Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0C049105.434ON31331316640.0
Suva_8.1735.434ON31231212011e-166
YOR120W (GCY1)5.434ON31231211811e-163
Skud_15.2835.434ON31231211791e-163
NCAS0H020605.434ON32231311651e-161
Smik_15.2985.434ON31231211631e-161
NDAI0C016005.434ON31331311611e-160
CAGL0I01100g5.434ON31031111141e-153
CAGL0A02816g5.434ON31030910991e-151
YDR368W (YPR1)5.434ON31231210901e-150
SAKL0G02530g5.434ON31231210901e-150
Suva_2.5405.434ON31231210861e-149
Smik_4.6345.434ON31231210761e-147
Skud_4.6375.434ON31231210651e-146
Kpol_1062.295.434ON31131010541e-144
KAFR0E03850singletonON31131210471e-143
NCAS0F033805.434ON31331210381e-142
NDAI0B056705.434ON31830910351e-141
TBLA0A02825singletonON31131210281e-140
KAFR0E038405.434ON31031310271e-140
ZYRO0F10032g5.434ON31030910131e-138
TDEL0E019105.434ON3113129961e-135
TBLA0A065105.434ON3123129951e-135
KLLA0B14707gsingletonON3103099761e-132
Kwal_47.18084na 1ON3093059751e-132
KLTH0E15532gsingletonON3093049741e-132
TPHA0E017605.434ON3103119691e-131
TPHA0G00210singletonON3113129621e-130
TDEL0D00230singletonON3123139581e-129
KLTH0E00220gsingletonON3062989381e-127
KLTH0A00528gsingletonON3062989381e-127
KLTH0F16060g5.434ON3093109381e-127
KLTH0A03476gna 1ON3083039271e-125
KLLA0D10109gsingletonON3093019091e-122
TBLA0A02835singletonON3113128921e-119
Kwal_55.214265.434ON3083108801e-118
AER401W5.434ON3133108161e-108
NDAI0A070003.108ON3203045636e-70
NCAS0I024203.108ON3203095392e-66
KAFR0G013503.108ON3243035263e-64
KNAG0K020703.108ON3233055142e-62
SAKL0C10626gsingletonON3222995123e-62
SAKL0C09922g3.108ON3223045081e-61
YBR149W (ARA1)3.108ON3443085031e-60
Smik_2.2883.108ON3442935003e-60
KLTH0C10010g3.108ON3213134984e-60
Suva_4.3983.108ON3443064987e-60
Smik_2.289singletonON3443084934e-59
Skud_2.2763.108ON3443084917e-59
Kwal_56.226113.108ON3213104897e-59
TDEL0D051603.108ON3253044872e-58
KLLA0F02728g3.108ON3302994872e-58
ZYRO0B06138g3.108ON3283144776e-57
CAGL0I01122g5.409ON3263254636e-55
Ecym_55085.409ON3263274602e-54
TBLA0F01720singletonON3263124551e-53
KLLA0F03256g7.468ON2853064476e-53
KNAG0B03780singletonON3263044436e-52
KAFR0C05320singletonON3273224412e-51
YHR104W (GRE3)5.409ON3273204393e-51
ACL107C5.409ON3543324395e-51
ZYRO0A06336g5.409ON3273324351e-50
TBLA0A00630singletonON3283174314e-50
NCAS0A066605.409ON3263234306e-50
Smik_8.1825.409ON3273204307e-50
KLTH0F16610g5.409ON3293094291e-49
Suva_15.3005.409ON3273204281e-49
Skud_8.1655.409ON3273234272e-49
Ecym_7160na 2ON2712924222e-49
NDAI0D016005.409ON3273264245e-49
TPHA0E018605.409ON3263264236e-49
KNAG0D013707.468ON2823044162e-48
TDEL0E021505.409ON3293304167e-48
SAKL0G01914g5.409ON3293204167e-48
SAKL0F14278g7.468ON2863064102e-47
YJR096W7.468ON2823114092e-47
Kwal_47.182197.468ON2933154102e-47
Skud_10.3187.468ON2823074067e-47
KLTH0G05786g7.468ON2863064051e-46
KAFR0G009207.468ON2863064014e-46
NCAS0H005607.468ON2843054014e-46
KLLA0E21627g5.409ON3293204027e-46
Suva_12.1847.468ON2823103971e-45
SAKL0F02574gna 3ON2893103972e-45
Smik_10.3847.468ON2823113962e-45
Kpol_1013.827.468ON2853143928e-45
Kwal_47.18893na 3ON2893093929e-45
TDEL0C033207.468ON2833053892e-44
Kwal_55.215365.409ON3293193862e-43
CAGL0C04543g7.468ON2872763814e-43
KLTH0G02420gna 3ON2893203772e-42
KLLA0F05775g7.285ON3093103755e-42
ZYRO0G17600g7.468ON2833053728e-42
ABL209Cna 2ON3102953608e-40
Kpol_1020.137.285ON3133253609e-40
Kwal_33.13276na 4ON3022923599e-40
Smik_4.1137.285ON3123123572e-39
KLTH0F01892gna 4ON3022793572e-39
NCAS0A137407.285ON3093143546e-39
NDAI0A023007.285ON3133253493e-38
Skud_4.1317.285ON3123163442e-37
Kwal_47.19278na 5ON3143163433e-37
ZYRO0E09614gna 5ON3083123398e-37
Kpol_381.8singletonON3093333381e-36
YDL124W7.285ON3123123381e-36
KAFR0B012007.285ON3153113321e-35
CAGL0J09394g7.285ON3113103311e-35
KLTH0G00638gna 5ON3133083293e-35
KNAG0C041107.285ON3113113267e-35
SAKL0F09746g7.285ON3123143268e-35
TBLA0F019807.285ON3023153232e-34
TDEL0D02790singletonON3293103208e-34
SAKL0F00704gna 5ON3153063162e-33
ZYRO0C09196g7.285ON3123323075e-32
Ecym_32647.285ON3113232882e-29
Kwal_33.13274singletonON108971589e-13
Suva_4.1227.285ON2061801128e-06
Suva_12.272singletonON2652891022e-04
KNAG0M023402.604ON3091471004e-04
Ecym_22962.604ON340148997e-04
Kwal_26.83772.604ON338144840.046
NCAS0A129502.604ON32381830.062
KLTH0D08844g2.604ON340173800.13
YDL243C (AAD4)singletonON32999800.15
YNL331C (AAD14)na 6ON376118800.15
TPHA0C025602.604ON34086800.17
TBLA0B10110singletonON345270800.17
YFL056C (AAD6)singletonON212105770.23
Skud_10.383na 7ON37699780.28
Kpol_449.4singletonON341264770.37
TBLA0G01120singletonON343349770.39
NCAS0C02450singletonON343292760.44
ZYRO0F00858g2.604ON34686760.44
KAFR0C03670singletonON343334750.65
Smik_14.1na 6ON37699750.71
Suva_14.10na 6ON37699740.78
Smik_4.6275.422ON67053741.1
TDEL0F00160singletonON504183731.3
KLTH0D13750g3.462ON338189721.4
KAFR0F03890singletonON319276711.9
NCAS0J016804.280ON204545722.1
NDAI0J026704.280ON205145722.2
Suva_13.2102.604ON34481702.5
Skud_3.179singletonON344299702.5
SAKL0H09438g8.565ON34250668.2
KLLA0B09658g3.462ON342120659.4
Smik_3.208singletonON34459659.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0C04910
         (313 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0C04910 Chr3 complement(949367..950308) [942 bp, 313 aa] {ON...   645   0.0  
Suva_8.173 Chr8 (308911..309849) [939 bp, 312 aa] {ON} YOR120W (...   467   e-166
YOR120W Chr15 (551114..552052) [939 bp, 312 aa] {ON}  GCY1Putati...   459   e-163
Skud_15.283 Chr15 (507542..508480) [939 bp, 312 aa] {ON} YOR120W...   458   e-163
NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434     453   e-161
Smik_15.298 Chr15 (512239..513177) [939 bp, 312 aa] {ON} YOR120W...   452   e-161
NDAI0C01600 Chr3 complement(342011..342952) [942 bp, 313 aa] {ON...   451   e-160
CAGL0I01100g Chr9 complement(91693..92625) [933 bp, 310 aa] {ON}...   433   e-153
CAGL0A02816g Chr1 (296851..297783) [933 bp, 310 aa] {ON} highly ...   427   e-151
YDR368W Chr4 (1213904..1214842) [939 bp, 312 aa] {ON}  YPR1NADPH...   424   e-150
SAKL0G02530g Chr7 (208952..209890) [939 bp, 312 aa] {ON} similar...   424   e-150
Suva_2.540 Chr2 (964433..965371) [939 bp, 312 aa] {ON} YDR368W (...   422   e-149
Smik_4.634 Chr4 (1133924..1134862) [939 bp, 312 aa] {ON} YDR368W...   419   e-147
Skud_4.637 Chr4 (1136769..1137707) [939 bp, 312 aa] {ON} YDR368W...   414   e-146
Kpol_1062.29 s1062 complement(63895..64830) [936 bp, 311 aa] {ON...   410   e-144
KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON}     407   e-143
NCAS0F03380 Chr6 (682072..683013) [942 bp, 313 aa] {ON} Anc_5.434     404   e-142
NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5....   403   e-141
TBLA0A02825 Chr1 complement(681691..682626) [936 bp, 311 aa] {ON}     400   e-140
KAFR0E03840 Chr5 complement(763027..763959) [933 bp, 310 aa] {ON...   400   e-140
ZYRO0F10032g Chr6 (813814..814746) [933 bp, 310 aa] {ON} uniprot...   394   e-138
TDEL0E01910 Chr5 complement(361621..362556) [936 bp, 311 aa] {ON...   388   e-135
TBLA0A06510 Chr1 complement(1597737..1598675) [939 bp, 312 aa] {...   387   e-135
KLLA0B14707g Chr2 complement(1291951..1292883) [933 bp, 310 aa] ...   380   e-132
Kwal_47.18084 s47 complement(677816..678745) [930 bp, 309 aa] {O...   380   e-132
KLTH0E15532g Chr5 complement(1380466..1381395) [930 bp, 309 aa] ...   379   e-132
TPHA0E01760 Chr5 complement(354862..355794) [933 bp, 310 aa] {ON...   377   e-131
TPHA0G00210 Chr7 (31978..32913) [936 bp, 311 aa] {ON}                 375   e-130
TDEL0D00230 Chr4 (37458..38396) [939 bp, 312 aa] {ON}  possible ...   373   e-129
KLTH0E00220g Chr5 complement(12415..13335) [921 bp, 306 aa] {ON}...   365   e-127
KLTH0A00528g Chr1 complement(46253..47173) [921 bp, 306 aa] {ON}...   365   e-127
KLTH0F16060g Chr6 complement(1304479..1305408) [930 bp, 309 aa] ...   365   e-127
KLTH0A03476g Chr1 complement(298735..299661) [927 bp, 308 aa] {O...   361   e-125
KLLA0D10109g Chr4 (854495..855424) [930 bp, 309 aa] {ON} similar...   354   e-122
TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}     348   e-119
Kwal_55.21426 s55 complement(832981..833907) [927 bp, 308 aa] {O...   343   e-118
AER401W Chr5 (1406905..1407846) [942 bp, 313 aa] {ON} Syntenic h...   318   e-108
NDAI0A07000 Chr1 complement(1596632..1597594) [963 bp, 320 aa] {...   221   6e-70
NCAS0I02420 Chr9 complement(454156..455118) [963 bp, 320 aa] {ON...   212   2e-66
KAFR0G01350 Chr7 (304389..305363) [975 bp, 324 aa] {ON} Anc_3.10...   207   3e-64
KNAG0K02070 Chr11 complement(419556..420527) [972 bp, 323 aa] {O...   202   2e-62
SAKL0C10626g Chr3 (962421..963389) [969 bp, 322 aa] {ON} similar...   201   3e-62
SAKL0C09922g Chr3 (897779..898747) [969 bp, 322 aa] {ON} similar...   200   1e-61
YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+ ...   198   1e-60
Smik_2.288 Chr2 (524564..525598) [1035 bp, 344 aa] {ON} YBR149W ...   197   3e-60
KLTH0C10010g Chr3 (829145..830110) [966 bp, 321 aa] {ON} similar...   196   4e-60
Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W ...   196   7e-60
Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W ...   194   4e-59
Skud_2.276 Chr2 (507436..508470) [1035 bp, 344 aa] {ON} YBR149W ...   193   7e-59
Kwal_56.22611 s56 complement(202750..203715) [966 bp, 321 aa] {O...   192   7e-59
TDEL0D05160 Chr4 complement(935981..936958) [978 bp, 325 aa] {ON...   192   2e-58
KLLA0F02728g Chr6 (249240..250232) [993 bp, 330 aa] {ON} similar...   192   2e-58
ZYRO0B06138g Chr2 complement(491830..492816) [987 bp, 328 aa] {O...   188   6e-57
CAGL0I01122g Chr9 (93934..94914) [981 bp, 326 aa] {ON} highly si...   182   6e-55
Ecym_5508 Chr5 (1035144..1036124) [981 bp, 326 aa] {ON} similar ...   181   2e-54
TBLA0F01720 Chr6 complement(430289..431269) [981 bp, 326 aa] {ON}     179   1e-53
KLLA0F03256g Chr6 (306731..307588) [858 bp, 285 aa] {ON} highly ...   176   6e-53
KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON}               175   6e-52
KAFR0C05320 Chr3 complement(1065934..1066917) [984 bp, 327 aa] {...   174   2e-51
YHR104W Chr8 (323409..324392) [984 bp, 327 aa] {ON}  GRE3Aldose ...   173   3e-51
ACL107C Chr3 complement(152564..153628) [1065 bp, 354 aa] {ON} S...   173   5e-51
ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {O...   172   1e-50
TBLA0A00630 Chr1 complement(126399..127385) [987 bp, 328 aa] {ON}     170   4e-50
NCAS0A06660 Chr1 (1316398..1317378) [981 bp, 326 aa] {ON}             170   6e-50
Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W (...   170   7e-50
KLTH0F16610g Chr6 complement(1346319..1347308) [990 bp, 329 aa] ...   169   1e-49
Suva_15.300 Chr15 (525715..526698) [984 bp, 327 aa] {ON} YHR104W...   169   1e-49
Skud_8.165 Chr8 (297201..298184) [984 bp, 327 aa] {ON} YHR104W (...   169   2e-49
Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to...   167   2e-49
NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON}               167   5e-49
TPHA0E01860 Chr5 complement(373074..374054) [981 bp, 326 aa] {ON...   167   6e-49
KNAG0D01370 Chr4 complement(230193..231041) [849 bp, 282 aa] {ON...   164   2e-48
TDEL0E02150 Chr5 complement(403001..403990) [990 bp, 329 aa] {ON...   164   7e-48
SAKL0G01914g Chr7 (162612..163601) [990 bp, 329 aa] {ON} highly ...   164   7e-48
SAKL0F14278g Chr6 (1143922..1144782) [861 bp, 286 aa] {ON} highl...   162   2e-47
YJR096W Chr10 (611195..612043) [849 bp, 282 aa] {ON} Putative xy...   162   2e-47
Kwal_47.18219 s47 (737925..738806) [882 bp, 293 aa] {ON} YJR096W...   162   2e-47
Skud_10.318 Chr10 (568560..569408) [849 bp, 282 aa] {ON} YJR096W...   160   7e-47
KLTH0G05786g Chr7 complement(460135..460995) [861 bp, 286 aa] {O...   160   1e-46
KAFR0G00920 Chr7 complement(215664..216524) [861 bp, 286 aa] {ON...   159   4e-46
NCAS0H00560 Chr8 complement(96020..96874) [855 bp, 284 aa] {ON} ...   159   4e-46
KLLA0E21627g Chr5 complement(1929294..1930283) [990 bp, 329 aa] ...   159   7e-46
Suva_12.184 Chr12 (289608..290456) [849 bp, 282 aa] {ON} YJR096W...   157   1e-45
SAKL0F02574g Chr6 complement(220827..221696) [870 bp, 289 aa] {O...   157   2e-45
Smik_10.384 Chr10 (600097..600945) [849 bp, 282 aa] {ON} YJR096W...   157   2e-45
Kpol_1013.82 s1013 complement(200564..201421) [858 bp, 285 aa] {...   155   8e-45
Kwal_47.18893 s47 (1017098..1017967) [870 bp, 289 aa] {ON} YJR09...   155   9e-45
TDEL0C03320 Chr3 (591171..592022) [852 bp, 283 aa] {ON} Anc_7.46...   154   2e-44
Kwal_55.21536 s55 complement(877191..878180) [990 bp, 329 aa] {O...   153   2e-43
CAGL0C04543g Chr3 (434137..435000) [864 bp, 287 aa] {ON} highly ...   151   4e-43
KLTH0G02420g Chr7 complement(188767..189636) [870 bp, 289 aa] {O...   149   2e-42
KLLA0F05775g Chr6 (560270..561199) [930 bp, 309 aa] {ON} highly ...   149   5e-42
ZYRO0G17600g Chr7 (1455426..1456277) [852 bp, 283 aa] {ON} highl...   147   8e-42
ABL209C Chr2 complement(11410..12342) [933 bp, 310 aa] {ON} Synt...   143   8e-40
Kpol_1020.13 s1020 (27790..28731) [942 bp, 313 aa] {ON} (27790.....   143   9e-40
Kwal_33.13276 s33 (153537..154445) [909 bp, 302 aa] {ON} YDL124W...   142   9e-40
Smik_4.113 Chr4 (216885..217823) [939 bp, 312 aa] {ON} YDL124W (...   142   2e-39
KLTH0F01892g Chr6 (149177..150085) [909 bp, 302 aa] {ON} similar...   142   2e-39
NCAS0A13740 Chr1 complement(2699208..2700137) [930 bp, 309 aa] {...   140   6e-39
NDAI0A02300 Chr1 (516594..517535) [942 bp, 313 aa] {ON} Anc_7.285     139   3e-38
Skud_4.131 Chr4 (235946..236884) [939 bp, 312 aa] {ON} YDL124W (...   137   2e-37
Kwal_47.19278 s47 complement(1169418..1170362) [945 bp, 314 aa] ...   136   3e-37
ZYRO0E09614g Chr5 complement(765913..766839) [927 bp, 308 aa] {O...   135   8e-37
Kpol_381.8 s381 complement(20844..21359,21366..21695,21698..2178...   134   1e-36
YDL124W Chr4 (240259..241197) [939 bp, 312 aa] {ON} NADPH-depend...   134   1e-36
KAFR0B01200 Chr2 (224411..225358) [948 bp, 315 aa] {ON} Anc_7.28...   132   1e-35
CAGL0J09394g Chr10 (925839..926774) [936 bp, 311 aa] {ON} simila...   132   1e-35
KLTH0G00638g Chr7 (43280..44221) [942 bp, 313 aa] {ON} similar t...   131   3e-35
KNAG0C04110 Chr3 (806389..807324) [936 bp, 311 aa] {ON} Anc_7.28...   130   7e-35
SAKL0F09746g Chr6 complement(746292..747230) [939 bp, 312 aa] {O...   130   8e-35
TBLA0F01980 Chr6 (493378..494286) [909 bp, 302 aa] {ON} Anc_7.28...   129   2e-34
TDEL0D02790 Chr4 complement(533517..534506) [990 bp, 329 aa] {ON}     127   8e-34
SAKL0F00704g Chr6 (60941..61888) [948 bp, 315 aa] {ON} similar t...   126   2e-33
ZYRO0C09196g Chr3 complement(698826..699764) [939 bp, 312 aa] {O...   122   5e-32
Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON} ...   115   2e-29
Kwal_33.13274 s33 (151643..151969) [327 bp, 108 aa] {ON} YJR096W...    65   9e-13
Suva_4.122 Chr4 (228898..228945,228942..229163,229167..229517) [...    48   8e-06
Suva_12.272 Chr12 complement(441543..442262,442266..442340) [795...    44   2e-04
KNAG0M02340 Chr13 complement(431237..432166) [930 bp, 309 aa] {O...    43   4e-04
Ecym_2296 Chr2 complement(574287..575309) [1023 bp, 340 aa] {ON}...    43   7e-04
Kwal_26.8377 s26 (759190..760206) [1017 bp, 338 aa] {ON} YMR041C...    37   0.046
NCAS0A12950 Chr1 complement(2551851..2552822) [972 bp, 323 aa] {...    37   0.062
KLTH0D08844g Chr4 (738727..739749) [1023 bp, 340 aa] {ON} simila...    35   0.13 
YDL243C Chr4 complement(17577..18566) [990 bp, 329 aa] {ON}  AAD...    35   0.15 
YNL331C Chr14 complement(16118..17248) [1131 bp, 376 aa] {ON}  A...    35   0.15 
TPHA0C02560 Chr3 (568135..569157) [1023 bp, 340 aa] {ON} Anc_2.6...    35   0.17 
TBLA0B10110 Chr2 complement(2432572..2433609) [1038 bp, 345 aa] ...    35   0.17 
YFL056C Chr6 complement(14793..15431) [639 bp, 212 aa] {ON}  AAD...    34   0.23 
Skud_10.383 Chr10 (684416..685546) [1131 bp, 376 aa] {ON} YNL331...    35   0.28 
Kpol_449.4 s449 (14334..15359) [1026 bp, 341 aa] {ON} (14334..15...    34   0.37 
TBLA0G01120 Chr7 complement(285827..286858) [1032 bp, 343 aa] {O...    34   0.39 
NCAS0C02450 Chr3 complement(455582..456613) [1032 bp, 343 aa] {O...    34   0.44 
ZYRO0F00858g Chr6 (68107..69147) [1041 bp, 346 aa] {ON} similar ...    34   0.44 
KAFR0C03670 Chr3 complement(747792..748823) [1032 bp, 343 aa] {O...    33   0.65 
Smik_14.1 Chr14 complement(607..1737) [1131 bp, 376 aa] {ON} YNL...    33   0.71 
Suva_14.10 Chr14 complement(10349..11479) [1131 bp, 376 aa] {ON}...    33   0.78 
Smik_4.627 Chr4 complement(1123137..1125149) [2013 bp, 670 aa] {...    33   1.1  
TDEL0F00160 Chr6 (17872..19386) [1515 bp, 504 aa] {ON}                 33   1.3  
KLTH0D13750g Chr4 complement(1120534..1121550) [1017 bp, 338 aa]...    32   1.4  
KAFR0F03890 Chr6 complement(761303..762262) [960 bp, 319 aa] {ON}      32   1.9  
NCAS0J01680 Chr10 complement(302247..308384) [6138 bp, 2045 aa] ...    32   2.1  
NDAI0J02670 Chr10 (667719..673874) [6156 bp, 2051 aa] {ON} Anc_4...    32   2.2  
Suva_13.210 Chr13 complement(341369..342400) [1032 bp, 344 aa] {...    32   2.5  
Skud_3.179 Chr3 (292171..293205) [1035 bp, 344 aa] {ON} YPL088W ...    32   2.5  
SAKL0H09438g Chr8 (803426..804454) [1029 bp, 342 aa] {ON} highly...    30   8.2  
KLLA0B09658g Chr2 complement(837873..838901) [1029 bp, 342 aa] {...    30   9.4  
Smik_3.208 Chr3 (305264..306298) [1035 bp, 344 aa] {ON} YPL088W ...    30   9.5  

