKDEIFRSLHLVRNLDGLEERDFDRFTDGKFDLLKTLIASDNQKNFTAS-TQFD 415

Query: 408 F 408
           F
Sbjct: 416 F 416

>AER257W Chr5 (1110411..1111844) [1434 bp, 477 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR119C (RIO1)
          Length = 477

 Score =  537 bits (1384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/409 (65%), Positives = 316/409 (77%), Gaps = 36/409 (8%)

Query: 1   MSVEEKFEKLSIDHHVKDDTA--NNKLLDKYAHKIKNDQFSFSKVKKTTKDKANRATVEN 58
           M +E++  KL +    +DDT   N ++L+K+A++IK D+ S +K  KT KDKANRATVEN
Sbjct: 1   MDLEDQLRKLKL----RDDTDHDNTRILEKFANQIKTDELSLTK-GKTNKDKANRATVEN 55

Query: 59  VLDPRTMRFLQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESLLARL 118
           VLDPRTMRFL+AL+NRG++S+FNGCLSTGKEANVYHA +G     A+   P+        
Sbjct: 56  VLDPRTMRFLRALVNRGVLSEFNGCLSTGKEANVYHALSG-----ATEGAPE-------- 102

Query: 119 TQEERAVQASVGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAE 178
                        K EYA+KI+KTSILVFKDRERYVDGEFRFRN+RS HNPRKMIKIWAE
Sbjct: 103 -------------KSEYAVKIYKTSILVFKDRERYVDGEFRFRNARSHHNPRKMIKIWAE 149

Query: 179 KEFRNLKRIYQSGAXXXXXXXXXXXXXXXMEFLNRGDGFASPRLRDYPYKDTDSIRQYYC 238
           KEFRNLKRIYQSG                MEFLNRGDGFASPRL+DYP+KD D I  YY 
Sbjct: 150 KEFRNLKRIYQSGVIPCPQPVEIKSNVLVMEFLNRGDGFASPRLKDYPFKDRDEIYHYYH 209

Query: 239 TLVAYMRLMYQVCGLVHADLSEYNVLVHNDRLYIIDVSQSVQPEHPMSLDFLRMDIKNVN 298
            +V+Y+RL+YQVC LVHADLSEYN +VH  +LYIIDVSQSVQPEHPMSLDFLRMDIKN+N
Sbjct: 210 VMVSYIRLLYQVCQLVHADLSEYNSIVHQSKLYIIDVSQSVQPEHPMSLDFLRMDIKNIN 269

Query: 299 LYFGKMGIDIFPERIIFQFVISESLDKFEGDYKSSKDLTEYVESNLPVKKTEQDEMEDEV 358
           +YF +MGIDIFPER+IFQFVISE+LDKF GD +S++DL  YV +NLP K+T QDE ED+V
Sbjct: 270 MYFERMGIDIFPERVIFQFVISETLDKFRGDMRSAEDLRSYVAANLPRKQTAQDEAEDQV 329

Query: 359 FRSLYLVRNLEGLEERDFDRFTEGKFDLLKSLLAHDMEK---NFTAAEQ 404
           FRSL+LVRNL GLEERDFDRFT+GKFDLLKSL+A D  K    FTA+EQ
Sbjct: 330 FRSLHLVRNLGGLEERDFDRFTDGKFDLLKSLIAQDNAKISNTFTASEQ 378

>TDEL0E01930 Chr5 (363913..365421) [1509 bp, 502 aa] {ON} Anc_5.432
           YOR119C
          Length = 502

 Score =  535 bits (1379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/402 (66%), Positives = 321/402 (79%), Gaps = 22/402 (5%)

Query: 1   MSVEEKFEKLSIDHHVKDDTANNKLLDKYAHKIKNDQFSFSKVKKTTKDKANRATVENVL 60
           MS+E++F++L I H    + AN ++LDK+++ IK D+ SF++  K++KDKANRATVENVL
Sbjct: 1   MSLEDQFDRLDISH--GREHANIQILDKHSNNIKTDELSFTR-SKSSKDKANRATVENVL 57

Query: 61  DPRTMRFLQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESLLARLTQ 120
           DPRTMRFL+++MNRG+IS+FNGCLSTGKEANVYHAFAG+ +         E+S       
Sbjct: 58  DPRTMRFLKSMMNRGVISEFNGCLSTGKEANVYHAFAGESI---------EDS------- 101

Query: 121 EERAVQASVGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKE 180
           ++  VQ   G KKE AIKI+KTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKE
Sbjct: 102 KDGHVQ---GEKKELAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKE 158

Query: 181 FRNLKRIYQSGAXXXXXXXXXXXXXXXMEFLNRGDGFASPRLRDYPYKDTDSIRQYYCTL 240
           FRNL+RI QSG                MEFL+RGDGFASPRL+D+ + D   I  YY T+
Sbjct: 159 FRNLRRINQSGVIPAPKPVEVKNNVLVMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTM 218

Query: 241 VAYMRLMYQVCGLVHADLSEYNVLVHNDRLYIIDVSQSVQPEHPMSLDFLRMDIKNVNLY 300
           +AY+RL+YQVC LVHADLSEYN +VH+ +LYIIDVSQSV+PEHPMSLDFLRMDIKN+N Y
Sbjct: 219 LAYIRLLYQVCRLVHADLSEYNAIVHDQKLYIIDVSQSVEPEHPMSLDFLRMDIKNINAY 278

Query: 301 FGKMGIDIFPERIIFQFVISESLDKFEGDYKSSKDLTEYVESNLPVKKTEQDEMEDEVFR 360
           F KMGIDIFPER+IFQFVISE+L+KF+G+ KSS DL+ YV   LPVK T  D  EDE+FR
Sbjct: 279 FEKMGIDIFPERLIFQFVISETLEKFDGNPKSSADLSNYVSKALPVKSTTGDVEEDEIFR 338

