Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0C049205.433ON21721711411e-160
CAGL0A02794g5.433ON2162107721e-104
KAFR0E039305.433ON2112167382e-99
NCAS0F033705.433ON2112197373e-99
YDR367W (KEI1)5.433ON2212147357e-99
Suva_2.5395.433ON2272207314e-98
Smik_4.6335.433ON2212177029e-94
Skud_4.6365.433ON2342206994e-93
Kpol_1062.305.433ON2142116889e-92
TDEL0E019205.433ON2202136723e-89
TPHA0E017705.433ON2172096323e-83
ZYRO0F10010g5.433ON2082106141e-80
SAKL0G02508g5.433ON2282206073e-79
Kwal_55.214325.433ON2072065706e-74
TBLA0A065205.433ON2062095446e-70
TBLA0G020105.433ON2132025255e-67
AER256C5.433ON2392215172e-65
NDAI0B056605.433ON1611655058e-65
KLTH0F16082g5.433ON2062065091e-64
KLLA0E21099g5.433ON2242184952e-62
Ecym_47625.433ON2212194934e-62
TPHA0F007204.129ON128353664.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0C04920
         (217 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0C04920 Chr3 complement(950839..951462,951584..951613) [654 ...   444   e-160
CAGL0A02794g Chr1 (295534..295563,295751..296371) [651 bp, 216 a...   301   e-104
KAFR0E03930 Chr5 (777060..777089,777170..777775) [636 bp, 211 aa...   288   2e-99
NCAS0F03370 Chr6 (681041..681070,681141..681746) [636 bp, 211 aa...   288   3e-99
YDR367W Chr4 (1212848..1212877,1212979..1213614) [666 bp, 221 aa...   287   7e-99
Suva_2.539 Chr2 (963328..963357,963470..964123) [684 bp, 227 aa]...   286   4e-98
Smik_4.633 Chr4 (1132870..1132899,1133000..1133635) [666 bp, 221...   275   9e-94
Skud_4.636 Chr4 (1135660..1135689,1135789..1136463) [705 bp, 234...   273   4e-93
Kpol_1062.30 s1062 complement(66657..67301) [645 bp, 214 aa] {ON...   269   9e-92
TDEL0E01920 Chr5 complement(363042..363665,363727..363765) [663 ...   263   3e-89
TPHA0E01770 Chr5 complement(356743..357396) [654 bp, 217 aa] {ON...   248   3e-83
ZYRO0F10010g Chr6 (812835..812861,812941..813540) [627 bp, 208 a...   241   1e-80
SAKL0G02508g Chr7 (207823..207855,207940..208593) [687 bp, 228 a...   238   3e-79
Kwal_55.21432 s55 complement(834129..834752) [624 bp, 207 aa] {O...   224   6e-74
TBLA0A06520 Chr1 complement(1599308..1599928) [621 bp, 206 aa] {...   214   6e-70
TBLA0G02010 Chr7 (525436..526077) [642 bp, 213 aa] {ON} Anc_5.43...   206   5e-67
AER256C Chr5 complement(1109526..1110152,1110213..1110305) [720 ...   203   2e-65
NDAI0B05660 Chr2 (1382276..1382761) [486 bp, 161 aa] {ON} Anc_5....   199   8e-65
KLTH0F16082g Chr6 complement(1305673..1306293) [621 bp, 206 aa] ...   200   1e-64
KLLA0E21099g Chr5 complement(1885338..1885976,1886092..1886127) ...   195   2e-62
Ecym_4762 Chr4 complement(1482336..1482983,1483049..1483066) [66...   194   4e-62
TPHA0F00720 Chr6 (162768..166619) [3852 bp, 1283 aa] {ON} Anc_4....    30   4.8  

>KNAG0C04920 Chr3 complement(950839..951462,951584..951613) [654 bp,
           217 aa] {ON} Anc_5.433 YDR367W
          Length = 217

 Score =  444 bits (1141), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 217/217 (100%), Positives = 217/217 (100%)

Query: 1   MTKLSSSLPKTFFGIFPLYIGVEIVLGVTLLNKCSGAFGILALFTGHPLDLMQWASYLWS 60
           MTKLSSSLPKTFFGIFPLYIGVEIVLGVTLLNKCSGAFGILALFTGHPLDLMQWASYLWS
Sbjct: 1   MTKLSSSLPKTFFGIFPLYIGVEIVLGVTLLNKCSGAFGILALFTGHPLDLMQWASYLWS 60

Query: 61  VFTLVVYAQGLYQIHKPKLLTFSQIVVVFSIDTVLTCLFTLWFTGVWFAEESNTDAAMGT 120
           VFTLVVYAQGLYQIHKPKLLTFSQIVVVFSIDTVLTCLFTLWFTGVWFAEESNTDAAMGT
Sbjct: 61  VFTLVVYAQGLYQIHKPKLLTFSQIVVVFSIDTVLTCLFTLWFTGVWFAEESNTDAAMGT 120

Query: 121 AASAVARLVKRGAEIDTQGATESYEYVFTIIITMVSLVFRLYFNFLLASFVQELLRHPQY 180
           AASAVARLVKRGAEIDTQGATESYEYVFTIIITMVSLVFRLYFNFLLASFVQELLRHPQY
Sbjct: 121 AASAVARLVKRGAEIDTQGATESYEYVFTIIITMVSLVFRLYFNFLLASFVQELLRHPQY 180

Query: 181 LVDQDDIEQDLKNKFFLRRWWVVSQKSSYSICRHVLV 217
           LVDQDDIEQDLKNKFFLRRWWVVSQKSSYSICRHVLV
Sbjct: 181 LVDQDDIEQDLKNKFFLRRWWVVSQKSSYSICRHVLV 217