>KNAG0C04910 Chr3 complement(949367..950308) [942 bp, 313 aa] {ON}
           Anc_5.434 YOR120W
          Length = 313

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/313 (100%), Positives = 313/313 (100%)

Query: 1   MSATLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNE 60
           MSATLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNE
Sbjct: 1   MSATLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNE 60

Query: 61  AEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRG 120
           AEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRG
Sbjct: 61  AEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRG 120

Query: 121 ENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDL 180
           ENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDL
Sbjct: 121 ENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDL 180

Query: 181 LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIA 240
           LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIA
Sbjct: 181 LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIA 240

Query: 241 KKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKR 300
           KKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKR
Sbjct: 241 KKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKR 300

Query: 301 IIDPDWEPFKPFV 313
           IIDPDWEPFKPFV
Sbjct: 301 IIDPDWEPFKPFV 313

>Suva_8.173 Chr8 (308911..309849) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  467 bits (1201), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 218/312 (69%), Positives = 258/312 (82%), Gaps = 1/312 (0%)

Query: 1   MSATLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNE 60
           MSATL  +T  L LNTGA I  +GLGTW+S    DAY SV+AAL+ GYRHIDTAAIYGNE
Sbjct: 1   MSATLQYSTKTLPLNTGAKIPQVGLGTWQSKD-NDAYKSVVAALKDGYRHIDTAAIYGNE 59

Query: 61  AEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRG 120
            +VG+AI++SGVPR EIFVTTKLWCTQH EP  ALDQSLKRLGLDYVDLYLMHWPVR+  
Sbjct: 60  DQVGQAIKDSGVPREEIFVTTKLWCTQHHEPAKALDQSLKRLGLDYVDLYLMHWPVRLDP 119

Query: 121 ENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDL 180
             + +G  +  PT  +G R +DIT+WNF+KTWELMQ+LP+T KTRA+GVSNFSINNLKDL
Sbjct: 120 NYIKDGHILSIPTKEDGSRPVDITNWNFIKTWELMQELPKTNKTRAVGVSNFSINNLKDL 179

Query: 181 LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIA 240
           LASPGN++ PAANQVE+HPLLPQ EL+DFC  KGI++EAYSPLGS DAP+LKEPV++EIA
Sbjct: 180 LASPGNQLTPAANQVELHPLLPQNELIDFCKSKGIMVEAYSPLGSTDAPLLKEPVVLEIA 239

Query: 241 KKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKR 300
           KKN V    VVISW+ QRGY+VLPKSVN +RI+ N   FTL+ EDFEA+NNISK +G KR
Sbjct: 240 KKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIKTNRKVFTLSDEDFEAINNISKEKGEKR 299

Query: 301 IIDPDWEPFKPF 312
           +++PDW PF+ F
Sbjct: 300 VVNPDWSPFEAF 311

>YOR120W Chr15 (551114..552052) [939 bp, 312 aa] {ON}  GCY1Putative
           NADP(+) coupled glycerol dehydrogenase, proposed to be
           involved in an alternative pathway for glycerol
           catabolism; also has mRNA binding activity; member of
           the aldo-keto reductase (AKR) family
          Length = 312

 Score =  459 bits (1181), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 216/312 (69%), Positives = 257/312 (82%), Gaps = 1/312 (0%)

Query: 1   MSATLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNE 60
           M ATL  +T +L LNTGA I  IGLGTW+S    DAY +V+ AL+ GYRHIDTAAIY NE
Sbjct: 1   MPATLHDSTKILSLNTGAQIPQIGLGTWQSKE-NDAYKAVLTALKDGYRHIDTAAIYRNE 59

Query: 61  AEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRG 120
            +VG+AI++SGVPR EIFVTTKLWCTQH EPE+ALDQSLKRLGLDYVDLYLMHWP R+  
Sbjct: 60  DQVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDP 119

Query: 121 ENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDL 180
             +   D +  PT  +G R +DIT+WNF+KTWELMQ+LP+TGKT+A+GVSNFSINNLKDL
Sbjct: 120 AYIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDL 179

Query: 181 LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIA 240
           LAS GNK+ PAANQVE+HPLLPQ EL++FC  KGIV+EAYSPLGS DAP+LKEPVI+EIA
Sbjct: 180 LASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIA 239

Query: 241 KKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKR 300
           KKN V    VVISW+VQRGY+VLPKSVN +RI+ N   FTL++EDFEA+NNISK +G KR
Sbjct: 240 KKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKR 299

Query: 301 IIDPDWEPFKPF 312
           ++ P+W PF+ F
Sbjct: 300 VVHPNWSPFEVF 311

>Skud_15.283 Chr15 (507542..508480) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  458 bits (1179), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 215/312 (68%), Positives = 257/312 (82%), Gaps = 1/312 (0%)

Query: 1   MSATLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNE 60
           M ATL  +T  L LNTGA I  +GLGTW+S    DAY SV+AAL+ GYRHIDTAAIY NE
Sbjct: 1   MPATLQDSTRTLSLNTGAQIPQVGLGTWQSKD-NDAYKSVLAALKDGYRHIDTAAIYRNE 59

Query: 61  AEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRG 120
            +VG+AIR+SGVPR +IFVTTKLWCTQH EP  ALDQSL+RLGLDYVDLYLMHWPVR+  
Sbjct: 60  DQVGQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDP 119

Query: 121 ENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDL 180
           + + +G+ +  PT  +G R +DIT+WNF+KTWELMQ+LP+TGK +A+GVSNFSINNLKDL
Sbjct: 120 DYIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDL 179

Query: 181 LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIA 240
           LAS GNK+ PAANQVE+HPLLPQ EL+DFC GKGI+IE YSPLGS DAP+LKEPVI+EIA
Sbjct: 180 LASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIA 239

Query: 241 KKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKR 300
           KKN V  A VVISW+ QRGY+VLPKSVN +R++AN   FTL+ EDFEA+N ISK +G KR
Sbjct: 240 KKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKR 299

Query: 301 IIDPDWEPFKPF 312
           ++ P+W PF+ F
Sbjct: 300 VVHPNWSPFEAF 311

>NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434
          Length = 322

 Score =  453 bits (1165), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 209/313 (66%), Positives = 260/313 (83%), Gaps = 2/313 (0%)

Query: 1   MSATLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNE 60
           MSA  S +T+  KLNTGATI A+GLGTW+S    + Y++VIAAL+AGYRHIDTAAIYGNE
Sbjct: 12  MSA--SNSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNE 69

Query: 61  AEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRG 120
            +VG+AI +SGVPR EIFVTTKLW TQH +P   L+ SLKRLGLDYVDLYLMHWPV +  
Sbjct: 70  GQVGKAINDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNP 129

Query: 121 ENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDL 180
            ++ +G+ +  P LP+GKRD++I  W++VKTWELMQ+LP+TGKTRA+GVSNFSINNLK +
Sbjct: 130 RSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKV 189

Query: 181 LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIA 240
           L+SPGNK+VPA NQVE+HPLLPQ+EL+++CH KGI++EAYSPLGS +APIL EPV+I +A
Sbjct: 190 LSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLA 249

Query: 241 KKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKR 300
           KK+GV  AQ+VISW+VQRGYIVLPKSV+ ERI+AN  T  L+ E+   +NNISK +G +R
Sbjct: 250 KKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERR 309

Query: 301 IIDPDWEPFKPFV 313
           I+ P WEPF PFV
Sbjct: 310 IVQPHWEPFVPFV 322

>Smik_15.298 Chr15 (512239..513177) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  452 bits (1163), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 211/312 (67%), Positives = 256/312 (82%), Gaps = 1/312 (0%)

Query: 1   MSATLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNE 60
           MS TL  +T  L LNTGA I  +GLGTW+S    DAY SV+AAL+AGY+HIDTAAIY NE
Sbjct: 1   MSTTLHDSTKTLSLNTGAQIPQVGLGTWQSKD-NDAYKSVLAALKAGYKHIDTAAIYRNE 59

Query: 61  AEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRG 120
            +VG+AI++SGVPR EIFVTTKLW TQH EP  ALD+SL+RLGLDYVDLYL+HWP R+  
Sbjct: 60  DQVGQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDT 119

Query: 121 ENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDL 180
             + +GD +  PT  +G R +D+T+WNF+KTWELMQ+LP+TGKT+AIGVSNFSINNLKDL
Sbjct: 120 NYIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDL 179

Query: 181 LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIA 240
           LASPGNK+ PAANQVE+HPLLPQ EL++FC  K I+IEAYSPLGS DAP+LKEP I++IA
Sbjct: 180 LASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIA 239

Query: 241 KKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKR 300
           KKN V    VVISW+ QRGY+VLPKSVN +RIE N   FTL++EDFEA+NNISK +G KR
Sbjct: 240 KKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKR 299

Query: 301 IIDPDWEPFKPF 312
           +++P+W PF+ F
Sbjct: 300 VVNPNWSPFEAF 311

>NDAI0C01600 Chr3 complement(342011..342952) [942 bp, 313 aa] {ON}
           Anc_5.434
          Length = 313

 Score =  451 bits (1161), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 208/313 (66%), Positives = 262/313 (83%)

Query: 1   MSATLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNE 60
           M +TL  +T+  KLNTGATI A+GLGTW+S    + Y++V+ AL+AGYRHIDTAAIY NE
Sbjct: 1   MGSTLKNSTATYKLNTGATIPAVGLGTWQSTNENEGYEAVMNALKAGYRHIDTAAIYKNE 60

Query: 61  AEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRG 120
            +VG+AI +SG+PR EIFVTTKLW TQH++PE AL+QSL+RLGLDYVDLYLMHWPV  + 
Sbjct: 61  DQVGKAINDSGIPREEIFVTTKLWGTQHRDPETALNQSLERLGLDYVDLYLMHWPVAFKP 120

Query: 121 ENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDL 180
           +++ +G+    P LPNG+RD+D+T WNFVKTWELMQ+LP+TGKTRA+GVSNFSINNLK L
Sbjct: 121 DSIKDGNYSTMPMLPNGQRDLDLTTWNFVKTWELMQELPKTGKTRAVGVSNFSINNLKAL 180