Query: 361 SLYLVRNLEGLEERDFDRFTEGKFDLLKSLLAHDMEKNFTAA 402
           SL+LVRNLEGLEERDFDRFT+GKFDLLKSL+AHD E++  AA
Sbjct: 339 SLHLVRNLEGLEERDFDRFTDGKFDLLKSLIAHDNERHLRAA 380

>Ecym_4763 Chr4 (1483168..1484784) [1617 bp, 538 aa] {ON} similar to
           Ashbya gossypii AER257W
          Length = 538

 Score =  512 bits (1318), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 259/409 (63%), Positives = 311/409 (76%), Gaps = 17/409 (4%)

Query: 1   MSVEEKFEKLSIDHHVKDDTANNKLLDKYAHKIKNDQFSFSKVKKTTKDKANRATVENVL 60
           M +E K  +L +  H + +  N+++LDK+A++IK D+ S ++  KT+KDKANRATVENVL
Sbjct: 33  MDLENKLGRLKLLDHSEHE--NSRILDKFANQIKTDELSVTR-GKTSKDKANRATVENVL 89

Query: 61  DPRTMRFLQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESLLARLTQ 120
           DPRTMRFL++L++RGII++FNGCLSTGKEANVYHAF         G   D      ++ +
Sbjct: 90  DPRTMRFLRSLIHRGIITEFNGCLSTGKEANVYHAF---------GNAVDIVEKQHKVIR 140

Query: 121 EERAVQASVGGKK--EYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAE 178
           +      S G  K  EYAIKI+KTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAE
Sbjct: 141 QSSICSDSEGDTKKVEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAE 200

Query: 179 KEFRNLKRIYQSGAXXXXXXXXXXXXXXXMEFLNRGDGFASPRLRDYPYKDTDSIRQYYC 238
           KEFRNLKRIY +G                MEFLNRGDGFASP+L+DYPY D   I  +Y 
Sbjct: 201 KEFRNLKRIYHTGVISCPKPIEIKSNVLVMEFLNRGDGFASPKLKDYPYSDRQEIYYFYH 260

Query: 239 TLVAYMRLMYQVCGLVHADLSEYNVLVHNDRLYIIDVSQSVQPEHPMSLDFLRMDIKNVN 298
            +VAY+RL+YQVC LVHADLSEYN +VH  +LYIIDVSQSVQPEHPMSLDFLRMDIKN+N
Sbjct: 261 VMVAYIRLLYQVCQLVHADLSEYNSIVHESKLYIIDVSQSVQPEHPMSLDFLRMDIKNIN 320

Query: 299 LYFGKMGIDIFPERIIFQFVISESLDKFEGDYKSSKDLTEYVESNLPVKKTEQDEMEDEV 358
            YF K+GI++F ER IFQFVISE L+KF+GDY+S   L +Y    LP+K TE+DE+EDE+
Sbjct: 321 AYFVKIGINVFSERAIFQFVISEKLEKFKGDYRSYDHLQKYASEYLPLKLTEEDEVEDEI 380

Query: 359 FRSLYLVRNLEGLEERDFDRFTEGKFDLLKSLLAHD---MEKNFTAAEQ 404
           FRSL+LVRNL GLEE DFDRFT GKFDLLKSL++ D   + K FTA+EQ
Sbjct: 381 FRSLHLVRNLGGLEEGDFDRFTNGKFDLLKSLVSQDNQKVAKTFTASEQ 429

>ZYRO0F09988g Chr6 complement(811306..812688) [1383 bp, 460 aa] {ON}
           similar to uniprot|Q12196 YOR119C Saccharomyces
           cerevisiae RIO1 Essential protein that plays a role in
           cell cycle progression
          Length = 460

 Score =  491 bits (1265), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 241/405 (59%), Positives = 297/405 (73%), Gaps = 36/405 (8%)

Query: 1   MSVEEKFEKLSIDHHVKDDTANNKLLDKYAHKIKNDQFSFSKVKKTTKDKANRATVENVL 60
           MS+E +F++L    HV     N ++L+KY ++I+N  F+  K  KT KDK++RATVENVL
Sbjct: 1   MSLETEFDRL----HVSKHQDNTRILEKYENRIENGGFTSGKGNKTYKDKSDRATVENVL 56

Query: 61  DPRTMRFLQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESLLARLTQ 120
           DPRTM+FL AL NRG+IS+FNGC+S+GKEANVYHAF  +G                    
Sbjct: 57  DPRTMKFLSALTNRGVISEFNGCISSGKEANVYHAFGPEG-------------------- 96

Query: 121 EERAVQASVGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKE 180
                       +E AIKI+KTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKE
Sbjct: 97  ------------QELAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKE 144

Query: 181 FRNLKRIYQSGAXXXXXXXXXXXXXXXMEFLNRGDGFASPRLRDYPYKDTDSIRQYYCTL 240
           FRNL+RI+ SG                M+FLNRGDG  SPRL+DY YKD   +  YY   
Sbjct: 145 FRNLRRIHSSGVVPTACPVEVKSNVLVMQFLNRGDGAPSPRLKDYQYKDELEVAHYYYKA 204

Query: 241 VAYMRLMYQVCGLVHADLSEYNVLVHNDRLYIIDVSQSVQPEHPMSLDFLRMDIKNVNLY 300
           +AYMRL+YQVC LVHADLSEYN++VH + L+IIDVSQSV+P HPMSLDFLRMDIKN+N Y
Sbjct: 205 IAYMRLLYQVCRLVHADLSEYNIVVHQNALHIIDVSQSVEPYHPMSLDFLRMDIKNINAY 264

Query: 301 FGKMGIDIFPERIIFQFVISESLDKFEGDYKSSKDLTEYVESNLPVKKTEQDEMEDEVFR 360
           FGKMG+ +F ER+IFQF+I+E+L+ F+GDYK++ DL EY+  +LP+K   +   EDE+FR
Sbjct: 265 FGKMGVSLFQERMIFQFIIAETLEGFQGDYKTADDLVEYLVEHLPLKTPTEGADEDEIFR 324