>CAGL0A02794g Chr1 (295534..295563,295751..296371) [651 bp, 216 aa]
           {ON} highly similar to uniprot|Q06346 Saccharomyces
           cerevisiae YDR367w
          Length = 216

 Score =  301 bits (772), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 134/210 (63%), Positives = 172/210 (81%), Gaps = 1/210 (0%)

Query: 7   SLPKTFFGIFPLYIGVEIVLGVTLLNKCSGAFGILALFTGHPLDLMQWASYLWSVFTLVV 66
           S PK+FFG  PLY+GVEIVLG+T+LNKCSGA+GILALFTGHPLD MQW SYLWSVFTL+V
Sbjct: 7   SFPKSFFGFLPLYLGVEIVLGITILNKCSGAYGILALFTGHPLDYMQWISYLWSVFTLIV 66

Query: 67  YAQGLYQIHKPKLLTFSQIVVVFSIDTVLTCLFTLWFTGVWFAEESNTDAAMGTAASAVA 126
           ++QGL+ IHKPKL+ FSQI+V F+ DTVLTC FTLWF+  WF + +N +    +A   V+
Sbjct: 67  FSQGLFMIHKPKLIVFSQILVYFTADTVLTCFFTLWFSAQWF-QSANEEKHETSAPVGVS 125

Query: 127 RLVKRGAEIDTQGATESYEYVFTIIITMVSLVFRLYFNFLLASFVQELLRHPQYLVDQDD 186
           +  +R  ++ +QGA+E YEY  T++ T+V+L+FR+YFNF+LASFVQELLRHP+Y+VDQDD
Sbjct: 126 QNYRRSTDLASQGASERYEYTVTMLFTLVTLMFRMYFNFILASFVQELLRHPKYMVDQDD 185

Query: 187 IEQDLKNKFFLRRWWVVSQKSSYSICRHVL 216
           +EQDLKNK  ++RWW+ SQK  Y +CRH L
Sbjct: 186 VEQDLKNKSAIKRWWIKSQKFCYKLCRHTL 215

>KAFR0E03930 Chr5 (777060..777089,777170..777775) [636 bp, 211 aa]
           {ON} Anc_5.433 YDR367W
          Length = 211

 Score =  288 bits (738), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 136/216 (62%), Positives = 164/216 (75%), Gaps = 6/216 (2%)

Query: 1   MTKLSSSLPKTFFGIFPLYIGVEIVLGVTLLNKCSGAFGILALFTGHPLDLMQWASYLWS 60
           M   S SLPK+F G+ PLY+ VEIVLG+T  NK SGAFGILALFTGHPL  MQW  YLWS
Sbjct: 1   MRTTSFSLPKSFLGVLPLYLAVEIVLGITAFNKVSGAFGILALFTGHPLAFMQWVFYLWS 60

Query: 61  VFTLVVYAQGLYQIHKPKLLTFSQIVVVFSIDTVLTCLFTLWFTGVWFAEESNTDAAMGT 120
             TL V+AQGL++IHKP +LTFSQI V +SIDT+  C FTLWFTG WF  ES T+AA+G+
Sbjct: 61  TVTLFVFAQGLFEIHKPNILTFSQIFVFYSIDTLCNCFFTLWFTGDWFNVESQTEAAVGS 120

Query: 121 AASAVARLVKRGAEIDTQGATESYEYVFTIIITMVSLVFRLYFNFLLASFVQELLRHPQY 180
                  + KR  +I +QGA++ YEY  TI IT+ SLVFR YFNF+LASFVQELLRHP+Y
Sbjct: 121 T------ITKRTEDISSQGASQGYEYSMTIFITLTSLVFRFYFNFILASFVQELLRHPKY 174

Query: 181 LVDQDDIEQDLKNKFFLRRWWVVSQKSSYSICRHVL 216
           + DQDDIEQDLKNK   +RWW+  QKS Y +C+++L
Sbjct: 175 MFDQDDIEQDLKNKSIWKRWWLKCQKSCYKLCKNLL 210

>NCAS0F03370 Chr6 (681041..681070,681141..681746) [636 bp, 211 aa]
           {ON} Anc_5.433 YDR367W
          Length = 211

 Score =  288 bits (737), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 137/219 (62%), Positives = 171/219 (78%), Gaps = 12/219 (5%)

Query: 1   MTKLSSSLPK---TFFGIFPLYIGVEIVLGVTLLNKCSGAFGILALFTGHPLDLMQWASY 57
           M   S +LPK   +FFGI PLY+GVEIVLG+T+ NKCSGA+GILALFTGHPLD +QW  Y
Sbjct: 1   MAHHSITLPKCFQSFFGIIPLYLGVEIVLGITIFNKCSGAYGILALFTGHPLDFVQWVFY 60

Query: 58  LWSVFTLVVYAQGLYQIHKPKLLTFSQIVVVFSIDTVLTCLFTLWFTGVWFAEESNTDAA 117
           LWS+FTL+++AQGLY+IHKP LLTFSQI+V +S+DT+ TC+FTLWFT  WF  E      
Sbjct: 61  LWSIFTLIIFAQGLYEIHKPTLLTFSQILVFYSLDTICTCIFTLWFTSQWFQTEPT---- 116

Query: 118 MGTAASAVARLVKRGAEIDTQGATESYEYVFTIIITMVSLVFRLYFNFLLASFVQELLRH 177
            GT  +    L +R   +++QGATE+YEY+ TI IT+V+L FRLYFN LLA+FVQELL H
Sbjct: 117 -GTEEA----LQRRNESLESQGATEAYEYMMTIFITLVTLTFRLYFNCLLAAFVQELLHH 171