Query: 181 LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIA 240
           L+SPGNK+VPAANQVE HPLLPQ EL  FC  KGI++EAYSPLGS +APIL EP IIEIA
Sbjct: 181 LSSPGNKLVPAANQVEAHPLLPQDELQKFCKEKGIILEAYSPLGSTNAPILTEPKIIEIA 240

Query: 241 KKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKR 300
           KK+ V  AQVVISW+VQ+G++VLPKSV++ERI+AN  TF L+ ++ +++NN+SK +G +R
Sbjct: 241 KKHNVQPAQVVISWHVQKGHVVLPKSVHEERIKANFQTFELSKDEMDSLNNLSKEKGERR 300

Query: 301 IIDPDWEPFKPFV 313
           I+ P+W PF PFV
Sbjct: 301 IVQPNWAPFVPFV 313

>CAGL0I01100g Chr9 complement(91693..92625) [933 bp, 310 aa] {ON}
           highly similar to uniprot|P14065 Saccharomyces
           cerevisiae YOR120w GCY1 or uniprot|Q12458 Saccharomyces
           cerevisiae YDR368w YPR1
          Length = 310

 Score =  433 bits (1114), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 206/311 (66%), Positives = 249/311 (80%), Gaps = 2/311 (0%)

Query: 3   ATLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAE 62
           A L KNTS LKLNTGA I  IGLGTW+S+   + Y++ + AL+AGYRHIDTAAIY NE E
Sbjct: 2   AALHKNTSTLKLNTGAHIPVIGLGTWQSSE-NEGYNATLEALKAGYRHIDTAAIYKNEEE 60

Query: 63  VGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRGEN 122
           +GRAIR+S +PR E+FVTTKLW TQH+ P  ALDQSLKRLGLDYVDLYLMHWPV ++ + 
Sbjct: 61  IGRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDL 120

Query: 123 MPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDLLA 182
           + +G+ +  P   +G RD+D+ DWNFVKTWELMQ+LP+  K RAIGVSNFSINNLK+LL 
Sbjct: 121 IKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELLN 179

Query: 183 SPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIAKK 242
           S GNK+VPAANQ+E+HPLLPQ EL++FC  KGIV+EAYSPLGS DAPILKE  I EIAKK
Sbjct: 180 SKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKK 239

Query: 243 NGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKRII 302
           NGV+A Q+VISW+ QRGY+VLPKSV  ERI  N  TF L+ EDF  ++N +K  G +R++
Sbjct: 240 NGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVV 299

Query: 303 DPDWEPFKPFV 313
            P+W PFKPFV
Sbjct: 300 SPNWGPFKPFV 310

>CAGL0A02816g Chr1 (296851..297783) [933 bp, 310 aa] {ON} highly
           similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368w YPR1
          Length = 310

 Score =  427 bits (1099), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 201/309 (65%), Positives = 244/309 (78%), Gaps = 1/309 (0%)

Query: 4   TLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEV 63
           +L  +T+ LKLNTGA I  +GLGTWRSAA  D YDSV+AAL+ GYRHID AAIYGNE +V
Sbjct: 2   SLKNSTATLKLNTGAEIPVVGLGTWRSAA-NDGYDSVLAALKLGYRHIDAAAIYGNEDQV 60

Query: 64  GRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRGENM 123
           GRAI++SGVPR EIF+TTKLW T+H+ P  ALD SLKRLGLDYVDLYLMHWPV ++    
Sbjct: 61  GRAIKDSGVPRQEIFITTKLWGTEHRNPAKALDSSLKRLGLDYVDLYLMHWPVALKAHGS 120

Query: 124 PEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDLLAS 183
            E D +  P  P+GK DIDI DW+F+KTWELMQ+LP+TGKT+AIGVSNFSINNLK L  S
Sbjct: 121 EEKDLLNIPKKPDGKTDIDIEDWDFIKTWELMQELPKTGKTKAIGVSNFSINNLKALKNS 180

Query: 184 PGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIAKKN 243
           P    VPAANQVE+HPL PQ EL+++C  + I+IEAYSP GSADAP+LKEP + ++A+K 
Sbjct: 181 PKFNTVPAANQVEIHPLFPQTELIEYCKSENILIEAYSPFGSADAPVLKEPELHKLAEKY 240

Query: 244 GVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKRIID 303
            +S AQ++ISW+VQRGY+VLPKSV+ ERIEANL   TL  ED E + N+SKV+G KR++ 
Sbjct: 241 NISTAQLIISWSVQRGYVVLPKSVHAERIEANLKVLTLKDEDMETITNLSKVKGEKRLVQ 300

Query: 304 PDWEPFKPF 312
            DW PF  F
Sbjct: 301 LDWSPFPTF 309

>YDR368W Chr4 (1213904..1214842) [939 bp, 312 aa] {ON}
           YPR1NADPH-dependent aldo-keto reductase, reduces
           multiple substrates including 2-methylbutyraldehyde and
           D,L-glyceraldehyde, expression is induced by osmotic and
           oxidative stress; functionally redundant with other
           aldo-keto reductases
          Length = 312

 Score =  424 bits (1090), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 198/312 (63%), Positives = 252/312 (80%), Gaps = 1/312 (0%)

Query: 1   MSATLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNE 60
           M ATL  +++ LKLNTGA+I  +G GTWRS    + Y SVIAAL+AGYRHID AAIY NE
Sbjct: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVD-NNGYHSVIAALKAGYRHIDAAAIYLNE 59

Query: 61  AEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRG 120
            EVGRAI++SGVPR EIF+TTKLW T+ ++PE AL++SLKRLGLDYVDLYLMHWPV ++ 
Sbjct: 60  EEVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKT 119

Query: 121 ENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDL 180
           + + +G+ +  PTL +G  DID  +WNF+KTWELMQ+LP+TGKT+A+GVSNFSINN+K+L
Sbjct: 120 DRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKEL 179

Query: 181 LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIA 240
           L SP NK+VPA NQ+E+HPLLPQ EL+ FC  KGIV+EAYSP GSA+AP+LKE  II++A
Sbjct: 180 LESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMA 239

Query: 241 KKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKR 300
           KK+GV  AQ++ISW++QRGY+VL KSVN ERI +N   FTL  +DF+ ++N+SKV GTKR
Sbjct: 240 KKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKR 299

Query: 301 IIDPDWEPFKPF 312
           ++D  W  F  F
Sbjct: 300 VVDMKWGSFPIF 311

>SAKL0G02530g Chr7 (208952..209890) [939 bp, 312 aa] {ON} similar to
           uniprot|Q12458 Saccharomyces cerevisiae YDR368W YPR1
           2-methylbutyraldehyde reductase may be involved in
           isoleucine catabolism
          Length = 312

 Score =  424 bits (1090), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 197/312 (63%), Positives = 250/312 (80%), Gaps = 1/312 (0%)

Query: 1   MSATLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNE 60
           MS  L  +++ +KLNTGA I  +GLGTWRS+   +AY+SV++A++ GYRHID+AAIYGNE
Sbjct: 1   MSIQLKNSSATVKLNTGAIIPQLGLGTWRSSD-EEAYNSVLSAIKLGYRHIDSAAIYGNE 59

Query: 61  AEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRG 120
             VG+AIR+SGVPR E+FVTTKLW TQ + PE ALD SLKRLGLDYVDLYL+HWP+  + 
Sbjct: 60  EPVGKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKT 119

Query: 121 ENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDL 180
           +N+ + D +  PT  +GK D+D+ DWNFVKTWEL+Q+LP TGK +A+GVSNFS+NNLK+L
Sbjct: 120 DNIKDDDYLTVPTGKDGKADVDVKDWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKEL 179

Query: 181 LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIA 240
           LASPGNK+VPA NQVE+HPLLPQ EL++F   KGIVIEAYSPLGS  +P+LKEPVIIE+A
Sbjct: 180 LASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVA 239

Query: 241 KKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKR 300
           KK GV  AQV+I+W +QRGY++LPKSVN +R+E+N   F L+ ED + ++ ISK QG KR
Sbjct: 240 KKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKR 299

Query: 301 IIDPDWEPFKPF 312
            + PDW  F  F
Sbjct: 300 FVHPDWPSFPIF 311

>Suva_2.540 Chr2 (964433..965371) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  422 bits (1086), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 196/312 (62%), Positives = 251/312 (80%), Gaps = 1/312 (0%)

Query: 1   MSATLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNE 60
           M ATL  +++ LKLNTGA+I  +G GTWRS   +  Y SVIAAL+AGYRHID AAIY NE
Sbjct: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVDNS-GYHSVIAALKAGYRHIDAAAIYLNE 59

Query: 61  AEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRG 120
            EVG+AI++SGVPR EIF+TTKLW T+ ++PE ALD+SLKRLGLDYVDLYLMHWPV ++ 
Sbjct: 60  EEVGKAIKDSGVPREEIFITTKLWGTEQRDPEAALDKSLKRLGLDYVDLYLMHWPVPLKT 119

Query: 121 ENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDL 180
           + + +GD +  PTL +G  D+D  +WNFVKTW+LMQKLP+TGKT+A+GVSNFSINN+K+L
Sbjct: 120 DTITDGDFLCIPTLEDGTIDVDTKEWNFVKTWDLMQKLPKTGKTKAVGVSNFSINNIKEL 179

Query: 181 LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIA 240
           L SP NK+VPA NQ+E+HPLLPQ EL+ FC  KGIV+EAYSP GSA+AP+LKE  II++A
Sbjct: 180 LKSPSNKLVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMA 239

Query: 241 KKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKR 300
           KK+GV  AQ++ISW++QRGY+VL KSVN ER+ +N   FTL  +DF+ ++N+SKV G KR
Sbjct: 240 KKHGVEPAQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKTISNLSKVHGEKR 299

Query: 301 IIDPDWEPFKPF 312
           +++  W  F  F
Sbjct: 300 VVNMQWNSFPIF 311

>Smik_4.634 Chr4 (1133924..1134862) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  419 bits (1076), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 194/312 (62%), Positives = 251/312 (80%), Gaps = 1/312 (0%)

Query: 1   MSATLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNE 60
           M ATL  +++ LKLNTGA+I  +G GTWRS    + Y SVIAAL+AGYRHID AAIY NE
Sbjct: 1   MPATLKNSSASLKLNTGASIPVLGFGTWRSVE-NNGYHSVIAALKAGYRHIDAAAIYLNE 59

Query: 61  AEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRG 120
            EVGRAI++SGVPR +IF+TTKLW T+ ++PE AL++SLKRLGLDYVDLYLMHWPV ++ 
Sbjct: 60  EEVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKT 119

Query: 121 ENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDL 180
           E + +G+ +  PTL +G  D+D  +WNF+KTW+LMQ+LP+TGKT+A+GVSNFSINN+K L
Sbjct: 120 ETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKAL 179

Query: 181 LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIA 240
           L SP NK+VPAANQ+E+HPLLPQ EL+ FC  KGIV+EAYSP GS +AP+L+E  II++A
Sbjct: 180 LESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMA 239

Query: 241 KKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKR 300
           KK+GV+ AQ++ISW++QRGY+VL KSVN ERI +N   FTL  +DF+ ++N+SKV G KR
Sbjct: 240 KKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKR 299

Query: 301 IIDPDWEPFKPF 312
           ++D  W  F  F
Sbjct: 300 VVDMKWSSFPIF 311

>Skud_4.637 Chr4 (1136769..1137707) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  414 bits (1065), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 192/312 (61%), Positives = 250/312 (80%), Gaps = 1/312 (0%)

Query: 1   MSATLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNE 60
           M ATL  +++ LKLNTGA+I A+G GTWRS    + Y SVIAAL+ GYRHID AAIY NE
Sbjct: 1   MPATLRNSSATLKLNTGASIPALGFGTWRSVD-NNGYHSVIAALKTGYRHIDAAAIYLNE 59

Query: 61  AEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRG 120
            EVGRAI++SG+ R EIF+TTKLW T+ ++PE AL++SLKRLGLDYVDLYLMHWPV ++ 
Sbjct: 60  EEVGRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKT 119

Query: 121 ENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDL 180
           + + +G+ +  PTL +G  D+D  +WNF+KTW+LMQ+LP+TGKTRA+GVSNFSINN+K+L
Sbjct: 120 DTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKEL 179

Query: 181 LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIA 240
           L SP NK+VPA NQVE+HPLLPQ EL+ FC  KGIV+EAYSP GSA+AP+LKE  II++A
Sbjct: 180 LKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMA 239

Query: 241 KKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKR 300
           KK+GV  +Q++ISW++QRGY+VL KSVN ER+ +N   FTL  +DF+A+ ++SKV G KR
Sbjct: 240 KKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKR 299

Query: 301 IIDPDWEPFKPF 312
           +++  W  F  F
Sbjct: 300 VVNMKWASFPIF 311

>Kpol_1062.29 s1062 complement(63895..64830) [936 bp, 311 aa] {ON}
           complement(63895..64830) [936 nt, 312 aa]
          Length = 311

 Score =  410 bits (1054), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 195/310 (62%), Positives = 242/310 (78%), Gaps = 2/310 (0%)

Query: 4   TLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEV 63
           +L    + +KLNTGA + A+GLGTW+S    DAY +V+ AL+ GYRHID AAIY NE EV
Sbjct: 2   SLKNCETRVKLNTGAELPAVGLGTWQSLE-NDAYKAVLTALKTGYRHIDGAAIYCNEGEV 60

Query: 64  GRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRGENM 123
           G+AIR+SGVPR EIFVTTKLW TQ + P+LAL+QSL+RLGLDYVDLYL+HWP+ +     
Sbjct: 61  GKAIRDSGVPRNEIFVTTKLWGTQQRTPQLALEQSLERLGLDYVDLYLIHWPIPLNPAQC 120

Query: 124 PE-GDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDLLA 182
            E G+ + FP LPNGKRD+D+  WNFVKTWELMQ+LP TGK +A+GVSNFSINN+K+LL+
Sbjct: 121 EESGNYLTFPGLPNGKRDVDLDTWNFVKTWELMQELPATGKCKAVGVSNFSINNIKELLS 180

Query: 183 SPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIAKK 242
           SPGNK+VPA NQ+E+HPLLPQ ELV+FC  KGIV+EAYSPLG   A ILKEP++ E+AKK
Sbjct: 181 SPGNKLVPAVNQIELHPLLPQVELVNFCKEKGIVVEAYSPLGGTGAAILKEPLVEELAKK 240

Query: 243 NGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKRII 302
             + AA +V+SW+VQRG +VLPKSV + RI +NL T TL  ED E + N+SK +G KR  
Sbjct: 241 YNIPAANLVVSWDVQRGVVVLPKSVTESRIISNLQTLTLAPEDVEKITNLSKEKGEKRTC 300

Query: 303 DPDWEPFKPF 312
            PD+ PF  F
Sbjct: 301 APDFSPFNTF 310

>KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON} 
          Length = 311

 Score =  407 bits (1047), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 200/312 (64%), Positives = 247/312 (79%), Gaps = 2/312 (0%)

Query: 1   MSATLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNE 60
           M++TL   T+ LKLNTGA++  +GLGTWR+    + Y++V +AL AGYRHIDTAAIY NE
Sbjct: 1   MASTLQNTTTTLKLNTGASLPILGLGTWRATDDQEGYNAVKSALEAGYRHIDTAAIYQNE 60

Query: 61  AEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRG 120
             VGRAIRESG+PR EIFVTTKLW TQH++P  ALDQSL+RLGLDYVDLYLMHWPV M  
Sbjct: 61  EVVGRAIRESGIPRDEIFVTTKLWGTQHRDPAAALDQSLERLGLDYVDLYLMHWPVPMEA 120

Query: 121 ENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDL 180
           +       + FP  P+G   ++ +DW+F+KTWELMQ+LP+T KTRAIGVSNFSINN+ DL
Sbjct: 121 KYSKSSSLLEFPYRPDGSLAVE-SDWDFIKTWELMQELPKT-KTRAIGVSNFSINNINDL 178

Query: 181 LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIA 240
           L SPGNKIVPAANQVE+HPLLPQ ELV FC  KGIV+EAYSP GS  AP+L E  IIE+A
Sbjct: 179 LKSPGNKIVPAANQVELHPLLPQAELVTFCQEKGIVVEAYSPFGSVSAPLLSEQAIIEVA 238

Query: 241 KKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKR 300
           KK+ VSAAQV++SW+++RG  VLPKSV+KER+ +N  TF+L  +DF  +NN+SK +G KR
Sbjct: 239 KKHDVSAAQVILSWHIKRGIAVLPKSVHKERVVSNFKTFSLPEDDFATINNVSKEKGEKR 298