Query: 361 SLYLVRNLEGLEERDFDRFTEGKFDLLKSLLAHDMEKNFTAAEQQ 405
           SL+LVR+L GLEERDFDRFT+GKFDLLKSL+A+D E+N    +QQ
Sbjct: 325 SLHLVRSLGGLEERDFDRFTDGKFDLLKSLIANDNERNLQRPQQQ 369

>CAGL0H08019g Chr8 (781773..783050) [1278 bp, 425 aa] {ON} highly
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207w
          Length = 425

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 72/325 (22%), Positives = 131/325 (40%), Gaps = 63/325 (19%)

Query: 68  LQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESLLARLTQEERAVQA 127
           L+ L+N+ ++      +  GKE+++Y       VS  +GT        A++ +  R    
Sbjct: 85  LRTLLNQEVVYSVGNTIGVGKESDIYQ------VSDRNGT--------AKVMKIHR---- 126

Query: 128 SVGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRI 187
                      + +TS    K+   Y+      RNSR   N   + K+ A KEF  +  +
Sbjct: 127 -----------LGRTSFHTVKNNRDYL------RNSRQGTNWMHLSKLAASKEFEFMSML 169

Query: 188 YQSGAXXXXXXXXXXXXXXXMEFLNRGDGFASPRLRDYPYKDTDSIRQYYCTLVAYMRLM 247
           Y  G                M+ +   DG+   RLR++      +I + Y  L+ ++  +
Sbjct: 170 YAKG-FIVPQAYGCSRHVVVMDLI---DGYPMRRLREHK-----NIPKLYSDLMTFIVKL 220

Query: 248 YQVCGLVHADLSEYNVLVHNDR---------LYIIDVSQSVQPEHPMSLDFLRMDIKNVN 298
               GL+H D +E+N+++ ND            +ID  Q +  +H  +  + + D+  + 
Sbjct: 221 AN-SGLIHCDFNEFNIMIKNDEAVTDEKDCGFVVIDFPQCISIQHKDAEFYFKRDVDCIR 279

Query: 299 LYF-GKMGIDIFPERII-----FQFVISESLDKFEGDYKSSKDLTEYVESNLPVKKTEQD 352
            +F  K+  D  PE  +     F      +   F  D K + +L E ++++   KK   D
Sbjct: 280 RFFKKKLKYDPQPEAGMLDTDGFGEGYKYAYPDFNRDVKRTDNLDELMQASGYSKKHPGD 339

Query: 353 EMEDEVFRSLYLVRNLEGLEERDFD 377
              +E   S+   RN E   + D D
Sbjct: 340 RYLEEAVESM---RNAEYNSDDDID 361

>Kwal_23.4563 s23 (768125..769402) [1278 bp, 425 aa] {ON} YNL207W
           (RIO2) -  [contig 4] FULL
          Length = 425

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 52/274 (18%), Positives = 109/274 (39%), Gaps = 64/274 (23%)

Query: 68  LQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESLLARLTQEERAVQA 127
           L+A++NR  +      +  GKE++VY   A DG  R           + ++ +  R    
Sbjct: 85  LKAMLNRDTVYSIGNVIGVGKESDVYRVSAKDGTPR-----------VLKIHRLGRTSFT 133

Query: 128 SVGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRI 187
           +V   ++Y               +R   G + F           + ++ A KE++ +  +
Sbjct: 134 TVKNNRDYL--------------KRNQSGSWMF-----------LSRLAANKEYQFMSLL 168

Query: 188 YQSGAXXXXXXXXXXXXXXXMEFLNRGDGFASPRLRDYPYKDTDSIRQYYCTLVAYMRLM 247
           Y  G                M  +   DG+   R+R +      ++ + Y  L++++  +
Sbjct: 169 YSKG----FVVPEPFDNSRHMILMQLIDGYPMRRMRSHK-----NLPKLYSDLMSFIVKL 219

Query: 248 YQVCGLVHADLSEYNVLVHND-------RLYIIDVSQSVQPEHPMSLDFLRMDIKNVNLY 300
               GL+H D +E+N+++ N           +ID  Q +  +H  + ++ + D+  +  +
Sbjct: 220 AN-HGLIHCDFNEFNIMIKNKVTDADDCGFIVIDFPQCISIQHQDAEEYFKRDVDCIRRF 278

Query: 301 FGKMGIDIFPERIIFQFVISESL---DKFEGDYK 331
           F K        ++ ++ V+ ES+   D F   YK
Sbjct: 279 FAK--------KLKYEPVVDESMLDEDGFGDGYK 304

>NCAS0G01580 Chr7 (281438..282712) [1275 bp, 424 aa] {ON} Anc_2.44
          Length = 424

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 63/314 (20%), Positives = 120/314 (38%), Gaps = 70/314 (22%)

Query: 68  LQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESLLARLTQEERAVQA 127
           L+ ++NR  I    G +  GKE+++Y   A DG  R           + ++ +  R    
Sbjct: 85  LKTMLNRNTIYSIGGSIGVGKESDIYQVSAVDGNPR-----------VMKIHRLGRTSFH 133

Query: 128 SVGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRI 187
           +V   ++Y                         RN++   N   + ++ A KE++ +  +
Sbjct: 134 TVRNNRDY------------------------LRNTKQGVNWMYLSRLAANKEYQFMSML 169

Query: 188 YQSGAXXXXXXXXXXXXXXXMEFLNRGDGFASPRLRDYPYKDTDSIRQYYCTLVAYMRLM 247
           Y  G                ME +    G+   RLR +      +I + Y  L+ ++ + 
Sbjct: 170 YTKG-FEVPEPFDNSRHIIVMELIK---GYPMRRLRKHK-----NIPKLYSDLMNFI-VK 219

Query: 248 YQVCGLVHADLSEYNVLV------HND-RLYIIDVSQSVQPEHPMSLDFLRMDIKNVNLY 300
               GL+H D +E+N+++       ND    +ID  Q +  +H  +  + + D+  +  +
Sbjct: 220 LGNSGLIHCDFNEFNIMIKDKPEDENDCGFVVIDFPQCISIQHQDAAYYFQRDVDCIRRF 279