Query: 178 PQYLVDQDDIEQDLKNKFFLRRWWVVSQKSSYSICRHVL 216
           P+YLVDQDD+EQDLKNK   +RWW+ +QK SY +C H+L
Sbjct: 172 PKYLVDQDDVEQDLKNKPVWKRWWIKNQKWSYKVCSHLL 210

>YDR367W Chr4 (1212848..1212877,1212979..1213614) [666 bp, 221 aa]
           {ON}  KEI1Component of inositol phosphorylceramide (IPC)
           synthase; forms a complex with Aur1p and regulates its
           activity; required for IPC synthase complex localization
           to the Golgi; post-translationally processed by Kex2p;
           KEI1 is an essential gene
          Length = 221

 Score =  287 bits (735), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 133/214 (62%), Positives = 168/214 (78%), Gaps = 4/214 (1%)

Query: 7   SLPKTFFGIFPLYIGVEIVLGVTLLNKCSGAFGILALFTGHPLDLMQWASYLWSVFTLVV 66
           +LPK+F G  PLY+ VEIVLG+++LNKCSGA+GILALFTGHPLD MQW +YLWSVFTL+V
Sbjct: 7   TLPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWIAYLWSVFTLIV 66

Query: 67  YAQGLYQIHKPKLLTFSQIVVVFSIDTVLTCLFTLWFTGVWFAEE--SNTDA--AMGTAA 122
           ++QGLY IHKP LL FSQI V+++IDT+ TC FTLWFT  WF  E  +N D   A+ +  
Sbjct: 67  FSQGLYLIHKPNLLVFSQICVLYTIDTISTCFFTLWFTTQWFTLEDTANIDGNNALQSNP 126

Query: 123 SAVARLVKRGAEIDTQGATESYEYVFTIIITMVSLVFRLYFNFLLASFVQELLRHPQYLV 182
            +  +L +RG +I  Q ATESYEY  TI+IT+VSL+FR YFNF+LASFVQELL HP+YLV
Sbjct: 127 ISTGKLTERGIDISKQSATESYEYTMTILITLVSLIFRFYFNFILASFVQELLHHPKYLV 186

Query: 183 DQDDIEQDLKNKFFLRRWWVVSQKSSYSICRHVL 216
           D+DD+EQ+LKNK   +R W  SQK  Y +C+++L
Sbjct: 187 DRDDVEQNLKNKPIWKRLWAKSQKGCYKLCKNLL 220

>Suva_2.539 Chr2 (963328..963357,963470..964123) [684 bp, 227 aa]
           {ON} YDR367W (REAL)
          Length = 227

 Score =  286 bits (731), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 131/220 (59%), Positives = 164/220 (74%), Gaps = 10/220 (4%)

Query: 7   SLPKTFFGIFPLYIGVEIVLGVTLLNKCSGAFGILALFTGHPLDLMQWASYLWSVFTLVV 66
           +LPK+F G  PLY+ VEIVLG+++LNKCSGA+GILALFTGHPLD MQW +YLWSVFTL+V
Sbjct: 7   ALPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSVFTLIV 66

Query: 67  YAQGLYQIHKPKLLTFSQIVVVFSIDTVLTCLFTLWFTGVWFAEESNTDAAMGTAAS--- 123
           +AQGLY IHKP LL FSQI V++++DT+ TC FTLWFT  WF  E N       +++   
Sbjct: 67  FAQGLYLIHKPNLLVFSQICVLYTVDTICTCFFTLWFTTQWFTLEGNASIVADASSTATQ 126

Query: 124 -------AVARLVKRGAEIDTQGATESYEYVFTIIITMVSLVFRLYFNFLLASFVQELLR 176
                  A  +L  R  +   QGA+ESYEY  TI+IT+VSL+FR YFNF+LASFVQELL 
Sbjct: 127 TINYNPIATGKLTARSTDTSGQGASESYEYSITILITLVSLIFRFYFNFILASFVQELLH 186

Query: 177 HPQYLVDQDDIEQDLKNKFFLRRWWVVSQKSSYSICRHVL 216
           HP+YLVD+DD+EQDLKNK   +R W  SQK  Y +C+++L
Sbjct: 187 HPKYLVDRDDVEQDLKNKPIWKRLWAKSQKGCYKLCKNLL 226

>Smik_4.633 Chr4 (1132870..1132899,1133000..1133635) [666 bp, 221
           aa] {ON} YDR367W (REAL)
          Length = 221

 Score =  275 bits (702), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 128/217 (58%), Positives = 162/217 (74%), Gaps = 10/217 (4%)

Query: 7   SLPKTFFGIFPLYIGVEIVLGVTLLNKCSGAFGILALFTGHPLDLMQWASYLWSVFTLVV 66
           +LPK+F G  PLY+ VEIVLG+++LNKCSG +GILALFTGHPLD MQW +YLWSVFTL++
Sbjct: 7   TLPKSFLGFMPLYLAVEIVLGISILNKCSGVYGILALFTGHPLDFMQWVAYLWSVFTLII 66

Query: 67  YAQGLYQIHKPKLLTFSQIVVVFSIDTVLTCLFTLWFTGVWFAEESNTDAAMGTAAS--- 123
           ++QGLY IHKP LL FSQI  ++++DT+ TC FTLWFT  WF  E   D A G A+    
Sbjct: 67  FSQGLYLIHKPNLLLFSQICALYTLDTLFTCFFTLWFTTQWFTLE---DTAGGVASQSNN 123