Query: 301 IIDPDWEPFKPF 312
           +++ DW PFK F
Sbjct: 299 VVNFDWSPFKIF 310

>NCAS0F03380 Chr6 (682072..683013) [942 bp, 313 aa] {ON} Anc_5.434
          Length = 313

 Score =  404 bits (1038), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 205/312 (65%), Positives = 246/312 (78%)

Query: 1   MSATLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNE 60
           M+ TL  +T+ LKLNTGA I  I LGTWRS  ATD YDSVIAAL+AGYRHIDTAAIYGNE
Sbjct: 1   MTVTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNE 60

Query: 61  AEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRG 120
            +VG+AIR+SG+PR EIFVT+KLW TQ   P  AL  +L RLGLDY+DLYLMHWPV    
Sbjct: 61  DQVGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNT 120

Query: 121 ENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDL 180
            N+   D +  P   NGK DI++  WNFVKTWELMQ+LP TG T+A+GVSNFSINNLK+L
Sbjct: 121 RNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL 180

Query: 181 LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIA 240
           L SPGNK+ PAANQ+E+HPLLP+ +L+ FC  KGI+IEAYSPLGS +APILKEP IIEI+
Sbjct: 181 LTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEIS 240

Query: 241 KKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKR 300
           KK  V  AQ++ISW+VQRGY+VL KS ++ERI AN   FTL+ EDFEA+ N++K +GT R
Sbjct: 241 KKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLR 300

Query: 301 IIDPDWEPFKPF 312
           ++DPDW PF  F
Sbjct: 301 VVDPDWSPFPLF 312

>NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5.434
          Length = 318

 Score =  403 bits (1035), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 192/309 (62%), Positives = 239/309 (77%), Gaps = 6/309 (1%)

Query: 10  SLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVGRAIRE 69
           ++LKL+TGA+I  IGLGTWRS    DAY SVIAAL+ GYRHIDTAAIYGNEA+VG+AIR+
Sbjct: 9   NILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAIRD 68

Query: 70  SGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRGENMPEGDKI 129
           SGVPR EIFVT+KLWC Q  +P+LAL+Q+LKRLGLDY+DLYLMHWPV     ++ + D  
Sbjct: 69  SGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDEDGS 128

Query: 130 G-----FPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDLLASP 184
           G      PT  NG  D+++  WNF+KTWELMQ LPE+GKT+A+GVSNFSINNL DLLA+ 
Sbjct: 129 GDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLAAS 188

Query: 185 GNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIAKKNG 244
             K+VPAANQ+E+HPLL Q EL+ +C  K I++EAYSP GS +APILK+  I  IAKK  
Sbjct: 189 TTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIAKKLD 248

Query: 245 VSAAQVVISWNVQR-GYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKRIID 303
           +   QVV+SW++QR GY+VLPKSV++ERI AN    TL  EDF+A+NN+ K +G  R++D
Sbjct: 249 IQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGELRVVD 308

Query: 304 PDWEPFKPF 312
           PDW PF  F
Sbjct: 309 PDWSPFPLF 317

>TBLA0A02825 Chr1 complement(681691..682626) [936 bp, 311 aa] {ON}
          Length = 311

 Score =  400 bits (1028), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 195/312 (62%), Positives = 238/312 (76%), Gaps = 2/312 (0%)

Query: 1   MSATLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNE 60
           MSA L   T+ +KLNTGA I AIGLGTWRS    D YDSVIAA + GYRHIDTAAIYGNE
Sbjct: 1   MSAALKNCTATVKLNTGANIPAIGLGTWRSEN-NDGYDSVIAAAKVGYRHIDTAAIYGNE 59

Query: 61  AEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRG 120
            +VG+AI E GV R E+FVTTKLW TQ ++PE AL+QSLKRLGLDYVDLYL+HWPV  + 
Sbjct: 60  DQVGKAINECGVTRSELFVTTKLWGTQQRDPETALNQSLKRLGLDYVDLYLIHWPVAFKT 119

Query: 121 ENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDL 180
           + + +G+ +  P   +G+ DID  +WNF+KTWELMQ L +TGKT+AIG+SNFSINN+K+L
Sbjct: 120 DTIKDGNLLTIPK-KDGEADIDYPEWNFIKTWELMQNLLKTGKTKAIGISNFSINNIKEL 178

Query: 181 LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIA 240
           LA+P   + PA NQVE+HPLLPQ EL+ FC  KGIVIEAYSPLG  +AP+LK+  IIEIA
Sbjct: 179 LAAPTTTVTPACNQVEVHPLLPQDELIAFCKEKGIVIEAYSPLGGINAPVLKDETIIEIA 238

Query: 241 KKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKR 300
           K+N V A QVV SW+VQRGY+VLPKSV + RI +NL TFTL+ +D   +NN+ KV+G  R
Sbjct: 239 KRNNVDAGQVVTSWHVQRGYVVLPKSVKESRIISNLKTFTLSDDDMTKINNLVKVKGENR 298

Query: 301 IIDPDWEPFKPF 312
             D   + F  F
Sbjct: 299 TCDLGIKGFPMF 310

>KAFR0E03840 Chr5 complement(763027..763959) [933 bp, 310 aa] {ON}
           Anc_5.434 YOR120W
          Length = 310

 Score =  400 bits (1027), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 195/313 (62%), Positives = 237/313 (75%), Gaps = 3/313 (0%)

Query: 1   MSATLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNE 60
           MSA L  +T  LKLN G+ I  +GLGTW++    DAY++V AAL AGYRHIDTAAIY NE
Sbjct: 1   MSANLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNE 60

Query: 61  AEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRG 120
            +VG AIR+SGVPR EIFVTTKLW  QH EPE+ALD+SL+RLGLDYVDLYLMHWPV +  
Sbjct: 61  VQVGEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120

Query: 121 ENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDL 180
             M E   +     P+G R ++ TDW F+ TWELMQKLP+  K R+IGVSNFS+NNLKDL
Sbjct: 121 SYMKES-PLELMKRPDGTRPVE-TDWTFINTWELMQKLPK-NKVRSIGVSNFSVNNLKDL 177

Query: 181 LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIA 240
           L +P   +VP  NQVE+HPLLPQ ELVD+C    I +EAYSPLGS  AP+L EP++I++A
Sbjct: 178 LKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVA 237

Query: 241 KKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKR 300
           KKNGV  A VV+SW VQR  IVLPKSV+ ER+ ANL TFTL  EDF+A+  IS+ +G +R
Sbjct: 238 KKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERR 297

Query: 301 IIDPDWEPFKPFV 313
           I +P++EPFK FV
Sbjct: 298 INNPNFEPFKTFV 310

>ZYRO0F10032g Chr6 (813814..814746) [933 bp, 310 aa] {ON}
           uniprot|Q9HGX9 Zygosaccharomyces rouxii ZGCY2 Glycerol
           dehydrogenase
          Length = 310

 Score =  394 bits (1013), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 189/309 (61%), Positives = 233/309 (75%), Gaps = 2/309 (0%)

Query: 4   TLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEV 63
           TL  +TS LKLNTG TI  +GLGTWRS    + Y +VI AL+AGYRHID AA+YGNE EV
Sbjct: 3   TLQNSTSTLKLNTGQTIPQVGLGTWRSKE-NEGYKAVIEALKAGYRHIDGAAVYGNEGEV 61

Query: 64  GRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRGENM 123
           G+AI++SGVPR EIF+TTKLWCTQ + P+ ALDQSL+RLGLDYVDLYL+HWPV +R EN+
Sbjct: 62  GKAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENI 121

Query: 124 PEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDLLAS 183
            +G+   F   P+G +D+D+ +WNF+KTWELMQKL E+GKT+AIGVSNFS+NNLKDLLA+
Sbjct: 122 KDGNLFQFAEKPDGSKDVDL-EWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAA 180

Query: 184 PGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIAKKN 243
           P  K+ PA NQVE+HPLLPQ++L+ F    GIVIEAYSPLG  +APIL +P + EIAK N
Sbjct: 181 PTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKAN 240

Query: 244 GVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKRIID 303
           GV A  VVISW VQ+G + LPKSV   RI  NL   TL+  D   V+ + K +G +R   
Sbjct: 241 GVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTCY 300

Query: 304 PDWEPFKPF 312
            D+ PF  F
Sbjct: 301 QDFSPFPIF 309

>TDEL0E01910 Chr5 complement(361621..362556) [936 bp, 311 aa] {ON}
           Anc_5.434 YOR120W
          Length = 311

 Score =  388 bits (996), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 187/312 (59%), Positives = 236/312 (75%), Gaps = 2/312 (0%)

Query: 1   MSATLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNE 60
           MSATLS NTS +KLNTG TI  +GLGTWRS    D Y +V AAL+AGYRHID AAIY NE
Sbjct: 1   MSATLSNNTSTVKLNTGYTIPQVGLGTWRSKEG-DGYKAVTAALKAGYRHIDGAAIYLNE 59

Query: 61  AEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRG 120
            EVG+AIR+SG+PR E+F+TTKLW TQ + P+ AL+QSL+RLGL+YVDLYLMHWPV ++ 
Sbjct: 60  EEVGKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKT 119

Query: 121 ENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDL 180
           + + +G+ +  P   +GK D+D T+W+FVKTWELMQ+LP+T K R++GVSNFSINNLK+L
Sbjct: 120 KRITDGNLLSSPAKEDGKPDVD-TEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKEL 178

Query: 181 LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIA 240
           LASPGNK+VPA  QVE+HPLLPQ  L DFC    I +EAYSPLG   AP+L +P+I +IA
Sbjct: 179 LASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIA 238

Query: 241 KKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKR 300
            ++   A  VV+SW VQRG + LPKS   ER+ +NL TF L+ E+  ++NN+SK +G KR
Sbjct: 239 DRHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKR 298

Query: 301 IIDPDWEPFKPF 312
              PD  PF  F
Sbjct: 299 TNAPDMSPFPLF 310

>TBLA0A06510 Chr1 complement(1597737..1598675) [939 bp, 312 aa] {ON}
           Anc_5.434 YOR120W
          Length = 312

 Score =  387 bits (995), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 182/312 (58%), Positives = 235/312 (75%), Gaps = 1/312 (0%)

Query: 1   MSATLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNE 60
           M A L  + + + LN G  I ++GLGTW+S    D Y+SVI AL+AGYRHIDTAAIY NE
Sbjct: 1   MPAQLKNSDTYVTLNNGEKIPSVGLGTWKSQE-NDGYNSVIYALKAGYRHIDTAAIYRNE 59

Query: 61  AEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRG 120
            EVGRAI++SGVPR +IF+TTKLWCT+ + P+ AL+ SLKRLGLDYVDLYLMHWPV +  
Sbjct: 60  GEVGRAIKDSGVPRDQIFITTKLWCTEFQNPKRALESSLKRLGLDYVDLYLMHWPVVLNP 119

Query: 121 ENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDL 180
             + + D +  P LP+G RD+D+  W+++KTWEL+Q+LP TG TR++GVSNFSINNL+ +
Sbjct: 120 RYIKDDDYLVVPRLPDGTRDVDMETWDYIKTWELVQELPATGLTRSVGVSNFSINNLEKV 179

Query: 181 LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIA 240
           L+SPGNK+ PA NQVE+HPLLPQ EL  +C  K I +EAYSP GS +AP LK+  I++IA
Sbjct: 180 LSSPGNKLTPAVNQVELHPLLPQFELQKYCDSKKIKLEAYSPFGSDNAPNLKQKTIVDIA 239

Query: 241 KKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKR 300
            KNGVS AQV+ SW VQR  +VLPKSV++ER+ +N   F L+ ED   ++ ++KV G KR
Sbjct: 240 AKNGVSPAQVITSWIVQRDIVVLPKSVHEERVISNFKVFDLSKEDIAEIDALAKVNGEKR 299

Query: 301 IIDPDWEPFKPF 312
           I  PDW+PF  F
Sbjct: 300 INKPDWDPFPVF 311

>KLLA0B14707g Chr2 complement(1291951..1292883) [933 bp, 310 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 310

 Score =  380 bits (976), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 180/309 (58%), Positives = 233/309 (75%), Gaps = 1/309 (0%)

Query: 4   TLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEV 63
           + S  +  LKLNTGA+I  +GLGTW+S    DAY++V++AL+ GYRHIDTAAIYGNE  V
Sbjct: 2   STSNESPSLKLNTGASIPVVGLGTWKSPEE-DAYNAVVSALQNGYRHIDTAAIYGNEEAV 60

Query: 64  GRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRGENM 123
           G+ IR+SGVPR EIFVTTKLW TQ ++PE ALD SL+RLGLDYVDLYL+HWPV +   ++
Sbjct: 61  GKGIRDSGVPREEIFVTTKLWGTQQRDPEAALDLSLQRLGLDYVDLYLIHWPVPLNASSI 120

Query: 124 PEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDLLAS 183
            +G+ + FP   +GK DIDI +WNF+KTWE MQ LP++GKT+AIGVSNFSI N++ LLA+
Sbjct: 121 TDGNYLTFPRTADGKIDIDIEEWNFIKTWEKMQHLPKSGKTKAIGVSNFSIKNIEALLAA 180

Query: 184 PGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIAKKN 243
             + IVPAANQ+E+HP LPQ EL+D+C  KGI+IEAYSPLGS+ + IL +P I  IA K 
Sbjct: 181 NPDFIVPAANQIEIHPQLPQTELIDYCKSKGILIEAYSPLGSSSSTILTDPTIEGIASKY 240

Query: 244 GVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKRIID 303
               A ++ISW   RGY+VLPKSVN +RI+ NL    L++ED E +N +++  G KR + 
Sbjct: 241 NAEPANILISWGASRGYVVLPKSVNPQRIKTNLKLLDLSTEDLEKINKLTESVGAKRYVA 300

Query: 304 PDWEPFKPF 312
           PD+ PF  F
Sbjct: 301 PDFSPFAIF 309

>Kwal_47.18084 s47 complement(677816..678745) [930 bp, 309 aa] {ON}
           YOR120W (GCY1) - Similar to mammalian aldo/keto
           reductases [contig 198] FULL
          Length = 309

 Score =  380 bits (975), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 178/305 (58%), Positives = 234/305 (76%), Gaps = 2/305 (0%)

Query: 5   LSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVG 64
           L  NT + KLNTGATI  +G GTWRS    + Y++V++A++ GYRHID+AA+YGNEA VG
Sbjct: 4   LKNNTDIGKLNTGATIPLLGFGTWRSTEE-EGYNAVLSAIKDGYRHIDSAAVYGNEAAVG 62

Query: 65  RAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRGENMP 124
           RAIR+SGVPR E+FVTTKLW TQ +EP  ALDQSL+RLGLDYVDLYL+HWP+ ++ + + 
Sbjct: 63  RAIRDSGVPREELFVTTKLWNTQQREPAKALDQSLQRLGLDYVDLYLIHWPLPIKTDRIT 122

Query: 125 EGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDLLASP 184
           +G+    PT  +GK D+D T+W+++KTW+LMQ+LP TGKTRA+GVSN S++ L+ LLA  
Sbjct: 123 DGNLFSIPTKEDGKPDVD-TEWDYIKTWQLMQELPSTGKTRAVGVSNVSVSQLEKLLADK 181

Query: 185 GNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIAKKNG 244
           GNK+VPA  QVE HPLLPQ +L+DFC    I++EAYSPLGS  +P++ EPVI EIAKK  
Sbjct: 182 GNKVVPAVCQVETHPLLPQNKLLDFCTKHDILLEAYSPLGSQGSPLIDEPVIKEIAKKYN 241

Query: 245 VSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKRIIDP 304
              AQ++ISW+++RGY+VLPKSV   RI++NL T  L  EDFE +N +   +G KR+ DP
Sbjct: 242 ADPAQIIISWDIKRGYVVLPKSVTPSRIKSNLQTLDLEDEDFEKINKLHVEKGEKRVNDP 301

Query: 305 DWEPF 309
           +W  F
Sbjct: 302 EWFTF 306

>KLTH0E15532g Chr5 complement(1380466..1381395) [930 bp, 309 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 309

 Score =  379 bits (974), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 176/304 (57%), Positives = 231/304 (75%), Gaps = 2/304 (0%)

Query: 6   SKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVGR 65
           + ++++ KL TGATI  +G GTWRS    D Y++V+ AL+ GYRHIDTAA+YGNEA VGR
Sbjct: 5   TNSSAVGKLRTGATIPLLGFGTWRSTEE-DGYNAVLTALKVGYRHIDTAAVYGNEAAVGR 63