Query: 301 FGK------------MGIDIFPERIIFQFVISESLDKFEGDYKSSKDLTEYVESNLPVKK 348
           F K            +  D F E   + + +      FE D K   +L E V+++   KK
Sbjct: 280 FKKKLKYEPKSDSSMLDTDGFGEGYKYAYPV------FERDIKRCDNLDELVQASGFSKK 333

Query: 349 TEQDEMEDEVFRSL 362
              D   +E   S+
Sbjct: 334 HPGDRSLEEAVESM 347

>Kpol_400.7 s400 complement(15841..17118) [1278 bp, 425 aa] {ON}
           complement(15841..17118) [1278 nt, 426 aa]
          Length = 425

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 57/314 (18%), Positives = 124/314 (39%), Gaps = 70/314 (22%)

Query: 68  LQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESLLARLTQEERAVQA 127
           L++L+N+  +      +  GKE+++Y A   +G  R           + ++ +  R    
Sbjct: 85  LKSLLNKDTVYSVGNTIGVGKESDIYQASDRNGEHR-----------VMKIHRLGRTSFH 133

Query: 128 SVGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRI 187
           +V   ++Y  K  + +  +F                        + ++ A KE++ +  +
Sbjct: 134 TVKNNRDYLKKYNQGASWMF------------------------LSRVAANKEYQFMSLL 169

Query: 188 YQSGAXXXXXXXXXXXXXXXMEFLNRGDGFASPRLRDYPYKDTDSIRQYYCTLVAYMRLM 247
           Y  G                ME +    GF   RLR +     D+I + Y  L+ ++  +
Sbjct: 170 YSKG-FTVPKAFDNSRHIVVMELIK---GFPLRRLRKH-----DNIPKLYSDLMCFIVNL 220

Query: 248 YQVCGLVHADLSEYNVLVHNDR-------LYIIDVSQSVQPEHPMSLDFLRMDIKNVNLY 300
               GL+H D +E+N+++ +++         +ID  Q +  +H  +  + + D+  +  +
Sbjct: 221 AN-SGLIHCDFNEFNIMIKDEKDDENDCGFIVIDFPQCISIQHKDADFYFKRDVDCIRRF 279

Query: 301 FGK------------MGIDIFPERIIFQFVISESLDKFEGDYKSSKDLTEYVESNLPVKK 348
           F K            + +D F +   +Q+ +      F  D + + +L E V+++   KK
Sbjct: 280 FKKKLKYEPQSDSTMLDLDGFGDGYKYQYPV------FSRDVERTDNLDELVQASGFSKK 333

Query: 349 TEQDEMEDEVFRSL 362
              D   +E   S+
Sbjct: 334 HPGDRYLEEAVESM 347

>NDAI0F03600 Chr6 complement(860282..861547) [1266 bp, 421 aa] {ON}
           Anc_2.44 YNL207W
          Length = 421

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 43/243 (17%), Positives = 97/243 (39%), Gaps = 51/243 (20%)

Query: 68  LQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESLLARLTQEERAVQA 127
           L+ ++NR  +    G +  GKE+++Y     +GVS+           + ++ +  R    
Sbjct: 85  LKTMLNRDTVYSIGGSIGVGKESDIYQVSDKNGVSK-----------VMKIHRLGRTSFH 133

Query: 128 SVGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRI 187
           +V   ++Y  K  K  +                       N   + ++ A KE++ +  +
Sbjct: 134 TVRNNRDYLKKNVKNGV-----------------------NWMYLSQLAANKEYQFMSML 170

Query: 188 YQSGAXXXXXXXXXXXXXXXMEFLNRGDGFASPRLRDYPYKDTDSIRQYYCTLVAYMRLM 247
           Y  G                +  +   +G+   RLR +     ++I + Y  L+ ++  +
Sbjct: 171 YTKG----FEVPEPFDNSRHIIIMGLIEGYPMRRLRKH-----NNIPKLYNDLMKFIVRL 221

Query: 248 YQVCGLVHADLSEYNVLVHND-------RLYIIDVSQSVQPEHPMSLDFLRMDIKNVNLY 300
               GL+H D +E+N+++ ++          +ID  Q +  +HP +  + + D+  +  +
Sbjct: 222 AN-SGLIHCDFNEFNIMIKDEVEDENDCGFVVIDFPQCISIQHPDAEFYFQRDVDCIRRF 280

Query: 301 FGK 303
           F K
Sbjct: 281 FKK 283

>KAFR0A07760 Chr1 complement(1560351..1561628) [1278 bp, 425 aa]
           {ON} Anc_2.44 YNL207W
          Length = 425

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 49/243 (20%), Positives = 103/243 (42%), Gaps = 51/243 (20%)

Query: 68  LQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESLLARLTQEERAVQA 127
           L+ ++NR  +    G +  GKE+++Y       VS  +GT              E+ ++ 
Sbjct: 85  LKTMLNRETVYSVGGTIGVGKESDIYR------VSDRNGT--------------EKVMKI 124

Query: 128 SVGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRI 187
                     ++ +TS    K++  Y+      +N+++  N   + KI A KE++ +  +
Sbjct: 125 H---------RLGRTSFHTVKNKRDYIK-----KNAKNGVNWMYLSKIAAGKEYQFMTLL 170

Query: 188 YQSGAXXXXXXXXXXXXXXXMEFLNRGDGFASPRLRDYPYKDTDSIRQYYCTLVAYMRLM 247
           +  G                ME +    G+   RLR +      +I + Y  L++++ + 
Sbjct: 171 FAKG-FDVPEAFDCSRHCIVMELIK---GYPMRRLRKHK-----NIPKLYSDLMSFI-VK 220