Query: 124 ----AVARLVKRGAEIDTQGATESYEYVFTIIITMVSLVFRLYFNFLLASFVQELLRHPQ 179
               +  RL  R  +I  Q ATESYEY  TI+IT+VSL+FR YFN +LASFVQELL HP+
Sbjct: 124 SNLISTERLTVRNTDISKQSATESYEYSITILITLVSLIFRFYFNLILASFVQELLHHPK 183

Query: 180 YLVDQDDIEQDLKNKFFLRRWWVVSQKSSYSICRHVL 216
           YLVD+DD+EQ+LKNK   +R +  SQK  Y +C+++L
Sbjct: 184 YLVDRDDVEQNLKNKPIWKRLYAKSQKGCYKLCKNLL 220

>Skud_4.636 Chr4 (1135660..1135689,1135789..1136463) [705 bp, 234
           aa] {ON} YDR367W (REAL)
          Length = 234

 Score =  273 bits (699), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 129/220 (58%), Positives = 162/220 (73%), Gaps = 13/220 (5%)

Query: 10  KTFFGIFPLYIGVEIVLGVTLLNKCSGAFGILALFTGHPLDLMQWASYLWSVFTLVVYAQ 69
           K+F G  PLY+ VEIVLG+++LNKCSGA+GILALFTGHPLD MQW +YLWSVFTL+V++Q
Sbjct: 14  KSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSVFTLIVFSQ 73

Query: 70  GLYQIHKPKLLTFSQIVVVFSIDTVLTCLFTLWFTGVWFAEESNTD---AAMGTAASAV- 125
           GLY IHKP LL FSQI +++++DT+ TC FTLWFT  WF  E+ TD    A  TA +A+ 
Sbjct: 74  GLYLIHKPNLLVFSQICILYTVDTIFTCFFTLWFTTQWFTLENPTDFGSIANSTADTALR 133

Query: 126 ---------ARLVKRGAEIDTQGATESYEYVFTIIITMVSLVFRLYFNFLLASFVQELLR 176
                     +L  R A+   Q ATE+YEY  TI IT+ SL+FR YFN +L SFVQELL 
Sbjct: 134 TNGLSPIMAGKLTARSADKSGQSATENYEYSITIFITLASLIFRFYFNLILGSFVQELLH 193

Query: 177 HPQYLVDQDDIEQDLKNKFFLRRWWVVSQKSSYSICRHVL 216
           HP+YLVD+DD+EQDLKNK   +R W  SQKS Y +C+++L
Sbjct: 194 HPKYLVDRDDVEQDLKNKPIWKRLWAKSQKSCYRLCKNLL 233

>Kpol_1062.30 s1062 complement(66657..67301) [645 bp, 214 aa] {ON}
           complement(66657..67301) [645 nt, 215 aa]
          Length = 214

 Score =  269 bits (688), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 126/211 (59%), Positives = 164/211 (77%), Gaps = 12/211 (5%)

Query: 6   SSLPKTFFGIFPLYIGVEIVLGVTLLNKCSGAFGILALFTGHPLDLMQWASYLWSVFTLV 65
           S+LP++FFG  PLYIGVE VLG+T+LNKCSGA+GILALFTGHPL++ QW SYLWSVFTL+
Sbjct: 15  SNLPRSFFGFLPLYIGVETVLGITILNKCSGAYGILALFTGHPLNVFQWVSYLWSVFTLI 74

Query: 66  VYAQGLYQIHKPKLLTFSQIVVVFSIDTVLTCLFTLWFTGVWFAEESNTDAAMGTAASAV 125
           +Y+QGL+Q+H P LLT+SQI VVFS DT LTC+FT+ F+  WF E   T + M   +   
Sbjct: 75  IYSQGLFQVHTPSLLTYSQIFVVFSFDTFLTCVFTMIFSSQWFTE---TGSGMSDGS--- 128

Query: 126 ARLVKRGAEIDTQGATESYEYVFTIIITMVSLVFRLYFNFLLASFVQELLRHPQYLVDQD 185
                 G +   QGA+E+YEY FTI+IT+V+LV R+YFNF+LA+F QEL  HP+Y+VD D
Sbjct: 129 ------GVDEYGQGASETYEYTFTILITVVALVSRMYFNFILAAFNQELFLHPKYMVDFD 182

Query: 186 DIEQDLKNKFFLRRWWVVSQKSSYSICRHVL 216
           D+EQDLKNK  + +WW+ S+KS Y++ RH+L
Sbjct: 183 DVEQDLKNKNKIVQWWIKSKKSCYNLARHIL 213

>TDEL0E01920 Chr5 complement(363042..363665,363727..363765) [663 bp,
           220 aa] {ON} Anc_5.433 YDR367W
          Length = 220

 Score =  263 bits (672), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 120/213 (56%), Positives = 158/213 (74%)

Query: 5   SSSLPKTFFGIFPLYIGVEIVLGVTLLNKCSGAFGILALFTGHPLDLMQWASYLWSVFTL 64
           S  LPK+F G  PLYIGVEI LG++++NKCSGA+GILALFTGHPLD MQW  Y+WS+FTL
Sbjct: 8   SMGLPKSFLGFVPLYIGVEIALGISIINKCSGAYGILALFTGHPLDSMQWVLYIWSIFTL 67

Query: 65  VVYAQGLYQIHKPKLLTFSQIVVVFSIDTVLTCLFTLWFTGVWFAEESNTDAAMGTAASA 124
           ++  QGLYQIHKP +LTFS I + F IDT+ T  FTLWFT  W+  E N++    T +S 
Sbjct: 68  IICVQGLYQIHKPNVLTFSHIFITFIIDTLFTSFFTLWFTAQWYNLEGNSNNVKDTKSSY 127