Query: 66  AIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRGENMPE 125
           AIR+SGVPR ++FVTTKLW TQH++P LALDQSL+RLGLDYVDLYL+HWP+ +R + + +
Sbjct: 64  AIRDSGVPRDQLFVTTKLWNTQHRDPRLALDQSLQRLGLDYVDLYLIHWPLPLRTQRITD 123

Query: 126 GDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDLLASPG 185
           G+    PT  +GK D+D   W++VKTWE+MQ LP+T KTRA+GVSNFS+  L++LLA+ G
Sbjct: 124 GNLFTVPTKEDGKPDVD-EQWSYVKTWEMMQDLPDTSKTRAVGVSNFSVTQLQNLLAASG 182

Query: 186 NKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIAKKNGV 245
            K++PA NQVE HPLLPQ +L  FC    I++EAYSPLGS  +P+++EP + EIA K+  
Sbjct: 183 TKVIPAVNQVETHPLLPQDKLYKFCSENNILLEAYSPLGSQGSPLVEEPAVKEIASKHNA 242

Query: 246 SAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKRIIDPD 305
             AQV+ISW ++RGY++LPKSV   RIE+N     LT +DF  +NNI K +G KRI DPD
Sbjct: 243 DPAQVLISWGIKRGYVILPKSVTPSRIESNFKIVDLTDDDFAKINNIHKEKGEKRINDPD 302

Query: 306 WEPF 309
           W  F
Sbjct: 303 WFHF 306

>TPHA0E01760 Chr5 complement(354862..355794) [933 bp, 310 aa] {ON}
           Anc_5.434 YOR120W
          Length = 310

 Score =  377 bits (969), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 187/311 (60%), Positives = 233/311 (74%), Gaps = 3/311 (0%)

Query: 4   TLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEV 63
           TLS +T+ + LN G  +  +GLGTW+S    DAY +V+AAL+AGYRHIDTAAIYGNE EV
Sbjct: 2   TLSNSTAKVTLNDGNQLPYVGLGTWQSKE-NDAYKAVVAALKAGYRHIDTAAIYGNEEEV 60

Query: 64  GRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMR-GEN 122
           GRAI++SGV R EIFVTTKLW TQH+ P+ AL+QSL+RLGLDYVDLYLMHWPV +   + 
Sbjct: 61  GRAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQC 120

Query: 123 MPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDLLA 182
             + + +  P   +G RD+D+  W+F+KTWELMQ LP++ K ++IGVSNFSINN+KDLLA
Sbjct: 121 KKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNIKDLLA 179

Query: 183 SPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIAKK 242
           SPGNK VP  NQVE+HPLLPQ ELV+FC  K IV+EAYSPLGS  APIL+   I E++KK
Sbjct: 180 SPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKK 239

Query: 243 NGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKRII 302
             +  A VV SW +QR  +VLPKSV + RI +NL T  L +E+F  +NNIS   G KR +
Sbjct: 240 LAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSV 299

Query: 303 DPDWEPFKPFV 313
            P+W PF PFV
Sbjct: 300 KPNWTPFIPFV 310

>TPHA0G00210 Chr7 (31978..32913) [936 bp, 311 aa] {ON} 
          Length = 311

 Score =  375 bits (962), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 177/312 (56%), Positives = 230/312 (73%), Gaps = 2/312 (0%)

Query: 1   MSATLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNE 60
           MS T         +     I A+ LGTW+ AA  + Y +V+ AL+AGYRHID AAIY NE
Sbjct: 1   MSVTAKNCDITYAIGKDTKIPAVALGTWK-AAPNEVYTAVLEALKAGYRHIDGAAIYCNE 59

Query: 61  AEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRG 120
            EVG+AIR+SG+PR +IFVTTKLW T+ + P  ALD SLKRLGLDYVDLYLMHWPV ++ 
Sbjct: 60  EEVGKAIRDSGIPRKDIFVTTKLWGTEQRNPLRALDSSLKRLGLDYVDLYLMHWPVALKA 119

Query: 121 ENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDL 180
           +++ + D +  P LP+GK DIDI +WNF+KTWELMQ+LP T K +AIGVSNFSINNL +L
Sbjct: 120 DSITDNDLLTIPKLPSGKTDIDIENWNFIKTWELMQELP-TSKAKAIGVSNFSINNLNEL 178

Query: 181 LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIA 240
           LA+P  K +PAANQ E+HPLLPQ EL+ +C  K I++EAY PLG ++ P++  PVI EIA
Sbjct: 179 LAAPTTKTIPAANQFEIHPLLPQNELIKYCQDKKIIVEAYCPLGGSNVPLVTNPVITEIA 238

Query: 241 KKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKR 300
            K GV+A Q++ISW +QRGY+VLPKSV KERI  N  T T+ +E+FE +NN++K  G +R
Sbjct: 239 TKLGVNAGQLLISWGIQRGYVVLPKSVRKERIVTNFQTITIPAEEFEKMNNLTKEFGVQR 298

Query: 301 IIDPDWEPFKPF 312
            ++ D+ PF  +
Sbjct: 299 SVNIDFSPFPTY 310

>TDEL0D00230 Chr4 (37458..38396) [939 bp, 312 aa] {ON}  possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 312

 Score =  373 bits (958), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 180/313 (57%), Positives = 231/313 (73%), Gaps = 3/313 (0%)

Query: 1   MSATLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNE 60
           M+ T +K  S  KLNTGA + AIGLGTW+S+   DAY +V++AL+AGY+HIDTAAIY NE
Sbjct: 1   MTVTSTKTPSF-KLNTGALLPAIGLGTWKSSEE-DAYTAVLSALKAGYKHIDTAAIYRNE 58

Query: 61  AEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRG 120
             VG+AIR+SG+PR E+F+TTKLW TQH++P+ ALD SL+RLGLDYVDLYL+H+PV  + 
Sbjct: 59  RAVGKAIRDSGIPRDELFITTKLWSTQHRDPKAALDGSLERLGLDYVDLYLIHYPVAFKT 118

Query: 121 ENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDL 180
           + + +G+   FP LPNGKRD+DI DW+FVKTW L+Q LPE+GK +A+GVSNFSINNLK L
Sbjct: 119 DRIEDGNPFCFPLLPNGKRDVDIVDWDFVKTWRLVQHLPESGKCKAVGVSNFSINNLKTL 178

Query: 181 LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIA 240
           L S     VPA NQVE+HP LPQ EL+DFC  K IV+EAYSPLGS  + +L +  + +IA
Sbjct: 179 LESDEKFAVPAVNQVEIHPQLPQTELIDFCKSKDIVVEAYSPLGSTGSQMLTDDTLQKIA 238

Query: 241 KK-NGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTK 299
           +K      AQ++I+W + RGY VLPKSV  +RIEAN     +  ED   V N+  + G K
Sbjct: 239 EKXXDAQPAQILINWGISRGYCVLPKSVTPKRIEANARIIDIKKEDLLKVTNLIDILGPK 298

Query: 300 RIIDPDWEPFKPF 312
           R ++PDW PF  F
Sbjct: 299 RYLEPDWSPFPIF 311

>KLTH0E00220g Chr5 complement(12415..13335) [921 bp, 306 aa] {ON}
           similar to uniprot|P14065 Saccharomyces cerevisiae
           YOR120W GCY1 Putative NADP( ) coupled glycerol
           dehydrogenase proposed to be involved in an alternative
           pathway for glycerol catabolism
          Length = 306

 Score =  365 bits (938), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 167/298 (56%), Positives = 231/298 (77%), Gaps = 1/298 (0%)

Query: 12  LKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVGRAIRESG 71
           L++NTG  I  +GLGTW+ AA  D Y +V+AAL +GYRHIDTAAIY NEA VGRAIR+SG
Sbjct: 6   LQMNTGKPIPVLGLGTWK-AADGDTYRAVLAALESGYRHIDTAAIYRNEAAVGRAIRDSG 64

Query: 72  VPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRGENMPEGDKIGF 131
           VPR +IFVTTKLWCTQ ++P+ AL+ SL+RLGLDYVDLYLMH+PV ++ + + +G+ +  
Sbjct: 65  VPREKIFVTTKLWCTQQRDPQSALNASLERLGLDYVDLYLMHFPVALKTDLIKDGNVLSI 124

Query: 132 PTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDLLASPGNKIVPA 191
           P   +G RD+DI  W+FVKTW+LMQ LP++GKT+AIGVSNFSI N++++L       VPA
Sbjct: 125 PVRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVSNFSIKNIEEILKPELGLSVPA 184

Query: 192 ANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIAKKNGVSAAQVV 251
           ANQ+E+HP LPQ EL+++C  KGI++EAYSPLGS+++ +L +P +I++A+K+ V  AQ++
Sbjct: 185 ANQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESSMLTDPDLIKLAEKHQVEPAQIL 244

Query: 252 ISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKRIIDPDWEPF 309
           ISW V RGY +LPKSVN +R+++NL    L+S D + ++ I +  G+KR + P W PF
Sbjct: 245 ISWGVTRGYCILPKSVNSKRVQSNLKIVKLSSNDVQQISKILEKLGSKRYVSPSWAPF 302

>KLTH0A00528g Chr1 complement(46253..47173) [921 bp, 306 aa] {ON}
           similar to uniprot|P14065 Saccharomyces cerevisiae
           YOR120W GCY1 Putative NADP( ) coupled glycerol
           dehydrogenase proposed to be involved in an alternative
           pathway for glycerol catabolism
          Length = 306

 Score =  365 bits (938), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 167/298 (56%), Positives = 231/298 (77%), Gaps = 1/298 (0%)

Query: 12  LKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVGRAIRESG 71
           L++NTG  I  +GLGTW+ AA  D Y +V+AAL +GYRHIDTAAIY NEA VGRAIR+SG
Sbjct: 6   LQMNTGKPIPVLGLGTWK-AADGDTYRAVLAALESGYRHIDTAAIYRNEAAVGRAIRDSG 64

Query: 72  VPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRGENMPEGDKIGF 131
           VPR +IFVTTKLWCTQ ++P+ AL+ SL+RLGLDYVDLYLMH+PV ++ + + +G+ +  
Sbjct: 65  VPREKIFVTTKLWCTQQRDPQSALNASLERLGLDYVDLYLMHFPVALKTDLIKDGNVLSI 124

Query: 132 PTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDLLASPGNKIVPA 191
           P   +G RD+DI  W+FVKTW+LMQ LP++GKT+AIGVSNFSI N++++L       VPA
Sbjct: 125 PVRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVSNFSIKNIEEILKPELGLSVPA 184

Query: 192 ANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIAKKNGVSAAQVV 251
           ANQ+E+HP LPQ EL+++C  KGI++EAYSPLGS+++ +L +P +I++A+K+ V  AQ++
Sbjct: 185 ANQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESSMLTDPDLIKLAEKHQVEPAQIL 244

Query: 252 ISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKRIIDPDWEPF 309
           ISW V RGY +LPKSVN +R+++NL    L+S D + ++ I +  G+KR + P W PF
Sbjct: 245 ISWGVTRGYCILPKSVNSKRVQSNLKIVKLSSNDVQQISKILEKLGSKRYVSPSWAPF 302

>KLTH0F16060g Chr6 complement(1304479..1305408) [930 bp, 309 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 309

 Score =  365 bits (938), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 175/310 (56%), Positives = 228/310 (73%), Gaps = 2/310 (0%)

Query: 1   MSATLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNE 60
           M+  L K T+  KLNTGA I  +GLGTWRS    + Y++ +AA++AGYRHID AA+  NE
Sbjct: 1   MTTVLKKCTATAKLNTGAQIPLLGLGTWRSTKE-NGYNATLAAIKAGYRHIDIAAVCMNE 59

Query: 61  AEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRG 120
             VGRAIR+SGVPR E+FVTTKLWCTQH++P+ AL QSLKRLGLDYVDLY+MHWPV  R 
Sbjct: 60  QVVGRAIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRS 119

Query: 121 ENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDL 180
           E +   + +  P   +G+ D+D   W++VKTWELMQ+LP TGKT A+GV+NFS++ LK L
Sbjct: 120 EQVKHTNYMLIPKRKDGQPDVD-EGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKL 178

Query: 181 LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIA 240
           + SPGNKIVPAA+Q+E HP LPQ +++ FC    I++EAYSPLGS  AP+L EPV+ EI+
Sbjct: 179 IDSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREIS 238

Query: 241 KKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKR 300
           KK  V  AQ+++SW +QRG+ VL KS    RIEANL TF +   D   +N +++ +GTKR
Sbjct: 239 KKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKR 298

Query: 301 IIDPDWEPFK 310
           I +P W  F+
Sbjct: 299 IHNPTWFSFE 308

>KLTH0A03476g Chr1 complement(298735..299661) [927 bp, 308 aa] {ON}
           similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 308

 Score =  361 bits (927), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 173/303 (57%), Positives = 226/303 (74%), Gaps = 3/303 (0%)

Query: 8   NTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVGRAI 67
           +TS+ KLNTGA+I  +GLGT+ S   T  Y +V+ A++ GYRHID AA+Y NE  VGRAI
Sbjct: 7   STSVGKLNTGASIPLVGLGTYLSEDET-GYKAVLHAIKVGYRHIDCAALYKNEDFVGRAI 65

Query: 68  RESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRGENMPEGD 127
           R+SGVPR E+FVTTK+W TQH+EP  AL++SL RLGLDYVDL+LMHWP  +R E + +G+
Sbjct: 66  RDSGVPREELFVTTKVWNTQHREPAKALEESLSRLGLDYVDLFLMHWPQALRTERITDGN 125

Query: 128 KIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDLLASPGNK 187
            I  P   + K D+D T+WN++KTW LMQ LP +GKT+A+GVSNFS+  L+ LLA PG+K
Sbjct: 126 MITVPKREDEKPDVD-TEWNYIKTWHLMQDLPASGKTKAVGVSNFSVKQLEKLLADPGSK 184

Query: 188 IVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIAKKNGVSA 247
           +VPA NQVE+HPLLPQ  L DFC  K I++ AYSPLGS  AP+L +PVI+EIA K+    
Sbjct: 185 VVPACNQVEVHPLLPQIPLYDFCKKKNIMLAAYSPLGSQKAPLLDDPVILEIAAKHKADP 244

Query: 248 AQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKRIIDPDWE 307
           AQ++I W+V+RGY+ LPKSV   RIE+NL    LT  + E +N I K +G KR++DP+W 
Sbjct: 245 AQIIIGWDVKRGYVALPKSVTPSRIESNLQIVNLTDSELEKINEIHK-KGEKRVVDPEWF 303

Query: 308 PFK 310
            F+
Sbjct: 304 DFE 306

>KLLA0D10109g Chr4 (854495..855424) [930 bp, 309 aa] {ON} similar to
           uniprot|P14065 Saccharomyces cerevisiae YOR120W GCY1
           Putative NADP( ) coupled glycerol dehydrogenase proposed
           to be involved in an alternative pathway for glycerol
           catabolism
          Length = 309

 Score =  354 bits (909), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 173/301 (57%), Positives = 220/301 (73%), Gaps = 3/301 (0%)

Query: 12  LKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVGRAIRESG 71
           LKLNTGA+I  +G GTW S+ A DAY +VI AL+ GYRHID AA+YGNEA VG+ IR+SG
Sbjct: 11  LKLNTGASIPQLGFGTWPSSHA-DAYTAVITALKTGYRHIDAAAMYGNEAAVGKGIRDSG 69

Query: 72  VPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRGENMPEGDKIGF 131
           +PR EIFVTTKLW TQ ++P  ALD+SL+RLGLDYVDL+L+HWPV ++    PE + + +
Sbjct: 70  IPREEIFVTTKLWNTQQRDPASALDESLERLGLDYVDLFLIHWPVPLKPVGGPE-NLLKY 128

Query: 132 PTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDLLASPGNKIVPA 191
           PT P  K  ID  DW+F+KTWELMQ LP+TGKTRA+GVSNFSI NL+DLL S  + +VPA
Sbjct: 129 PT-PGIKPQIDTEDWSFIKTWELMQTLPKTGKTRAVGVSNFSIKNLEDLLNSSPDVLVPA 187

Query: 192 ANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIAKKNGVSAAQVV 251
            NQ E+HP LPQ EL+++C  KGIV+EAY PLGS+ + +L +P I EIA K  V  A V+
Sbjct: 188 VNQFEIHPQLPQTELINYCKSKGIVVEAYCPLGSSSSAMLSDPTIAEIADKYHVKPANVL 247

Query: 252 ISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKRIIDPDWEPFKP 311
           I+W + RGY VLPKS    RI +N     L+ ED E +  +S+  G KR + PD+EP+  
Sbjct: 248 INWGISRGYCVLPKSFTPARIASNKTPVHLSREDTERITKLSETLGVKRYVHPDFEPYPL 307