Query: 248 YQVCGLVHADLSEYNVLV------HNDRLY-IIDVSQSVQPEHPMSLDFLRMDIKNVNLY 300
               GL+H D +E+N+++       ND  + +ID  Q +  +H  +  + + D+  +  +
Sbjct: 221 LGNSGLIHCDFNEFNIMIKDKVEDENDPGFVVIDFPQCISIQHNDAEFYFKRDVDCIRRF 280

Query: 301 FGK 303
           F K
Sbjct: 281 FKK 283

>Suva_14.136 Chr14 (250349..251629) [1281 bp, 426 aa] {ON} YNL207W
           (REAL)
          Length = 426

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 65/308 (21%), Positives = 119/308 (38%), Gaps = 65/308 (21%)

Query: 68  LQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESLLARLTQEERAVQA 127
           L+ ++NR  +      +  GKE+++Y     DG  R                        
Sbjct: 85  LKTMLNRDTVYSVGNTIGVGKESDIYKVSDKDGNPRV----------------------- 121

Query: 128 SVGGKKEYAIKIFK---TSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL 184
                    IKI +   TS    ++   Y+      R S    N   + ++ A KE++ +
Sbjct: 122 ---------IKIHRLGRTSFHTVRNNRDYL------RKSSQGANWMHLSRLAANKEYQFM 166

Query: 185 KRIYQSGAXXXXXXXXXXXXXXXMEFLNRGDGFASPRLRDYPYKDTDSIRQYYCTLVAYM 244
             +Y  G                ME +N   GF   RLR +      +I + Y  L+ ++
Sbjct: 167 SMLYSKG-FKVPEPFDNSRHIVVMELIN---GFPMRRLRKHK-----NIPKLYSDLMCFI 217

Query: 245 RLMYQVCGLVHADLSEYNVLVHND-------RLYIIDVSQSVQPEHPMSLDFLRMDIKNV 297
            +     GL+H D +E+NV++ ++          +ID  Q V  +H  +  + + D+  +
Sbjct: 218 -VQLGNSGLIHCDFNEFNVMIKDELEDENDCGFVVIDFPQCVSIQHQDADYYFQRDVDCI 276

Query: 298 NLYF-GKMGIDIFPERII-----FQFVISESLDKFEGDYKSSKDLTEYVESNLPVKKTEQ 351
             +F  K+  +  P+  +     F      +  +F+ D K S +L E V+++   KK   
Sbjct: 277 RRFFKKKLKYEPKPDSSMLDTDGFGDGYKYAYPEFKRDIKRSDNLDELVQASGFSKKHPG 336

Query: 352 D-EMEDEV 358
           D  +ED V
Sbjct: 337 DRSLEDAV 344

>TPHA0H00920 Chr8 complement(188834..190123) [1290 bp, 429 aa] {ON}
           Anc_2.44 YNL207W
          Length = 429

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 48/243 (19%), Positives = 96/243 (39%), Gaps = 52/243 (21%)

Query: 68  LQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESLLARLTQEERAVQA 127
           L++L+N+  +    G +  GKE+++Y     +G                     +R ++ 
Sbjct: 85  LKSLLNKDTVYSIGGTIGVGKESDIYEGSDKNG--------------------NKRVLKI 124

Query: 128 SVGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRI 187
                     ++ +TS    K+   Y+      R S    N   + K+ A KE++ +  +
Sbjct: 125 H---------RLGRTSFHTVKNNRDYL------RRSNQGTNWMNLSKLAANKEYQFMSLL 169

Query: 188 YQSGAXXXXXXXXXXXXXXXMEFLNRGDGFASPRLRDYPYKDTDSIRQYYCTLVAYMRLM 247
           Y  G                ME +    G+   RLR   +KD   I + Y  L+ ++ L 
Sbjct: 170 YTKG-FKVPEPFDNSRHVIVMELIR---GYPMRRLR--KHKD---IPKLYSDLMKFI-LQ 219

Query: 248 YQVCGLVHADLSEYNVLVHND-------RLYIIDVSQSVQPEHPMSLDFLRMDIKNVNLY 300
               GL+H D +E+N+++ ++          +ID  Q +  +H  +  + + D+  +  +
Sbjct: 220 LANSGLIHCDFNEFNIMIKDEVEDENDCGFVVIDFPQCISIQHKDADFYFKRDVDGIRRF 279

Query: 301 FGK 303
           F K
Sbjct: 280 FKK 282

>Smik_14.125 Chr14 (234660..235922) [1263 bp, 420 aa] {ON} YNL207W
           (REAL)
          Length = 420

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 46/243 (18%), Positives = 93/243 (38%), Gaps = 52/243 (21%)

Query: 68  LQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESLLARLTQEERAVQA 127
           L+ ++NR  +      +  GKE+++Y     +G  R           + ++ +  R    
Sbjct: 85  LKTMLNRDTVYSVGNTIGVGKESDIYKVSDKNGKPR-----------VMKIHRLGRTSFH 133

Query: 128 SVGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRI 187
           SV   ++Y                         RNS    N   + ++ A KE++ +  +
Sbjct: 134 SVRNNRDY------------------------LRNSNQGANWMHLSRLAANKEYQFMSML 169

Query: 188 YQSGAXXXXXXXXXXXXXXXMEFLNRGDGFASPRLRDYPYKDTDSIRQYYCTLVAYMRLM 247
           Y  G                ME +   +G+   RLR +      +I + Y  L+ ++  +
Sbjct: 170 YSKG-FKVPEPFDNSRHIVVMELI---EGYPMRRLRKHK-----NIPKLYSDLMCFIVEL 220

Query: 248 YQVCGLVHADLSEYNVLVHND-------RLYIIDVSQSVQPEHPMSLDFLRMDIKNVNLY 300
               GL+H D +E+N+++ N+          +ID  Q V  +H  +  + + D+  +  +
Sbjct: 221 AN-SGLIHCDFNEFNIMIKNEVEDEKDCGFVVIDFPQCVSIQHQDADYYFQRDVDCIRRF 279