Query: 125 VARLVKRGAEIDTQGATESYEYVFTIIITMVSLVFRLYFNFLLASFVQELLRHPQYLVDQ 184
               V   ++I  QGA+E +EY  T+ IT++SL  +LYF F++ASFVQELL HP+Y++DQ
Sbjct: 128 SDAPVDYSSKIAHQGASEGFEYGVTMFITILSLAGKLYFTFIIASFVQELLLHPRYMLDQ 187

Query: 185 DDIEQDLKNKFFLRRWWVVSQKSSYSICRHVLV 217
           DD+EQDLK++ F +RWW+ SQKS Y + + +L 
Sbjct: 188 DDVEQDLKHQSFWKRWWIKSQKSCYKMSKSLLA 220

>TPHA0E01770 Chr5 complement(356743..357396) [654 bp, 217 aa] {ON}
           Anc_5.433 YDR367W
          Length = 217

 Score =  248 bits (632), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 111/209 (53%), Positives = 151/209 (72%), Gaps = 9/209 (4%)

Query: 8   LPKTFFGIFPLYIGVEIVLGVTLLNKCSGAFGILALFTGHPLDLMQWASYLWSVFTLVVY 67
           LPK+FFG  PLYIGVE VLG+T+ NKCSG +GILALFTGHPL  +QW SYLWS FTL++Y
Sbjct: 17  LPKSFFGFLPLYIGVETVLGITIFNKCSGIYGILALFTGHPLTAIQWVSYLWSSFTLLIY 76

Query: 68  AQGLYQIHKPKLLTFSQIVVVFSIDTVLTCLFTLWFTGVWFAEESNTDAAMGTAASAVAR 127
           AQGL+Q+H P LLT+ QI++ +S DT+ TC FT++F   WF EESN    + ++ +    
Sbjct: 77  AQGLFQVHHPNLLTYCQILITYSFDTICTCFFTIYFCSHWFTEESNAGDNINSSTT---- 132

Query: 128 LVKRGAEIDTQGATESYEYVFTIIITMVSLVFRLYFNFLLASFVQELLRHPQYLVDQDDI 187
                 +   QGA+ES E+ +T+ +T+++LV R YFNF+LASF Q+L  HP+Y++DQDD+
Sbjct: 133 -----VDKYNQGASESKEFFWTMTLTLIALVSRFYFNFILASFTQQLFLHPKYMIDQDDV 187

Query: 188 EQDLKNKFFLRRWWVVSQKSSYSICRHVL 216
           EQDLKNK  + +WW+ S+K  Y   +  L
Sbjct: 188 EQDLKNKSIIVQWWIKSKKRCYYTSKRFL 216

>ZYRO0F10010g Chr6 (812835..812861,812941..813540) [627 bp, 208 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 208

 Score =  241 bits (614), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 117/210 (55%), Positives = 147/210 (70%), Gaps = 8/210 (3%)

Query: 7   SLPKTFFGIFPLYIGVEIVLGVTLLNKCSGAFGILALFTGHPLDLMQWASYLWSVFTLVV 66
           +LPK F G  PLYIGVE+ LGVT+LNKCSG FGILALFTGHPL+ +QW  YLWS+F+ VV
Sbjct: 6   NLPKRFLGFLPLYIGVEVALGVTILNKCSGLFGILALFTGHPLEFLQWVLYLWSIFSFVV 65

Query: 67  YAQGLYQIHKPKLLTFSQIVVVFSIDTVLTCLFTLWFTGVWFAEESNTDAAMGTAASAVA 126
           YAQGL+   KP LL FSQI + FSIDT LTCLFTLWFT  W+  E NT      AA+A+ 
Sbjct: 66  YAQGLFTYSKPSLLVFSQIFIAFSIDTFLTCLFTLWFTNQWYTLEDNTPTQKSIAAAAMQ 125

Query: 127 RLVKRGAEIDTQGATESYEYVFTIIITMVSLVFRLYFNFLLASFVQELLRHPQYLVDQDD 186
                      QGA++S+E+V TI IT+ SL+ RLYFNF+LASFVQ LL+HP+Y+VD  D
Sbjct: 126 E--------PNQGASQSFEFVMTIFITLASLIARLYFNFVLASFVQGLLQHPRYMVDYVD 177

Query: 187 IEQDLKNKFFLRRWWVVSQKSSYSICRHVL 216
           +EQ+L+ +   +R W  +Q       + +L
Sbjct: 178 VEQELRTQPVWKRVWTRTQIRCLRYSKQLL 207

>SAKL0G02508g Chr7 (207823..207855,207940..208593) [687 bp, 228 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 228

 Score =  238 bits (607), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 152/220 (69%), Gaps = 10/220 (4%)

Query: 8   LPKTFFGIFPLYIGVEIVLGVTLLNKCSGAFGILALFTGHPLDLMQWASYLWSVFTLVVY 67
           LPK+F G  PLYIGVE+ LG+++ NK SG +GILALFTGHPLD MQW  Y  SV TL+VY
Sbjct: 9   LPKSFLGFLPLYIGVELGLGISIFNKFSGFYGILALFTGHPLDFMQWCFYSLSVLTLLVY 68

Query: 68  AQGLYQIHKPKLLTFSQIVVVFSIDTVLTCLFTLWFTGVWFAEESNTD--AAMGT----- 120
             GL+QI KP  LT+S ++VVF+IDT+L C FT+WF+  WF+ E N D   A+GT     
Sbjct: 69  LSGLWQIRKPNPLTYSLVLVVFTIDTLLNCFFTIWFSAQWFSIEENDDNKGAVGTSKLQS 128