Query: 312 F 312
           F
Sbjct: 308 F 308

>TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}
          Length = 311

 Score =  348 bits (892), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 166/312 (53%), Positives = 230/312 (73%), Gaps = 2/312 (0%)

Query: 1   MSATLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNE 60
           M+ TL   T  + LN G  I  IGLGT+ S    + Y++V+ A +AGYRH+DTAA Y NE
Sbjct: 1   MAVTLKNCTETITLNNGTKIPVIGLGTYLSKQ-NEVYEAVVTAAKAGYRHVDTAAFYKNE 59

Query: 61  AEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRG 120
            +VG+A+++ GVPR E++VTTK+W T+ ++PE ALD+SLKRLGL+Y+DLYLMHWPV ++ 
Sbjct: 60  EQVGKAVKDCGVPRSEMYVTTKVWPTELRDPEAALDKSLKRLGLEYIDLYLMHWPVTLKT 119

Query: 121 ENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDL 180
           + + +G+ +  P LP+G  D+D  DW FV+ WE MQKL ++GK ++IGVSNFSINN+K+L
Sbjct: 120 DTIKDGELMCIPRLPDGNADVD-KDWTFVQAWEAMQKLLKSGKVKSIGVSNFSINNIKEL 178

Query: 181 LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIA 240
           LA+P   +VP  NQVE+ PLLP  EL++FC  K I+ +AY P G ++AP++K+  ++EIA
Sbjct: 179 LAAPTTTVVPVVNQVEVQPLLPNDELIEFCRSKDIITQAYCPFGGSEAPLIKDATVVEIA 238

Query: 241 KKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKR 300
           K NGV A QV+ SW+VQRGY+VLPKSV + RI +NL TFTL+  D   +NNISK QG KR
Sbjct: 239 KGNGVDAGQVITSWHVQRGYVVLPKSVKESRIISNLKTFTLSDADMTKMNNISKTQGEKR 298

Query: 301 IIDPDWEPFKPF 312
           + + ++ PF  F
Sbjct: 299 LNNVNFSPFPIF 310

>Kwal_55.21426 s55 complement(832981..833907) [927 bp, 308 aa] {ON}
           YOR120W (GCY1) - Similar to mammalian aldo/keto
           reductases [contig 130] FULL
          Length = 308

 Score =  343 bits (880), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 170/310 (54%), Positives = 222/310 (71%), Gaps = 3/310 (0%)

Query: 1   MSATLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNE 60
           M+  L K T+   LNTGA I  +GLGTWR       Y +++AAL+AGYRHID+AA+  NE
Sbjct: 1   MTGILKKCTATATLNTGAKIPLLGLGTWR-LTKEGGYKAILAALKAGYRHIDSAAVCMNE 59

Query: 61  AEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRG 120
             +G+AIR+SGV R E+FVTTKLW TQH++P  ALDQSLKRLGL+YVDLY+MHWP+  R 
Sbjct: 60  QVIGKAIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRV 119

Query: 121 ENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDL 180
           + +   + +  P    GK  +D TDW++VKTWELMQKLP T KTRAIGV+NFS+  L  L
Sbjct: 120 DQIKAKNFMLIPRNSEGKPYVD-TDWDYVKTWELMQKLP-TEKTRAIGVANFSVPQLTSL 177

Query: 181 LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIA 240
           L SP NKI+PAA+Q+E HP LP  E++ FC  KGI++EAYSPLG    P++ EPVI EI+
Sbjct: 178 LKSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREIS 237

Query: 241 KKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKR 300
           KK  V  AQ++ISW ++RG  VLPKS  + RIE+NL  F L+ ED+E ++ I++ +G KR
Sbjct: 238 KKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKR 297

Query: 301 IIDPDWEPFK 310
             +P W  F+
Sbjct: 298 THNPPWFSFE 307

>AER401W Chr5 (1406905..1407846) [942 bp, 313 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR368W (YPR1) and
           YOR120W (GCY1)
          Length = 313

 Score =  318 bits (816), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 161/310 (51%), Positives = 216/310 (69%), Gaps = 2/310 (0%)

Query: 3   ATLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAE 62
           ATL  +T  + LNTGA I   GLGTW+S     +  +V AAL+ GY+HIDTA+ Y NE  
Sbjct: 5   ATLKASTDTVTLNTGAKIPLFGLGTWQSTDDDASS-AVAAALKHGYKHIDTASFYKNEEL 63

Query: 63  VGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRGEN 122
           VG+A++ESG+PR E+F+TTK+W  Q ++P  ALD SLK+LG +YVDL LMHWPV  +   
Sbjct: 64  VGKAVKESGIPREELFITTKVWNDQQRDPAGALDLSLKKLGTEYVDLLLMHWPVPFKEPE 123

Query: 123 MPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDLLA 182
               D    P  P+GK   D  +W+FVKTW LMQKL  TGK +AIGVSNFSINNL++LL 
Sbjct: 124 NSTLDAYKVPRGPDGKVTRD-EEWDFVKTWHLMQKLLGTGKVKAIGVSNFSINNLEELLN 182

Query: 183 SPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIAKK 242
           + G  +VPA NQVE+H  LPQ ELV++C  KGIV+EAYSPLGS+ AP+LK+  + ++A+K
Sbjct: 183 AEGTTVVPAVNQVELHIRLPQLELVEYCQKKGIVVEAYSPLGSSSAPLLKDATVNKVAEK 242

Query: 243 NGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKRII 302
            GV+ A V++++   RG +VLPKSV + RI +N   F +  ED + +N+I K +G +R +
Sbjct: 243 YGVTPAHVLLNYVANRGIVVLPKSVKESRIISNFEYFKMDEEDIKLLNDIHKKEGVQRFV 302

Query: 303 DPDWEPFKPF 312
           DPD+ PF  F
Sbjct: 303 DPDFSPFPLF 312

>NDAI0A07000 Chr1 complement(1596632..1597594) [963 bp, 320 aa] {ON}
           Anc_3.108
          Length = 320

 Score =  221 bits (563), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 129/304 (42%), Positives = 182/304 (59%), Gaps = 20/304 (6%)

Query: 12  LKLNTGATIRAIGLGTWRSAAATDAY----DSVIAALRAGYRHIDTAAIYGNEAEVGRAI 67
             LN G  I AIGLGT   A+  D Y    ++V AA+RAGYRHIDTA  Y  E  +G+A+
Sbjct: 11  FNLNNGTRIPAIGLGT---ASPKDRYPETKEAVKAAIRAGYRHIDTAYFYKTEPYIGQAL 67

Query: 68  RE----SGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRGENM 123
           +E    + + R E+F+TTK+W T    P  ++DQSLK LG+DYVDL L HWPV  +    
Sbjct: 68  KELFESAEIKREELFITTKVWPTFWNNPSDSIDQSLKDLGIDYVDLVLQHWPVCFQKVEN 127

Query: 124 PEGDKIGFPTLPNGKRDIDI-TDWNFVKTWELMQKL---PETGKTRAIGVSNFSINNLKD 179
            +G+ IG P   +G    +   DW F  T++ ++K+   P+  + RAIGVSN+ I  L+ 
Sbjct: 128 SQGNIIGLPRDKDGNALFEKDADWLF--TYKALEKIYLDPKDNRVRAIGVSNYPIEYLER 185

Query: 180 LLASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEI 239
           L      K+ PA NQVE+HP LPQ EL  FCH   I++ AYSPLGS  AP LK   + ++
Sbjct: 186 LFKE--CKVTPAINQVEVHPHLPQLELNKFCHDHAILLTAYSPLGSDGAPNLKIKSVQDL 243

Query: 240 AKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTK 299
           AKK  V  A ++ S+++ +G +VLP+S+N +RI AN+    LT +D   ++ +  +    
Sbjct: 244 AKKYKVEPADILTSYHISKGNVVLPRSLNPKRIAANVSFAKLTDDDLSKLDQVG-IDEPN 302

Query: 300 RIID 303
           R ID
Sbjct: 303 RFID 306

>NCAS0I02420 Chr9 complement(454156..455118) [963 bp, 320 aa] {ON}
           Anc_3.108
          Length = 320

 Score =  212 bits (539), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 123/309 (39%), Positives = 185/309 (59%), Gaps = 15/309 (4%)

Query: 7   KNTSL-LKLNTGATIRAIGLGTWR-SAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVG 64
           +NT +   LN G  I AIGLGT        +   +V AA+RAGYR IDTA  Y  E  +G
Sbjct: 5   RNTEIYFNLNNGGRIPAIGLGTASPKGRYPETKKAVKAAIRAGYRQIDTAWYYKTEPYIG 64

Query: 65  RAI----RESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRG 120
            A+    R+  + R ++F+TTK+W     +P  ++++SLK LG+DYVD+ L HWP+  + 
Sbjct: 65  EALKELFRDGEIKREDLFITTKVWPCYWDDPSTSINESLKSLGIDYVDMVLQHWPLCYKK 124

Query: 121 ENMPEGDKIGFPTLPNGKRDI-DITDWNFVKTWELMQKL---PETGKTRAIGVSNFSINN 176
                G  IG P   +GK    +  DW  + T++LM+K+   P+  + RAIGVSN+ I  
Sbjct: 125 TYDENGTIIGKPLDKDGKVIFAEGADW--ITTYQLMEKIYLDPKDTRVRAIGVSNYPIEY 182

Query: 177 LKDLLASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVI 236
           L+ ++     K+ P  NQVE+HP LPQ EL DFCH  GI++ AYSPLGS  AP  K P++
Sbjct: 183 LERVIKE--CKVTPVINQVELHPHLPQLELNDFCHKNGILLTAYSPLGSGGAPNTKIPLV 240

Query: 237 IEIAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQ 296
            E AKK+ V+ A ++ S++V++G +V+P+S+N ER+ +N+    LT  + +++++   V 
Sbjct: 241 QEYAKKHEVAPADILTSYHVRKGNVVIPRSLNPERVASNIYFAPLTKNEMKSLDDFG-VN 299

Query: 297 GTKRIIDPD 305
              R I  D
Sbjct: 300 TPHRYIGTD 308

>KAFR0G01350 Chr7 (304389..305363) [975 bp, 324 aa] {ON} Anc_3.108
           YBR149W
          Length = 324

 Score =  207 bits (526), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 119/303 (39%), Positives = 183/303 (60%), Gaps = 15/303 (4%)

Query: 12  LKLNTGATIRAIGLGTWRSAAAT-DAYDSVIAALRAGYRHIDTAAIYGNEAEVGRAIRE- 69
            KLN G TI A+G GT+       +   +V AA++AGYRHIDTA +Y +E  VG AI+E 
Sbjct: 11  FKLNNGTTIPALGFGTYAPRERIPETKQAVKAAIKAGYRHIDTAWVYESEPYVGEAIKEM 70

Query: 70  ---SGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPV---RMRGENM 123
                V R ++FVTTK+W       E +L++SL+ LGLDYVDL L HWP+   R+  E  
Sbjct: 71  IEEGEVSRSDLFVTTKVWPVYWDNVEKSLNESLEALGLDYVDLLLQHWPLCFPRVEDEKN 130

Query: 124 PEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKL---PETGKTRAIGVSNFSINNLKDL 180
                + +P    GK  ++    +F++T+  ++K+   P+  + RAIGVSN++I  L+ L
Sbjct: 131 GVNGLVAYPEDDEGKPLLN-EKGDFLETYRQIEKIYLNPDDHRVRAIGVSNYAIEYLEAL 189

Query: 181 LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIA 240
                 K+ P  NQVE+HP LPQ EL  FCH  GI++ AYSPLGS  AP LK P++ ++A
Sbjct: 190 FKE--CKVKPVVNQVEIHPHLPQLELNKFCHNHGILLTAYSPLGSDGAPNLKIPLVHQLA 247

Query: 241 KKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKR 300
           +K  +S   ++IS+++++G  V+P+S+N  RI + +     T E+ + ++N+  ++   R
Sbjct: 248 EKYDMSLNDILISYHIRKGNTVIPRSLNPVRIASTIEFAPFTQEELKQLDNVG-IEEPAR 306

Query: 301 IID 303
            +D
Sbjct: 307 FVD 309

>KNAG0K02070 Chr11 complement(419556..420527) [972 bp, 323 aa] {ON}
           Anc_3.108 YBR149W
          Length = 323

 Score =  202 bits (514), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 119/305 (39%), Positives = 182/305 (59%), Gaps = 19/305 (6%)

Query: 12  LKLNTGATIRAIGLGTWR-SAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVGRAIRE- 69
            KLN G  + A+GLGT        +   +V AA++AGYRHIDTA  YG E  +G A++E 
Sbjct: 11  FKLNNGVNMPALGLGTASPREHMAETKQAVKAAIKAGYRHIDTAWFYGTEGYIGDALKEL 70

Query: 70  ---SGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRGENMPEG 126
                V R ++F+T+K+W     + +L+L++SLK LGLDYVDLYL HWP+  +     E 
Sbjct: 71  LENGDVKRSDLFITSKVWPVYWDDVDLSLNESLKSLGLDYVDLYLQHWPLCFQ---KIED 127

Query: 127 DKIGFPTLPNGKRDID-----ITDWNFVKTWELMQKL---PETGKTRAIGVSNFSINNLK 178
            K G   L     D D     +   +++ T++ M+K+   P+  + RAIGVSN+ +  L 
Sbjct: 128 SKDGVNGLKGKPIDKDGNALIVEGADYLSTYKQMEKIYLDPKDNRVRAIGVSNYPVEYLD 187

Query: 179 DLLASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIE 238
            LL      + PA NQVEMHP LPQ EL +FC    I + AYSPLGS+ AP+LK P++ E
Sbjct: 188 RLLKV--CTVKPAVNQVEMHPHLPQFELREFCELHDIKLTAYSPLGSSGAPLLKLPLVKE 245

Query: 239 IAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGT 298
           +++K  V+   V+IS+++++G  V+P+S+N  R+   +   TLT  + + +++I + + +
Sbjct: 246 LSEKYQVTLNDVLISYHIRKGSFVIPRSLNPVRLAGCVNFVTLTEGELDQLDDIGR-KDS 304

Query: 299 KRIID 303
            R ID
Sbjct: 305 IRYID 309

>SAKL0C10626g Chr3 (962421..963389) [969 bp, 322 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 322

 Score =  201 bits (512), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 109/299 (36%), Positives = 180/299 (60%), Gaps = 10/299 (3%)

Query: 12  LKLNTGATIRAIGLGTWRSAAAT-DAYDSVIAALRAGYRHIDTAAIYGNEAEVGRAIRE- 69
             LNTGA I ++GLGT           D+V  A++ GYR IDTA +YG+E  +G A++E 
Sbjct: 11  FNLNTGAKIPSLGLGTVNPPEKMPQTKDAVKHAVKNGYRLIDTAWMYGSEPYIGEALQEL 70

Query: 70  ---SGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRGENMPEG 126
                V R ++F+TTK+W   +   E +L +SLK+L LDYVDL L HWP+    +    G
Sbjct: 71  FEEGVVKREDLFITTKVWPCHYNTVEQSLQESLKQLKLDYVDLLLQHWPLCFVKQYDEHG 130

Query: 127 DKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPE--TGKTRAIGVSNFSINNLKDLLASP 184
                P  P     +     +++ TW+ ++K+ +  +G+ R IGVSN+ +  L+ LL   
Sbjct: 131 KLKSHPVDPKSGDIVLDEKGDYLTTWKQLEKVYKDGSGRVRNIGVSNYPVEYLERLLKE- 189

Query: 185 GNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIAKKNG 244
             ++VP  NQVE+HPLLPQ+EL ++C+  GI++E++SPLGS+  P L+ P++ E++KK  
Sbjct: 190 -TEVVPVLNQVELHPLLPQEELSEYCNSHGILMESFSPLGSSGTPHLEHPLVKELSKKYD 248

Query: 245 VSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKRIID 303
                V+++++V++G +V+P+S+N  RI  N     L+ ED + ++ + + +   R++D
Sbjct: 249 CEPGSVLLNYHVRKGNVVVPRSLNHGRIIKNADFVALSEEDLDKLSGLGR-EKPVRVMD 306

>SAKL0C09922g Chr3 (897779..898747) [969 bp, 322 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 322

 Score =  200 bits (508), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 123/304 (40%), Positives = 174/304 (57%), Gaps = 18/304 (5%)

Query: 12  LKLNTGATIRAIGLGTWRSAAATDAY----DSVIAALRAGYRHIDTAAIYGNEAEVGRAI 67
             LN G  I A+GLGT   A   D +    ++V AA++AG+R IDTA  YG E  +G A+
Sbjct: 11  FNLNNGTRIPAVGLGT---ANPKDKWPQTKEAVKAAVKAGFRQIDTAWAYGTEEYIGEAL 67