Query: 301 FGK 303
           F K
Sbjct: 280 FKK 282

>TDEL0A00860 Chr1 (143723..144982) [1260 bp, 419 aa] {ON} Anc_2.44
           YNL207W
          Length = 419

 Score = 39.3 bits (90), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 63/319 (19%), Positives = 125/319 (39%), Gaps = 69/319 (21%)

Query: 68  LQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESLLARLTQEERAVQA 127
           +++++NR  +  F   +  GKE+++Y     +GV              A++ +  R    
Sbjct: 85  VKSMLNRDTVYSFGNTIGVGKESDIYQVSDKNGV--------------AKVMKIHR---- 126

Query: 128 SVGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRI 187
                      + +TS    K+   Y+      + +    N   +  + A+KE++ +  +
Sbjct: 127 -----------LGRTSFHTVKNNRDYL------KKNAHGTNWMHLSLLAAQKEYQFMSLL 169

Query: 188 YQSGAXXXXXXXXXXXXXXXMEFLNRGDGFASPRLRDYPYKDTDSIRQYYCTLVAYMRLM 247
           Y  G                ME +   DGF    LR++      +I + Y  L+ +   +
Sbjct: 170 YSKG-FIVPQPYDNSRHIVLMELI---DGFPMRNLRNHS-----NIPKLYSDLMTFAVKL 220

Query: 248 YQVCGLVHADLSEYNVLVHND-------RLYIIDVSQSVQPEHPMSLDFLRMDIKNVNLY 300
               GL+H D +E+N+++ N           +ID  Q +  +H  +  + + DI+ +  +
Sbjct: 221 AN-SGLIHCDFNEFNIMIKNTVEDSKDCGFVVIDFPQCISIQHKDADFYFQRDIECIRRF 279

Query: 301 F-GKMGIDIFPERII---------FQFVISESLDKFEGDYKSSKDLTEYVESNLPVKKTE 350
           F  K+  D  P+  +         +++   E    FE D     +L E V+++   KK  
Sbjct: 280 FRKKLKYDPTPDPTMLDEDGYGDGYRYAYPE----FERDVHRCDNLDELVQASGFSKKHP 335

Query: 351 QDEMEDEVFRSLYLVRNLE 369
            D   +E   S+   RN E
Sbjct: 336 GDRSLEEAVDSM---RNAE 351

>ABL166W Chr2 (88546..89790) [1245 bp, 414 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YNL207W (RIO2)
          Length = 414

 Score = 37.4 bits (85), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 47/244 (19%), Positives = 98/244 (40%), Gaps = 55/244 (22%)

Query: 68  LQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESLLARLTQEERAVQA 127
           L++L+ +  I      +  GKE+++Y       VS A+      +SL+ ++ +  R    
Sbjct: 85  LKSLLEKNAIYSVGNTIGVGKESDIYQ------VSDAA-----SQSLVMKIHRLGRTSFH 133

Query: 128 SVGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQH-NPRKMIKIWAEKEFRNLKR 186
           +V  K+EY                            R Q  N  ++  + AE+E+  +  
Sbjct: 134 TVKTKREYL--------------------------KRGQSANWMRLSHLSAEREYAYMCL 167

Query: 187 IYQSGAXXXXXXXXXXXXXXXMEFLNRGDGFASPRLRDYPYKDTDSIRQYYCTLVAYMRL 246
           +Y  G                ME++    G+   RLR +      ++ + Y  L+A++  
Sbjct: 168 LYSKG-FSVPKPYANSRHAIVMEYIR---GYPMRRLRSHS-----NVPKLYSDLMAFVVK 218

Query: 247 MYQVCGLVHADLSEYNVLVHND-------RLYIIDVSQSVQPEHPMSLDFLRMDIKNVNL 299
           +    G++H D +E+N+++ +D          +ID  Q +  +H  +  + + D+  +  
Sbjct: 219 LAN-HGMIHCDFNEFNIMIKDDIDDPEDQGFVVIDFPQCISIQHQEAEYYFKRDVDCIRR 277

Query: 300 YFGK 303
           +F K
Sbjct: 278 FFKK 281

>KLTH0B07722g Chr2 complement(625231..626517) [1287 bp, 428 aa] {ON}
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207W RIO2 Protein required for cell viability
          Length = 428

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 58/310 (18%), Positives = 120/310 (38%), Gaps = 71/310 (22%)

Query: 68  LQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESLLARLTQEERAVQA 127
           L+A+++R  I      +  GKE++VY   A DG +R           + ++ +  R    
Sbjct: 85  LRAMLSRDTIYSVGNVIGVGKESDVYRVSAKDGSAR-----------VLKIHRLGRTSFT 133

Query: 128 SVGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRI 187
           +V   ++Y               +R   G + F           + ++ A KE++ +  +
Sbjct: 134 TVKNNRDYL--------------KRNQSGSWMF-----------LSRLAANKEYQFMSLL 168

Query: 188 YQSGAXXXXXXXXXXXXXXXMEFLNRGDGFASPRLRDYPYKDTDSIRQYYCTLVAYMRLM 247
           +  G                ME +   DG+    +R +      ++ + Y  L+ ++  +
Sbjct: 169 HSKG-FTVPEPFDNSRHMILMELI---DGYPMRNMRLHK-----NLPKLYSDLMLFIVKL 219

Query: 248 YQVCGLVHADLSEYNVLVHN-------DRLYIIDVSQSVQPEHPMSLDFLRMDIKNVNLY 300
               GL+H D +E+N+++ N       +   +ID  Q +  +H  +  F + D+  +  +
Sbjct: 220 AN-HGLIHCDFNEFNIMIKNSVTGPEDNGFIVIDFPQCISIQHQDAEFFFKRDVDCIRRF 278

Query: 301 FGK------------MGIDIFPERIIFQFVISESLDKFEGDYKSSKDLTEYVESNLPVKK 348
           F K            + +D F +   + + +      FE D K   +L E V+++   KK
Sbjct: 279 FKKKLKFEPRVDESMLDVDGFGDGYKYPYPV------FERDVKRCDNLDELVQASGFSKK 332