Query: 121 ---AASAVARLVKRGAEIDTQGATESYEYVFTIIITMVSLVFRLYFNFLLASFVQELLRH 177
              A      L +R   + +Q A++ YEY  T++ T+++L  R YFNF+LA+FVQ++LRH
Sbjct: 129 AGRALGPAKELNRRNNSLASQSASQGYEYTMTMLFTVLTLAVRFYFNFILAAFVQQMLRH 188

Query: 178 PQYLVDQDDIEQDLKNKFFLRRWWVVSQKSSYSICRHVLV 217
           P+Y+VD+DD+EQDLKNK   RR  + S+K  Y+ C+  L 
Sbjct: 189 PKYIVDKDDVEQDLKNKSLFRRLCIKSEKWCYNACQRALA 228

>Kwal_55.21432 s55 complement(834129..834752) [624 bp, 207 aa] {ON}
           YDR367W - Protein required for cell viability [contig
           130] FULL
          Length = 207

 Score =  224 bits (570), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 147/206 (71%), Gaps = 9/206 (4%)

Query: 20  IGVEIVLGVTLLNKCSGAFGILALFTGHPLDLMQWASYLWSVFTLVVYAQGLYQIHKPKL 79
           +GVEI LG+T+LNKCSG +GIL L TGH LD MQW  YL S+ T++VY+ GL  I+KP +
Sbjct: 1   MGVEIGLGITVLNKCSGFYGILGLLTGHHLDFMQWVLYLTSIITVIVYSVGLSSIYKPSV 60

Query: 80  LTFSQIVVVFSIDTVLTCLFTLWFTGVWFAEESN--TDAAMGTAASAVAR-------LVK 130
           L++S I++ F+ DT++TC FTLWF+G WF+ +++  TD    T  S+          + K
Sbjct: 61  LSYSLILLTFTTDTLVTCFFTLWFSGQWFSAKNSELTDPNSTTLQSSAGNNSPSGNLISK 120

Query: 131 RGAEIDTQGATESYEYVFTIIITMVSLVFRLYFNFLLASFVQELLRHPQYLVDQDDIEQD 190
           RG  + +Q A++  EY FTI++T+ +L  R YFNF++ +FVQ LLRHP+Y+VDQDD+EQD
Sbjct: 121 RGDTLSSQSASQGTEYFFTILVTIFALATRFYFNFIIMAFVQRLLRHPKYVVDQDDVEQD 180

Query: 191 LKNKFFLRRWWVVSQKSSYSICRHVL 216
           LK++ FLRRWW+ ++  SY ICR  L
Sbjct: 181 LKHRGFLRRWWIRAETHSYKICRRYL 206

>TBLA0A06520 Chr1 complement(1599308..1599928) [621 bp, 206 aa] {ON}
           Anc_5.433 YDR367W
          Length = 206

 Score =  214 bits (544), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 98/209 (46%), Positives = 138/209 (66%), Gaps = 18/209 (8%)

Query: 8   LPKTFFGIFPLYIGVEIVLGVTLLNKCSGAFGILALFTGHPLDLMQWASYLWSVFTLVVY 67
           LPK F G+ PLY+GVE+VLG+T+ NKC GA+GILALF GHPL+  QW  Y WS+  L +Y
Sbjct: 15  LPKRFCGVAPLYLGVELVLGITIFNKCGGAYGILALFNGHPLEFAQWVLYTWSIVCLAIY 74

Query: 68  AQGLYQIHKPKLLTFSQIVVVFSIDTVLTCLFTLWFTGVWFAEESNTDAAMGTAASAVAR 127
           AQGL ++H+P L TFSQ+ + FS+DT+LTC FT++FT  WFA  + T             
Sbjct: 75  AQGLAKVHRPTLYTFSQVFIFFSVDTLLTCAFTVYFTHEWFAANTTTRPPAA-------- 126

Query: 128 LVKRGAEIDTQGATESYEYVFTIIITMVSLVFRLYFNFLLASFVQELLRHPQYLVDQDDI 187
                     QGA+++YEY  ++++T+ SLV RLYFNF++ SF+QEL   P Y +D D++
Sbjct: 127 ----------QGASDAYEYSVSLLVTLASLVSRLYFNFIVGSFLQELFFRPAYTLDTDEV 176

Query: 188 EQDLKNKFFLRRWWVVSQKSSYSICRHVL 216
           E +L++   LRR W+ +Q   Y + R +L
Sbjct: 177 ETELRHSSLLRRLWLQNQHYCYILSRRIL 205

>TBLA0G02010 Chr7 (525436..526077) [642 bp, 213 aa] {ON} Anc_5.433
           YDR367W
          Length = 213

 Score =  206 bits (525), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 92/202 (45%), Positives = 143/202 (70%), Gaps = 4/202 (1%)

Query: 5   SSSLPKTFFGIFPLYIGVEIVLGVTLLNKCSGAFGILALFTGHPLDLMQWASYLWSVFTL 64
           S  LP +FF +FPLY+GVE++LG+ +LNKCSG +GILALFTGHPL ++QW +Y+WS+FTL
Sbjct: 10  SKVLPNSFFILFPLYLGVELILGICILNKCSGFYGILALFTGHPLSIVQWLTYIWSIFTL 69

Query: 65  VVYAQGLYQIHKPKLLTFSQIVVVFSIDTVLTCLFTLWFTGVWFAEESNTDAAMGTAASA 124
           ++Y QG++ I KP +  FSQI  +FS+DT+ T   TL+F   WF+    +D +   + ++
Sbjct: 70  LIYTQGMFHIKKPNVYLFSQIFTIFSLDTIFTLFLTLYFALDWFS----SDHSNKQSENS 125