Query: 68  RE----SGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRGENM 123
           +E      V R ++F+TTK+W     + E +L++SLKRL LDYVDL L HWP     +  
Sbjct: 68  QELFAEGVVKREDLFITTKVWPNYWDQAEKSLNESLKRLQLDYVDLLLQHWPFCFVKKQD 127

Query: 124 PEGDK--IGFPTLPNGKRDIDIT-DW-NFVKTWELMQKLPETGKTRAIGVSNFSINNLKD 179
           PEG    +  P   +G    D   DW    K  E +       + RAIGVSN+ I  L+ 
Sbjct: 128 PEGSGQLVNHPQHEDGSPFYDTAGDWLETYKQIEAIYLAENDTRVRAIGVSNYPIEYLER 187

Query: 180 LLASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEI 239
           L      K VPA NQVE+HP LPQ+EL D+C+  GI++ +YSPLGS  AP L+ P++ E+
Sbjct: 188 LFKE--CKTVPAINQVELHPRLPQRELCDYCNKHGILMTSYSPLGSNGAPNLRIPLVQEL 245

Query: 240 AKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTK 299
           A K   +   V++S+++++G IV+P+S+N ERI   L    LT E+ + +N    V+   
Sbjct: 246 ASKYNANGNDVLVSYHIRQGTIVIPRSLNLERISKGLGFVPLTKEELDKLNQYG-VEHEY 304

Query: 300 RIID 303
           R ID
Sbjct: 305 RYID 308

>YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+
           dependent arabinose dehydrogenase, involved in
           carbohydrate metabolism; purified as homodimer;
           naturally occurs with a N-terminus degradation product
          Length = 344

 Score =  198 bits (503), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 120/308 (38%), Positives = 184/308 (59%), Gaps = 17/308 (5%)

Query: 12  LKLNTGATIRAIGLGTWR-SAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVGRAIRE- 69
             LN G  I A+GLGT        +   +V AA++AGYRHIDTA  Y  E  VG AI+E 
Sbjct: 25  FSLNNGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKEL 84

Query: 70  ---SGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRGENMPEG 126
                + R ++F+TTK+W     E + +L++SLK LGL+YVDL L HWP+       P+G
Sbjct: 85  LEDGSIKREDLFITTKVWPVLWDEVDRSLNESLKALGLEYVDLLLQHWPLCFEKIKDPKG 144

Query: 127 DK--IGFPTLPNGKRDIDITDWNFVKTWELMQKL---PETGKTRAIGVSNFSINNLKDLL 181
               +  P   +GK  +   D ++++T++ ++K+   P   + RAIGVSNFSI  L+ L+
Sbjct: 145 ISGLVKTPVDDSGKT-MYAADGDYLETYKQLEKIYLDPNDHRVRAIGVSNFSIEYLERLI 203

Query: 182 ASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIAK 241
                ++ P  NQVE HP LPQ EL  FC    I++ AYSPLGS  AP LK P++ ++A+
Sbjct: 204 KE--CRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSHGAPNLKIPLVKKLAE 261

Query: 242 KNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKRI 301
           K  V+   ++IS+++++G IV+P+S+N  RI +++   +LT ++ + +N+  + +   R 
Sbjct: 262 KYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSSIEFASLTKDELQELNDFGE-KYPVRF 320

Query: 302 IDPDWEPF 309
           ID   EPF
Sbjct: 321 ID---EPF 325

>Smik_2.288 Chr2 (524564..525598) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  197 bits (500), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 115/293 (39%), Positives = 175/293 (59%), Gaps = 13/293 (4%)

Query: 12  LKLNTGATIRAIGLGTWR-SAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVGRAIRE- 69
             LN G  I A+GLGT        +   +V AA++AGYRHIDTA  Y  E  VG AI+E 
Sbjct: 25  FSLNNGVRIPALGLGTANPQEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKEL 84

Query: 70  ---SGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRGENMPEG 126
                + R ++F+TTK+W     E + +L++SLK LGLDYVDL L HWP+       PEG
Sbjct: 85  LEEGTIQREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLLLQHWPICFGKVKDPEG 144

Query: 127 DKIGFPTLP--NGKRDIDITDWNFVKTWELMQKL---PETGKTRAIGVSNFSINNLKDLL 181
              G+  LP  +  + +  ++ ++++T++ ++K+       + RAIGVSNFSI  L+ L+
Sbjct: 145 IS-GYMKLPVDDSGKTVYASNGDWLETYKQLEKIYLDSNDHRVRAIGVSNFSIEYLERLI 203

Query: 182 ASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIAK 241
                K+ P  NQVE HP LPQ EL  FC    I++ AYSPLGS  AP LK P++ ++ +
Sbjct: 204 KE--CKVKPTVNQVESHPHLPQVELRKFCFMHDILLTAYSPLGSQGAPNLKIPLVKKLCE 261

Query: 242 KNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISK 294
           K  V+   ++IS+++++G IV+P+S+N  RI +N+    LT ++ + +N   +
Sbjct: 262 KYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSNIEFVCLTKDELQELNEFGE 314

>KLTH0C10010g Chr3 (829145..830110) [966 bp, 321 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 321

 Score =  196 bits (498), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 123/313 (39%), Positives = 185/313 (59%), Gaps = 17/313 (5%)

Query: 7   KNTSL-LKLNTGATIRAIGLGTWRSAAAT-DAYDSVIAALRAGYRHIDTAAIYGNEAEVG 64
           KNT +   LN G  + AIGLGT            +V AA+++GYRHIDTA  Y  E  VG
Sbjct: 5   KNTEVYFTLNNGVRMPAIGLGTANVVEQIPQTKQAVKAAIKSGYRHIDTAWAYQCEDRVG 64

Query: 65  RAIRE----SGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRG 120
            A++E      V R +IFVTTK+W T     + ++ +SL+ LGLD+VDL L HWP+    
Sbjct: 65  EALKELFEEGVVKREDIFVTTKVWPTNWDRVDESISRSLENLGLDHVDLVLQHWPLCFNR 124

Query: 121 ENMPEG-DKIGF-PTLPNGKRDIDITDWNFVKTWELMQKL--PETGKTRAIGVSNFSINN 176
              P+G D +   P   +G    +    ++++T++ ++KL   +  + RAIGVSN+ +  
Sbjct: 125 LEDPDGIDGVRRNPYHEDGSPHYN-EKGDYLETFKTLEKLYLAKDPRFRAIGVSNYPVEY 183

Query: 177 LKDLLASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVI 236
           L+ LL     ++VPA NQVE HP LPQ EL DFC    I +EAYSPLG+ +AP++   ++
Sbjct: 184 LERLLKE--CQVVPAINQVECHPHLPQMELRDFCTKHNIRLEAYSPLGATNAPLIDNELV 241

Query: 237 IEIAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQ 296
            +IA K   S   V+I++++++G + +P+SVN + I +N+    L+ ED + +N    V+
Sbjct: 242 KKIAGKYACSTQNVLIAYHMRQGVVSVPRSVNPKHIASNVQFVALSKEDIDTLNKFG-VE 300

Query: 297 GTKRIIDPDWEPF 309
            TKRI+D   EPF
Sbjct: 301 NTKRIVD---EPF 310

>Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  196 bits (498), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 118/306 (38%), Positives = 183/306 (59%), Gaps = 17/306 (5%)

Query: 14  LNTGATIRAIGLGTWR-SAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVGRAIRE--- 69
           LN G  + A+GLGT        +   +V AA++AGYRHIDTA  Y  E  VG AI+E   
Sbjct: 27  LNNGVRVPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKELLE 86

Query: 70  -SGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRGENMPEGDK 128
              + R ++F+TTK+W     E E +L +SLK +GLDYVDL+L HWP+       P+G  
Sbjct: 87  EGSIKREDLFITTKVWPVLWDEVERSLSESLKAMGLDYVDLFLQHWPLCFEKVKDPKGIS 146

Query: 129 --IGFPTLPNGKRDIDITDWNFVKTWELMQKL---PETGKTRAIGVSNFSINNLKDLLAS 183
             +  P   +G+  +  ++ ++++T++ ++K+   P   + RAIGVSNFSI  L+ L+  
Sbjct: 147 GLVKTPVHKSGEAML-ASNGDWMETYKQLEKIYLDPNDHRVRAIGVSNFSIEYLERLVKE 205

Query: 184 PGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIAKKN 243
              ++ P  NQVE HP LPQ EL  FC    I++ AYSPLGS  AP LK P++ ++ +K 
Sbjct: 206 --CRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSNGAPNLKIPLVKKLVEKY 263

Query: 244 GVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKRIID 303
            V+   V+IS+++++G IV+P+S+N  RI +++    LT ++ + +N+  + +   R ID
Sbjct: 264 NVTGNDVLISYHIRQGTIVIPRSLNPVRISSSIEFACLTKDELQELNDFGE-KYPVRFID 322

Query: 304 PDWEPF 309
              EPF
Sbjct: 323 ---EPF 325

>Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  194 bits (493), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 120/308 (38%), Positives = 181/308 (58%), Gaps = 17/308 (5%)

Query: 12  LKLNTGATIRAIGLGTWR-SAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVGRAIRE- 69
             LN G  I A+GLGT        +   +V AA++AGYRHIDTA  Y  E  VG AI+E 
Sbjct: 25  FSLNNGVRIPALGLGTANPQEKLAETKQAVKAAIKAGYRHIDTAWAYRTEPFVGEAIKEL 84

Query: 70  ---SGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRGENMPEG 126
                + R ++F+TTK+W     E + +L++SLK LGLDYVDL L HWP+       P+G
Sbjct: 85  LEEGTIQREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLLLQHWPLCFEKVKDPKG 144

Query: 127 DK--IGFPTLPNGKRDIDITDWNFVKTWELMQKL---PETGKTRAIGVSNFSINNLKDLL 181
               +  P   +GK  +  ++ ++++T++ ++K+       + RAIGVSNFSI  L+ L+
Sbjct: 145 ISGLVKTPVDDSGKT-VYASNGDWLETYKQLEKIYLDSNDHRVRAIGVSNFSIEYLERLI 203

Query: 182 ASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIAK 241
                K+ P  NQVE HP LPQ EL  FC    I++ AYSPLGS  AP LK P++ ++ +
Sbjct: 204 KE--CKVKPTVNQVESHPHLPQVELRKFCFMHDILLTAYSPLGSQGAPNLKIPLVKKLCE 261

Query: 242 KNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKRI 301
           K  V+   ++IS+++++G IV+P+S+N  RI +N+    LT ++ + +N   + +   R 
Sbjct: 262 KYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSNIEFVCLTKDELQELNEFGE-KYPVRF 320

Query: 302 IDPDWEPF 309
           ID   EPF
Sbjct: 321 ID---EPF 325

>Skud_2.276 Chr2 (507436..508470) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  193 bits (491), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 117/308 (37%), Positives = 183/308 (59%), Gaps = 17/308 (5%)

Query: 12  LKLNTGATIRAIGLGTWR-SAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVGRAIRE- 69
             LN G  I A+GLGT        +   +V AA++AGYRHIDTA  Y  E  VG AI+E 
Sbjct: 25  FSLNNGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKEL 84

Query: 70  ---SGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRGENMPEG 126
                + R ++F+TTK+W     E + +L++SLK LGLDYVDL+L HWP+       P+G
Sbjct: 85  LEDGSIKREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLFLQHWPLCFEKVKDPKG 144

Query: 127 DK--IGFPTLPNGKRDIDITDWNFVKTWELMQKL---PETGKTRAIGVSNFSINNLKDLL 181
               +  P   +GK  +  ++ ++++T++ ++K+   P   + RAIGVSNFSI  L+ L+
Sbjct: 145 LSGLVKTPVDDSGKT-MYASNGDWLETYKQLEKIYLDPNDHRIRAIGVSNFSIEYLERLI 203

Query: 182 ASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIAK 241
                ++ P  NQVE HP LPQ  +  FC    I++ AYSPLGS  AP LK P++ ++ +
Sbjct: 204 KE--CRVKPTVNQVETHPHLPQMAMRKFCFMHDILLTAYSPLGSNGAPNLKIPLVKKLTE 261

Query: 242 KNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKRI 301
           K  ++   V+IS+++++G IV+P+S+N  RI +++    LT ++ + +N+  + +   R 
Sbjct: 262 KYNLTGNDVLISYHIRQGTIVIPRSLNPVRISSSIEFSCLTKDELQELNDFGE-KYPVRF 320

Query: 302 IDPDWEPF 309
           ID   EPF
Sbjct: 321 ID---EPF 325

>Kwal_56.22611 s56 complement(202750..203715) [966 bp, 321 aa] {ON}
           YBR149W (ARA1) - D-arabinose dehydrogenase [contig 184]
           FULL
          Length = 321

 Score =  192 bits (489), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 114/310 (36%), Positives = 185/310 (59%), Gaps = 14/310 (4%)

Query: 7   KNTSL-LKLNTGATIRAIGLGTWRSAAAT-DAYDSVIAALRAGYRHIDTAAIYGNEAEVG 64
           KNT +   LN G  + A+GLGT            +V AA+++GYRHIDTA  Y  E  +G
Sbjct: 5   KNTEIYFTLNNGVKMPALGLGTANVIEQIPQTKQAVKAAIKSGYRHIDTAWAYRCEDRIG 64

Query: 65  RAIRE----SGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRG 120
            A++E      + R +IF+TTK+W T     + ++ +SL+ LG+DYVDL L HWP+    
Sbjct: 65  EALKELFEEGVIKREDIFITTKVWPTNWDRADESISRSLENLGVDYVDLVLQHWPLCFNR 124

Query: 121 ENMPEG-DKIGF-PTLPNGKRDIDITDWNFVKTWELMQK--LPETGKTRAIGVSNFSINN 176
              PEG D I   PT  +G    +    ++++T++ ++K  L +  + R+IGVSN+ +  
Sbjct: 125 LQDPEGIDGICRNPTHEDGSPHYN-EKGDYLQTFKSLEKMYLSKDPRFRSIGVSNYPVEY 183

Query: 177 LKDLLASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVI 236
           L+ LL     K+VPA NQVEMHP LPQ EL DFC    I +EA+SP G+  +P++K  ++
Sbjct: 184 LERLLKE--CKVVPAVNQVEMHPHLPQMELRDFCTKHNIRLEAFSPFGATGSPMVKNELV 241

Query: 237 IEIAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQ 296
            ++A+K   +   V+I++++++G + +P+SVN + I +N+    L+ ED + +N    V+
Sbjct: 242 QKVAQKYSCTPNDVLIAYHLRQGVVTVPRSVNPKNIASNVQFVPLSKEDIDELNKFG-VE 300

Query: 297 GTKRIIDPDW 306
             KR++D ++
Sbjct: 301 NPKRLVDEEF 310

>TDEL0D05160 Chr4 complement(935981..936958) [978 bp, 325 aa] {ON}
           Anc_3.108 YBR149W
          Length = 325

 Score =  192 bits (487), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 116/304 (38%), Positives = 179/304 (58%), Gaps = 16/304 (5%)

Query: 14  LNTGATIRAIGLGTWRSAAA-TDAYDSVIAALRAGYRHIDTAAIYGNEAEVGRAIRE--- 69
           LN G  + AIGLGT        +   +V AA++AGYR+IDTA  YG+E  VG AI+E   
Sbjct: 13  LNNGVRMPAIGLGTANPPEKLAETKQAVKAAVKAGYRNIDTAWAYGSEPFVGEAIKELIE 72

Query: 70  -SGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRGENMPEGDK 128
              + R ++F+T+K+W     + E +L +SLK LG+DY+DL+L HWP+       P G  
Sbjct: 73  EGAIKREDLFITSKVWPVLWDDAERSLQESLKSLGVDYIDLWLQHWPLCYNRREDPHGIN 132

Query: 129 --IGFPTLPNGKRDI-DITDWNFVKTWELMQKL---PETGKTRAIGVSNFSINNLKDLLA 182
                P   +G  D  +  DW  + T++ M+++   P+  + RAIGVSNF +  LK +L 
Sbjct: 133 GLARNPEKADGSPDFNEKADW--LDTYKQMERIYSNPKDNRVRAIGVSNFPVEYLKRVLK 190

Query: 183 SPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIAKK 242
                + P  NQVEMHP LPQ EL +FCH   I + AYSPLGS  AP++K P+I E+++K
Sbjct: 191 E--CPVKPVLNQVEMHPRLPQFELNEFCHDNDIKLTAYSPLGSHGAPMVKHPLIKEMSQK 248