Query: 349 TEQDEMEDEV 358
              D   +E 
Sbjct: 333 HPGDRRWEEA 342

>ZYRO0C10340g Chr3 complement(793323..794573) [1251 bp, 416 aa] {ON}
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207W RIO2 Protein required for cell viability
          Length = 416

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 48/244 (19%), Positives = 95/244 (38%), Gaps = 53/244 (21%)

Query: 68  LQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESLLARLTQEERAVQA 127
           ++A++NR  +      +  GKE+++Y       VS  +G      + + ++ +  R    
Sbjct: 85  IKAMLNRDTVYSIGNTIGVGKESDIYK------VSDRNGN-----AQVMKIHRLGRTSFT 133

Query: 128 SVGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRI 187
           SV   ++Y                         ++SR   +   +  + A KE+  L  +
Sbjct: 134 SVRNNRDY------------------------LKHSRQGTSWMHLSLLAAHKEYEFLALL 169

Query: 188 YQSGAXXXXXXXXXXXXXXXMEFLNRGDGFASPRLRDYPYKDTDSIRQYYCTLVAYMRLM 247
           +  G                MEF+    GF    LR +      +I + Y  L+ +   +
Sbjct: 170 HSRG-FQVPEAFDNSRHMVLMEFIK---GFPMKNLRTHS-----NIPKLYSDLMKFAVDL 220

Query: 248 YQVCGLVHADLSEYNVLVHND--------RLYIIDVSQSVQPEHPMSLDFLRMDIKNVNL 299
            +  GL+H D +E+N+++ +            +ID  Q +  +HP +  F R DI+ +  
Sbjct: 221 AK-SGLIHCDYNEFNIMIKDQDTTDSSDCGFVVIDFPQCISIQHPDAEFFFRRDIECIRR 279

Query: 300 YFGK 303
           +F K
Sbjct: 280 FFKK 283

>Skud_14.129 Chr14 (244224..245501) [1278 bp, 425 aa] {ON} YNL207W
           (REAL)
          Length = 425

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 45/243 (18%), Positives = 92/243 (37%), Gaps = 52/243 (21%)

Query: 68  LQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESLLARLTQEERAVQA 127
           L+ ++NR  +      +  GKE+++Y     +G  R           + ++ +  R    
Sbjct: 85  LKTMLNRNTVYSVGNTIGVGKESDIYKVSDKNGNPR-----------VMKIHRLGRTSFH 133

Query: 128 SVGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRI 187
           SV   ++Y                         +NS    N   + ++ A KE++ +  +
Sbjct: 134 SVRNNRDY------------------------LKNSNQGANWMHLSRLAANKEYQFMSML 169

Query: 188 YQSGAXXXXXXXXXXXXXXXMEFLNRGDGFASPRLRDYPYKDTDSIRQYYCTLVAYMRLM 247
           Y  G                ME +   +G+   RLR +      +I + Y  L+ ++  +
Sbjct: 170 YSKG-FKVPEPFDNSRHIVVMELI---EGYPMRRLRKHK-----NIPKLYSDLMCFVVEL 220

Query: 248 YQVCGLVHADLSEYNVLVHND-------RLYIIDVSQSVQPEHPMSLDFLRMDIKNVNLY 300
               GL+H D +E+N++V +           +ID  Q V  +H  +  + + D+  +  +
Sbjct: 221 AN-SGLIHCDFNEFNIMVKDKVEDEQDCGFVVIDFPQCVSIQHQDADYYFQRDVDCIRRF 279

Query: 301 FGK 303
           F K
Sbjct: 280 FKK 282

>Ecym_1119 Chr1 complement(244327..246702) [2376 bp, 791 aa] {ON}
           similar to Ashbya gossypii AFR647C
          Length = 791

 Score = 35.0 bits (79), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 32/49 (65%), Gaps = 3/49 (6%)

Query: 139 IFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRI 187
           +F+T  + F+D++R+ +G    R   +QH+P +++K+    E+ ++KR+
Sbjct: 312 LFETKPMYFEDQKRFFNGVIEIR---TQHDPLELLKLCKRIEYEDMKRV 357

>KNAG0F01060 Chr6 (188811..190097) [1287 bp, 428 aa] {ON} Anc_2.44
           YNL207W
          Length = 428

 Score = 34.3 bits (77), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 61/313 (19%), Positives = 123/313 (39%), Gaps = 72/313 (23%)

Query: 68  LQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESLLARLTQEERAVQA 127
           L+ ++NR  +      +  GKE+++Y     +GV                    E+ ++ 
Sbjct: 85  LKTMLNRDSLYSVGNTIGVGKESDIYKVSDKNGV--------------------EKVMKI 124

Query: 128 SVGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRI 187
                     ++ +TS    ++   Y+      +NS++  N   + K+ A KE++ +  +
Sbjct: 125 H---------RLGRTSFHTVRNNRDYLR-----KNSKNGANWMFLSKLAAAKEYQFMSLL 170

Query: 188 YQSGAXXXXXXXXXXXXXXXMEFLNRGDGFASPRLRDYPYKDTDSIRQYYCTLVAYMRLM 247
           +  G                ME +    GF   RLR +      ++ + Y  L+ ++ L 
Sbjct: 171 HSRG-FRVPEPFDHSRHIIIMELIK---GFPMTRLRKH-----QNVPKLYSDLMKFI-LE 220

Query: 248 YQVCGLVHADLSEYNVLVH--------NDRLYI-IDVSQSVQPEHPMSLDFLRMDIKNVN 298
               GL+H D +E+N+++         ND  +I ID  Q +  +H  +  + + D+  + 
Sbjct: 221 LGNSGLIHCDFNEFNIMIKDKLDGSDPNDTGFIVIDFPQCISIQHQDASFYFQRDVDCIR 280