Query: 125 VARLVKRGAEIDTQGATESYEYVFTIIITMVSLVFRLYFNFLLASFVQELLRHPQYLVDQ 184
           + R  K       QGA+ +YE    +I+T+ +L+ R Y+N +LASF+ +L  +P++++DQ
Sbjct: 126 LQRTEKDIELSQKQGASSTYELFLIVIVTLFTLISRCYYNLVLASFLHKLFINPKFIIDQ 185

Query: 185 DDIEQDLKNKFFLRRWWVVSQK 206
           DD+E DLKNK F +++  +S+K
Sbjct: 186 DDVETDLKNKSFFKKFGGISKK 207

>AER256C Chr5 complement(1109526..1110152,1110213..1110305) [720 bp,
           239 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YDR367W; 1-intron
          Length = 239

 Score =  203 bits (517), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 102/221 (46%), Positives = 141/221 (63%), Gaps = 18/221 (8%)

Query: 6   SSLPKTFFGIFPLYIGVEIVLGVTLLNKCSGAFGILALFTGHPLDLMQWASYLWSVFTLV 65
           + LPK+FFG+ PLYIGVE+ LG+ + NK  G FG+LALFTGHPLD++QW  YLWS  TL+
Sbjct: 27  NHLPKSFFGL-PLYIGVELSLGIAIFNKFCGLFGLLALFTGHPLDILQWLFYLWSFVTLL 85

Query: 66  VYAQGLYQIHKPKLLTFSQIVVVFSIDTVLTCLFTLWFTGVWF----------AEESNTD 115
           VY  GL QI++P+L  +  ++VV+S DT+LTCL+TLWFT  WF          A+E + D
Sbjct: 86  VYLHGLMQIYQPRLAAYCLVLVVYSTDTILTCLYTLWFTRGWFIDGDVGVTATAKEDDAD 145

Query: 116 AAMGTAASAVARLVKRGAEIDTQGATESYEYVFTIIITMVSLVFRLYFNFLLASFVQELL 175
           A  G+       +      +  Q A++SYEY FT+  T+ +L  R Y NFL+ASFVQ + 
Sbjct: 146 ATQGS-------VTVENEPVSHQSASKSYEYAFTMAFTLFALSLRFYSNFLIASFVQRMF 198

Query: 176 RHPQYLVDQDDIEQDLKNKFFLRRWWVVSQKSSYSICRHVL 216
           +H ++    DD+EQDLK+K    R +   Q+  Y +CR  L
Sbjct: 199 QHNKFAAGCDDVEQDLKHKSVAYRAYAKMQRWCYFLCRRYL 239

>NDAI0B05660 Chr2 (1382276..1382761) [486 bp, 161 aa] {ON} Anc_5.433
           YDR367W
          Length = 161

 Score =  199 bits (505), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 90/165 (54%), Positives = 124/165 (75%), Gaps = 5/165 (3%)

Query: 52  MQWASYLWSVFTLVVYAQGLYQIHKPKLLTFSQIVVVFSIDTVLTCLFTLWFTGVWFAEE 111
           MQW +YLWS+F L+++AQGLYQIHKP LLTFSQI V F++DT+ TC FTLWFT  WF + 
Sbjct: 1   MQWVAYLWSIFCLIIFAQGLYQIHKPTLLTFSQITVFFTLDTLFTCFFTLWFTAQWF-QG 59

Query: 112 SNTDAAMGTAASAVARLVKRGAEIDTQGATESYEYVFTIIITMVSLVFRLYFNFLLASFV 171
           S  ++A+ T+      + KR   + +QGAT  YEY  T++IT ++L FR YFN +LASFV
Sbjct: 60  SEGESAVQTSTG----VQKRDTSLASQGATAGYEYFVTMLITFITLTFRFYFNCILASFV 115

Query: 172 QELLRHPQYLVDQDDIEQDLKNKFFLRRWWVVSQKSSYSICRHVL 216
           QELL +P++++DQDD+EQDLKNK  ++RWW+ ++K  Y +C+ VL
Sbjct: 116 QELLSNPKFMIDQDDVEQDLKNKSMVKRWWIKNEKFCYRLCKSVL 160

>KLTH0F16082g Chr6 complement(1305673..1306293) [621 bp, 206 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 206

 Score =  200 bits (509), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 146/206 (70%), Gaps = 8/206 (3%)

Query: 20  IGVEIVLGVTLLNKCSGAFGILALFTGHPLDLMQWASYLWSVFTLVVYAQGLYQIHKPKL 79
           +GVEI LG+T+LNKCSG +GIL L TGH LD MQW  YL SVFTLVVY+ GL  ++KPKL
Sbjct: 1   MGVEIGLGITILNKCSGFYGILGLLTGHQLDFMQWVLYLTSVFTLVVYSLGLTTVYKPKL 60

Query: 80  LTFSQIVVVFSIDTVLTCLFTLWFTGVWFAEE--------SNTDAAMGTAASAVARLVKR 131
            T++ +++ F+ DT++TC FTLWF+G+WFA +        S T    G  +S    L  R
Sbjct: 61  QTYAFVLLTFTADTLITCFFTLWFSGMWFAAKESELSDPSSATQQTSGGISSGSKLLTAR 120