Query: 299 LYFGK------------MGIDIFPERIIFQFVISESLDKFEGDYKSSKDLTEYVESNLPV 346
            +F K            +  D F +   + +        FE D K   +L E ++++   
Sbjct: 281 RFFKKKMKYEPKTDSTLLDTDGFGDGYKYPYP------DFERDVKRQDNLDELLQASGYT 334

Query: 347 KKTEQD-EMEDEV 358
           KK   D ++ED V
Sbjct: 335 KKHPGDRDLEDAV 347

>SAKL0E13552g Chr5 complement(1118842..1120101) [1260 bp, 419 aa]
           {ON} highly similar to uniprot|P40160 YNL207W
           Saccharomyces cerevisiae RIO2 Protein required for cell
           viability
          Length = 419

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 45/243 (18%), Positives = 92/243 (37%), Gaps = 53/243 (21%)

Query: 68  LQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESLLARLTQEERAVQA 127
           L+A++NR  +      +  GKE+++Y     +G SR           + RL         
Sbjct: 85  LKAMLNRDTVYSIGATIGVGKESDIYQVSDRNGNSRVMK--------IHRLG-------- 128

Query: 128 SVGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRI 187
                        +TS    K+   Y+ G       R   +   + ++ A KE++ +  +
Sbjct: 129 -------------RTSFQTVKNNRDYLKG-------RQSASWMFLSRLAANKEYQFMSLL 168

Query: 188 YQSGAXXXXXXXXXXXXXXXMEFLNRGDGFASPRLRDYPYKDTDSIRQYYCTLVAYMRLM 247
           Y  G                ME +    G+   RLR +       + + Y  L+ ++ + 
Sbjct: 169 YSKG-FKVPEPFDNSRHIILMELIK---GYPMRRLRKH-----HDLPKLYSDLMCFI-VN 218

Query: 248 YQVCGLVHADLSEYNVLVHND-------RLYIIDVSQSVQPEHPMSLDFLRMDIKNVNLY 300
               GL+H D +E+N+++ ++          +ID  Q +  +H  +  + + D+  +  +
Sbjct: 219 LANHGLIHCDFNEFNIMIKDEVDDENDCGFVVIDFPQCISIQHKDAEYYFQRDVDCIRRF 278

Query: 301 FGK 303
           F K
Sbjct: 279 FKK 281

>YNL207W Chr14 (255353..256630) [1278 bp, 425 aa] {ON}
           RIO2Essential serine kinase involved in the processing
           of the 20S pre-rRNA into mature 18S rRNA; has similarity
           to Rio1p
          Length = 425

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 44/243 (18%), Positives = 92/243 (37%), Gaps = 52/243 (21%)

Query: 68  LQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESLLARLTQEERAVQA 127
           L+ ++NR  +      +  GKE+++Y     +G  R           + ++ +  R    
Sbjct: 85  LKTMLNRDTVYSVGNTIGVGKESDIYKVSDKNGNPR-----------VMKIHRLGRTSFH 133

Query: 128 SVGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRI 187
           SV   ++Y                         + S    N   + ++ A KE++ +  +
Sbjct: 134 SVRNNRDY------------------------LKKSNQGANWMHLSRLAANKEYQFMSML 169

Query: 188 YQSGAXXXXXXXXXXXXXXXMEFLNRGDGFASPRLRDYPYKDTDSIRQYYCTLVAYMRLM 247
           Y  G                ME +   +G+   RLR +      +I + Y  L+ ++  +
Sbjct: 170 YSKG-FKVPEPFDNSRHIVVMELI---EGYPMRRLRKHK-----NIPKLYSDLMCFIVDL 220

Query: 248 YQVCGLVHADLSEYNVLV------HND-RLYIIDVSQSVQPEHPMSLDFLRMDIKNVNLY 300
               GL+H D +E+N+++       ND    +ID  Q +  +H  +  + + D+  +  +
Sbjct: 221 AN-SGLIHCDFNEFNIMIKDKLEDENDCGFVVIDFPQCISIQHQDADYYFQRDVDCIRRF 279

Query: 301 FGK 303
           F K
Sbjct: 280 FKK 282

>TDEL0F04700 Chr6 complement(883407..885593) [2187 bp, 728 aa]
          {ON} Anc_8.346 YLR139C
          Length = 728

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 33/69 (47%), Gaps = 10/69 (14%)

Query: 1  MSVEEKFEKLSIDHHVKDDTANNKLLDKYAHKIKNDQFSFSKVKKTTKDKANRATVENVL 60
          MS+E     L     V DD+  N+LL      I ND F+ ++ KK   DKAN      VL
Sbjct: 30 MSMESNEAILRSTPEVVDDSITNQLL------ILNDTFNATRGKKRKPDKANIV----VL 79

Query: 61 DPRTMRFLQ 69
          DP+    L+
Sbjct: 80 DPKQAGLLK 88

>NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177
           YAR019C
          Length = 897

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 23/101 (22%), Positives = 50/101 (49%), Gaps = 2/101 (1%)

Query: 208 MEFLNRGDGFASPRLRDYPYKDTDSIRQYYCTLVAYMRLMYQVCGLVHADLSEYNVLVH- 266
           ME+   G+ F + + R+    D D+ + Y   ++A +  ++ + G ++ DL   N+L+H 
Sbjct: 569 MEYCMGGEFFRALQTRESKCIDEDAAQFYASEVIAALEYLH-LLGFIYRDLKPENILLHK 627

Query: 267 NDRLYIIDVSQSVQPEHPMSLDFLRMDIKNVNLYFGKMGID 307
           +  + + D   S+Q +   +  F++  I + N     + ID
Sbjct: 628 SGHIMLSDFDLSIQAKDSKNPTFMKNGILSTNNSNSNLIID 668

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,659,067
Number of extensions: 1862548
Number of successful extensions: 6846
Number of sequences better than 10.0: 67
Number of HSP's gapped: 7075
Number of HSP's successfully gapped: 70
Length of query: 496
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 382
Effective length of database: 40,409,475
Effective search space: 15436419450
Effective search space used: 15436419450
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)