Query: 132 GAEIDTQGATESYEYVFTIIITMVSLVFRLYFNFLLASFVQELLRHPQYLVDQDDIEQDL 191
           G  + +Q A+++ EY FTI++++++LV R YFNF++ +FVQ L RHP+YLVDQDD++QDL
Sbjct: 121 GETLSSQSASQATEYFFTILVSLIALVSRFYFNFIILAFVQRLFRHPKYLVDQDDVDQDL 180

Query: 192 KNKFFLRRWWVVSQKSSYSICRHVLV 217
           K+K   +RWW+ ++  SY +C H L 
Sbjct: 181 KHKKLWQRWWIRAENWSYRVCHHYLA 206

>KLLA0E21099g Chr5 complement(1885338..1885976,1886092..1886127)
           [675 bp, 224 aa] {ON} similar to uniprot|Q06999
           Saccharomyces cerevisiae YDR367W Protein of unknown
           function green fluorescent protein (GFP)-fusion protein
           localizes to the cytoplasm in a punctate pattern
          Length = 224

 Score =  195 bits (495), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 94/218 (43%), Positives = 141/218 (64%), Gaps = 12/218 (5%)

Query: 8   LPKTFFGIFPLYIGVEIVLGVTLLNKCSGAFGILALFTGHPLDLMQWASYLWSVFTLVVY 67
           LP+TF   +PLYIGVE+ LGV   NK SG +G+LALFTGHPLD +QW  Y+WS+F LVV+
Sbjct: 10  LPQTFLS-YPLYIGVEVALGVLTFNKFSGMYGVLALFTGHPLDFVQWTFYIWSIFCLVVF 68

Query: 68  AQGLYQIHKPKLLTFSQIVVVFSIDTVLTCLFTLWFTGVWFAEESNTD--------AAMG 119
             G+ Q++KP +L  S +  VFS+DT+++C++ LWFT VWF++E +TD         A+G
Sbjct: 69  ISGIRQVYKPNILLMSTVTFVFSVDTIVSCIYCLWFTAVWFSQEGSTDVTDLKSAGTALG 128

Query: 120 TAASAVARLVKRGAEIDT-QGATESYEYVFTIIITMVSLVFRLYFNFLLASFVQELLRHP 178
            A       +    ++DT + A+  YE+   I++T+V L  R YFNF++ +F Q+LLR  
Sbjct: 129 PAHEGTTSTIS--TKVDTSKSASSGYEFFLIILLTLVPLAVRFYFNFIIIAFQQQLLRSG 186

Query: 179 QYLVDQDDIEQDLKNKFFLRRWWVVSQKSSYSICRHVL 216
           ++  DQ+DIE +L N+  L +W    +K  + +C+  L
Sbjct: 187 KFTFDQNDIEVNLHNRNILFKWRYKFEKWCFYLCKRYL 224

>Ecym_4762 Chr4 complement(1482336..1482983,1483049..1483066) [666
           bp, 221 aa] {ON} similar to Ashbya gossypii AER256C
           1-intron
          Length = 221

 Score =  194 bits (493), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 97/219 (44%), Positives = 138/219 (63%), Gaps = 11/219 (5%)

Query: 8   LPKTFFGIFPLYIGVEIVLGVTLLNKCSGAFGILALFTGHPLDLMQWASYLWSVFTLVVY 67
           LP++FFG+ PLYIGVE+ LGV + NK  G +GILALFTG PLDL+QW  Y+WS   L+V+
Sbjct: 4   LPQSFFGL-PLYIGVELSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAALLVF 62

Query: 68  AQGLYQIHKPKLLTFSQIVVVFSIDTVLTCLFTLWFTGVWFAEE-----SNTDAAMG--- 119
            +GL Q++KPKL+T+  ++ V+S+DTVL C F + FTG WF++E     SN  +  G   
Sbjct: 63  TKGLSQVYKPKLMTYCMVLTVYSLDTVLACFFAVLFTGDWFSKEDTSSGSNPVSGKGIGV 122

Query: 120 --TAASAVARLVKRGAEIDTQGATESYEYVFTIIITMVSLVFRLYFNFLLASFVQELLRH 177
                S       R    DTQ A+  YEY  TI++T++    R Y NF++ASFV+ +++ 
Sbjct: 123 VDVGKSGTQNFAYRRTVDDTQSASTHYEYSSTILLTLIVSALRFYSNFIIASFVRRMMKQ 182

Query: 178 PQYLVDQDDIEQDLKNKFFLRRWWVVSQKSSYSICRHVL 216
            +Y+ + DD+E DLKN     R +V +Q+  Y  CR  L
Sbjct: 183 NRYITEPDDVEYDLKNTSVAYRAYVSTQRWCYYFCRRYL 221

>TPHA0F00720 Chr6 (162768..166619) [3852 bp, 1283 aa] {ON} Anc_4.129
           YAL002W
          Length = 1283

 Score = 30.0 bits (66), Expect = 4.8,   Method: Composition-based stats.
 Identities = 11/53 (20%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 145 EYVFTIIITMVSLV-FRLYFNFLLASFVQELLRHPQYLVDQDDIEQDLKNKFF 196
           +Y+  +++ +++   ++ Y+ FL+    + + ++PQY+   ++I Q++ +K F
Sbjct: 764 QYIMDMLVDILNTASYQEYYRFLVIFLAKNITKYPQYIKFSNNILQNIIDKIF 816

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.328    0.140    0.432 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 21,432,733
Number of extensions: 847588
Number of successful extensions: 2729
Number of sequences better than 10.0: 29
Number of HSP's gapped: 2778
Number of HSP's successfully gapped: 29
Length of query: 217
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 112
Effective length of database: 41,441,469
Effective search space: 4641444528
Effective search space used: 4641444528
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 63 (28.9 bits)