Query: 243 NGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKRII 302
              S   ++ S+++++G  V+P+S+N  RI +N+    L+ +D + + ++ + +  KR I
Sbjct: 249 YKASENDILTSFHIRQGNTVVPRSINSVRIASNIEFVPLSKDDLDKLKDLGRTE-PKRFI 307

Query: 303 DPDW 306
           +  W
Sbjct: 308 NEKW 311

>KLLA0F02728g Chr6 (249240..250232) [993 bp, 330 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 330

 Score =  192 bits (487), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 112/299 (37%), Positives = 176/299 (58%), Gaps = 12/299 (4%)

Query: 14  LNTGATIRAIGLGTW-RSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVGRAIRE--- 69
            N G  + A GLGT  +     +   +V AA++AGYRHIDTA  YG E  VG A++E   
Sbjct: 13  FNNGNKVPAFGLGTAAQHERVAETKQAVKAAIKAGYRHIDTAWAYGVEEYVGEALQELFE 72

Query: 70  -SGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRGENMPEG-D 127
              V R ++ +T+K+W T   + + +L++SL RL +DYVDL+L HWP+  +    P G D
Sbjct: 73  ERVVKREDLHITSKVWHTMWNDVDKSLNESLARLKVDYVDLFLQHWPLCTQKVPDPHGVD 132

Query: 128 KIGFPTLPNGKRDIDITDWNFVKTWELMQKL---PETGKTRAIGVSNFSINNLKDLLASP 184
           KI    + +    +     ++++T++ ++K+       + RAIGVSNF I  LK +L   
Sbjct: 133 KIAKEPVDDQGNPLYDEKGDWIETYKQIEKIYLDKNDKRVRAIGVSNFPIEYLKRVLKE- 191

Query: 185 GNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIAKKNG 244
             + VPA NQVE+HP LPQ+EL +FC    I++ AYSPLG   AP+L+ P++  + +K  
Sbjct: 192 -CRTVPACNQVELHPHLPQRELCEFCSEHKILVTAYSPLGGNGAPLLELPILKGLCEKYN 250

Query: 245 VSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKRIID 303
            S   ++ S+++++G IV+P+S+N  RI +NL    L+ ED   +N   + +  KR I+
Sbjct: 251 ASPNDILTSYHLRQGTIVIPRSLNSTRIASNLEFVPLSEEDVNKLNEFGQ-KNKKRYIN 308

>ZYRO0B06138g Chr2 complement(491830..492816) [987 bp, 328 aa] {ON}
           similar to uniprot|P38115 Saccharomyces cerevisiae
           YBR149W ARA1 Large subunit of NADP dependent arabinose
           dehydrogenase involved in carbohydrate metabolism small
           subunit is unidentified
          Length = 328

 Score =  188 bits (477), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 118/314 (37%), Positives = 183/314 (58%), Gaps = 22/314 (7%)

Query: 12  LKLNTGATIRAIGLGTWRSAAATD-AYDSVIAALRAGYRHIDTAAIYGNEAEVGRAIRE- 69
             LN G  + A+GLGT            +V AA++AGYRHIDTA  YG+E  VG AI+E 
Sbjct: 14  FTLNNGVRMPALGLGTANPHPEIGRTKQAVKAAVKAGYRHIDTAWAYGSEPFVGEAIKEL 73

Query: 70  --SGVPRGE-IFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRGENMPEG 126
              GV R E IF+T+K+W     + E +L++SL+ LG+DY+DL+L HWP+      + + 
Sbjct: 74  MEEGVIRREDIFITSKVWPVLWDDVERSLNESLESLGVDYIDLWLQHWPLCY----VKQE 129

Query: 127 DKIGF------PTLPNGKRDIDITDWNFVKTWELMQKL---PETGKTRAIGVSNFSINNL 177
           D  G       P  PNG+   ++ D ++++T+  M+K+   P   + R+IGVSNF +  L
Sbjct: 130 DTHGINGLARNPETPNGEPYYEV-DGDWLETYVQMEKIYLDPSDNRVRSIGVSNFPVQYL 188

Query: 178 KDLLASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVII 237
           +  L     K  PA NQVEMHP LPQ EL  FC    I++EAYSPLGS +AP +   ++ 
Sbjct: 189 ERTLFECAVK--PAVNQVEMHPRLPQFELNKFCRAHNILLEAYSPLGSHNAPNVHLQLVQ 246

Query: 238 EIAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQG 297
           ++A+K  +S + ++ S+++++G  V+ +SVN  RI +N+    LT E+ + ++ +  +  
Sbjct: 247 DLAEKYSMSPSGILNSYHIRQGNAVVSRSVNTMRIASNVEFAALTEEELDNLDQLG-ITK 305

Query: 298 TKRIIDPDWEPFKP 311
            KR ++  W    P
Sbjct: 306 PKRFVNEKWNAVVP 319

>CAGL0I01122g Chr9 (93934..94914) [981 bp, 326 aa] {ON} highly
           similar to uniprot|P38715 Saccharomyces cerevisiae
           YHR104w GRE3 aldose reductase
          Length = 326

 Score =  182 bits (463), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 117/325 (36%), Positives = 177/325 (54%), Gaps = 36/325 (11%)

Query: 9   TSLLKLNTGATIRAIGLGTWR---SAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVGR 65
           +S++ LN G  +  +GLG W+      A   YD    A++ GYR  D A  YGNE EVG+
Sbjct: 2   SSVVTLNNGLKMPLVGLGCWKIPNDVCAQQVYD----AIKIGYRLFDGAEDYGNEKEVGQ 57

Query: 66  AIR----ESGVPRGEIFVTTKLWCTQHK--EPELALDQSLKRLGLDYVDLYLMHWPVRMR 119
            IR    E  V R ++FV +KLW + H     ++AL ++L  +GLDY+DL+ +H+P+  +
Sbjct: 58  GIRKAIDEGVVKREDVFVVSKLWNSFHHPDHVKMALKRTLSDMGLDYLDLFYIHFPIAFK 117

Query: 120 GENMPEGDKIGFPTLPNGKRDIDITDWN--FVKTWELMQKLPETGKTRAIGVSNFSINNL 177
                E    GF T    +++  IT+ +   + T+  +++  E G  ++IG+SNFS + +
Sbjct: 118 YVPFEEKYPPGFYTGKEDEKNGHITEAHVPIIDTYRALEQCVEEGLIKSIGISNFSGSLV 177

Query: 178 KDLLASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPV-- 235
           +DLL     KI P A QVE HP L Q+ LV++C   GI + AYS  G      L  P+  
Sbjct: 178 QDLLRQC--KIKPVALQVEHHPYLTQEHLVEYCKDNGIQVVAYSSFGPQSYIELNHPLAK 235

Query: 236 ----------IIEIAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLL---TFTLT 282
                     I +IA  + V+ +QV++ W  QRG  ++PKS  KER++ NL+     TLT
Sbjct: 236 NTPNLFHHDTIKQIANNHNVATSQVLLRWATQRGIAIIPKSSKKERLQDNLMIDEKLTLT 295

Query: 283 SEDFEAVNNISKVQGTKRIIDP-DW 306
            ++ EA   ISK+    R+ DP DW
Sbjct: 296 HKELEA---ISKLNKNLRLNDPWDW 317

>Ecym_5508 Chr5 (1035144..1036124) [981 bp, 326 aa] {ON} similar to
           Ashbya gossypii ACL107C
          Length = 326

 Score =  181 bits (460), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 116/327 (35%), Positives = 176/327 (53%), Gaps = 26/327 (7%)

Query: 8   NTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVG--- 64
           +T    LN G  +  +GLG W+ +A   A   V  A++ GYR  D A  YGNE E+G   
Sbjct: 3   DTRTYTLNNGMKMPVVGLGCWKLSADVAA-TQVYEAIKLGYRLFDGALCYGNEKEIGVGI 61

Query: 65  -RAIRESGVPRGEIFVTTKLWCTQHK--EPELALDQSLKRLGLDYVDLYLMHWPVRMRGE 121
            +AI E  V R ++F+ +KLWC  H     +LAL ++L  LGLDYVDLY +H+P+ ++  
Sbjct: 62  KQAINEGLVKREDLFIVSKLWCNFHHPDHVKLALQRTLNDLGLDYVDLYYIHFPLPIKYV 121

Query: 122 NMPEGDKIGFPTLPNGKRDIDITDWN--FVKTWELMQKLPETGKTRAIGVSNFSINNLKD 179
            + E       T    +R+  +++     + T+  M+KL + G  +++G+SNF    ++D
Sbjct: 122 PLEEKYPPEMYTGEEDRRNNIVSEQQVPILDTYRAMEKLVDEGLVKSLGLSNFQACLIQD 181

Query: 180 LLASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSAD------------ 227
           LL   G +I P A QVE+HP L Q+ LV +   K I + AYS  G               
Sbjct: 182 LLR--GARIKPVALQVELHPYLSQERLVTYAQSKDIQVVAYSTFGPLSFLELGNSAAKDV 239

Query: 228 APILKEPVIIEIAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLT-FTLTSEDF 286
            P+L+  +++ IAKK+ V+ +QV++ W  QRG  V+PKS  KER+  NL +   LT  D 
Sbjct: 240 TPLLEHEIVLNIAKKHDVTPSQVILRWATQRGIAVIPKSSKKERLLNNLNSDKALTLSDS 299

Query: 287 EAVNNISKVQGTKRIIDP-DWEPFKPF 312
           E +++I  +    R +DP DW     F
Sbjct: 300 E-MSDIFSLNKNLRFLDPWDWARLPGF 325

>TBLA0F01720 Chr6 complement(430289..431269) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  179 bits (455), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 117/312 (37%), Positives = 167/312 (53%), Gaps = 32/312 (10%)

Query: 9   TSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVG---- 64
           +SL  LN G  +  +GLG W+      A + V  A++ GYR  D A  YGNE EVG    
Sbjct: 2   SSLAALNNGLKMPMVGLGCWKIPNTVCA-EQVYQAIKLGYRLFDGAEDYGNEKEVGQGIR 60

Query: 65  RAIRESGVPRGEIFVTTKLWCTQHK--EPELALDQSLKRLGLDYVDLYLMHWPVRMRGEN 122
           RAI E  V R ++F+ +KLW T H     +LA+ ++L  LGLDY+DLY +H+P+  +   
Sbjct: 61  RAIDEKIVKRSDLFIVSKLWNTYHHPDHVKLAVKKTLSDLGLDYLDLYYIHFPLAFKFVP 120

Query: 123 MPEGDKIGFPTLPNGKRD-----IDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNL 177
           + E    GF T   GK D     I +    ++ T+  M+ L E G  ++IGVSN     L
Sbjct: 121 IEEKYPPGFYT---GKEDAAQGKISLQKVPYLDTYHAMEALVEEGLIKSIGVSNLQGGLL 177

Query: 178 KDLLASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSA----------- 226
           +D+L   G KI P   Q+E HP L Q  LVD+C  + I++ AYS  G             
Sbjct: 178 QDVLM--GCKIKPVTLQIEHHPYLTQSRLVDYCKREQIIVVAYSSFGQQSYLELGSELKE 235

Query: 227 DAP-ILKEPVIIEIAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANL---LTFTLT 282
           D P +   PVI  IA K  V+ ++V++ W  Q G  V+PKS  KER+  NL    T TL+
Sbjct: 236 DTPNLFDHPVIKRIASKYNVTTSEVLLRWANQNGVAVIPKSSKKERLLMNLNIESTLTLS 295

Query: 283 SEDFEAVNNISK 294
           +E+   ++NI++
Sbjct: 296 NEELVEISNINR 307

>KLLA0F03256g Chr6 (306731..307588) [858 bp, 285 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 285

 Score =  176 bits (447), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 109/306 (35%), Positives = 170/306 (55%), Gaps = 46/306 (15%)

Query: 13  KLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVGRAIRE--- 69
           KL++G TI ++GLGT+       AY  V  AL  GYRH DTA +YGNE EVG+ I++   
Sbjct: 10  KLSSGYTIPSVGLGTYELPPNKTAY-LVHQALEVGYRHFDTAVLYGNEYEVGQGIKKWLN 68

Query: 70  ---SGVPRGEIFVTTKLWCTQH--KEPELALDQSLKRL-GLDYVDLYLMHWPVRMRGENM 123
              +   RG++F TTKLW +QH  ++ + A+D  L+ +  L Y+DL L+H P+       
Sbjct: 69  ENPAENKRGDVFYTTKLWDSQHGYEKAKKAIDHCLQEVEDLGYIDLLLIHSPLG------ 122

Query: 124 PEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDLLAS 183
             G K+                   ++T+E MQ+  + GK R+IGVSN+   ++++LL  
Sbjct: 123 --GKKLR------------------LETYEAMQEAVDAGKVRSIGVSNYGFQHIEELLNW 162

Query: 184 PGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIAKKN 243
              K  P  NQ+E+ P   +QEL DFC  KGI++EAY+PL       LK+P ++++A + 
Sbjct: 163 EKLKYKPVVNQIEISPWCMRQELADFCKKKGILVEAYAPLTHGTK--LKDPDLVKVANEV 220

Query: 244 GVSAAQVVISWNVQRGYIVLPKSVNKERIEANL--LTFTLTSEDFEAVNNISKVQGTKRI 301
           G    Q +I W++Q+GYI LPK+ +  R+ +NL   +F  T++  + ++     + T   
Sbjct: 221 GCDVGQALIRWSLQKGYIPLPKTQSVSRLASNLDVFSFEWTTDQMDQLDKPYAYEPT--- 277

Query: 302 IDPDWE 307
              DWE
Sbjct: 278 ---DWE 280

>KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  175 bits (443), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 108/304 (35%), Positives = 169/304 (55%), Gaps = 26/304 (8%)

Query: 14  LNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVG----RAIRE 69
           LN G T+  +GLG W+ +    A + V  A++ GYR  D A  YGNE +VG    RAI E
Sbjct: 7   LNNGLTMPLVGLGCWKISPDICA-EQVYEAIKLGYRLFDGACDYGNEKQVGDGIRRAIDE 65

Query: 70  SGVPRGEIFVTTKLWCTQH--KEPELALDQSLKRLGLDYVDLYLMHWPVRMRGENMPEGD 127
             V R ++FV +KLW T H  K  +LAL ++L  + L+Y+DLY +H+P+  +     E  
Sbjct: 66  GIVKREDLFVVSKLWNTYHDPKHVKLALQRTLDDMKLEYLDLYYIHFPLAFKFVPFEERY 125

Query: 128 KIGFPTLPNGKRDIDITDWN--FVKTWELMQKLPETGKTRAIGVSNFSINNLKDLLASPG 185
             GF T     +   +T+     + T+  M++L + G T++IG+SN++   ++D L   G
Sbjct: 126 PPGFYTGAEDAKKGILTEEKVALIDTYRAMEELVDEGLTKSIGISNYAGALVQDTLR--G 183

Query: 186 NKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSAD------------APILKE 233
            +I P   Q+E HP L Q++LV++C   GI + AYS  G                P+   
Sbjct: 184 CRIKPVCLQIEHHPYLTQEKLVEYCKLNGIQVVAYSSFGPQSFVDIDQKLAKHTPPLFDH 243

Query: 234 PVIIEIAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANL---LTFTLTSEDFEAVN 290
           PVI +IA+++ V+ +QV++ W  QRG  V+PKS +K R+  NL      TLT +D E ++
Sbjct: 244 PVIKKIAQEHKVTTSQVILRWATQRGIAVIPKSAHKGRLLGNLQIDQAVTLTPKDLEEIS 303

Query: 291 NISK 294
           +++K
Sbjct: 304 SLNK 307

>KAFR0C05320 Chr3 complement(1065934..1066917) [984 bp, 327 aa] {ON}
           
          Length = 327

 Score =  174 bits (441), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 116/322 (36%), Positives = 178/322 (55%), Gaps = 31/322 (9%)

Query: 10  SLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVG----R 65
           SL+ LN G  +  +GLG W+ +    A + V  A++ GYR  D A  YGNE EVG    +
Sbjct: 3   SLVTLNNGQKMPLVGLGCWKISNDICA-EQVYQAIKLGYRLFDGATDYGNEVEVGQGIKK 61

Query: 66  AIRESGVPRGEIFVTTKLWCTQHK--EPELALDQSLKRLGLDYVDLYLMHWPVRMRGENM 123
           AI E  V R ++FV +KLW + H     +LAL ++L+ LGLDY+DLY +H+P+  +    
Sbjct: 62  AIDEGLVKRSDLFVVSKLWNSYHHPDHVKLALKRNLQDLGLDYIDLYYIHFPIAFKFVPF 121

Query: 124 PEGDKIGFPTLPNGKRDIDITDWN--FVKTWELMQKLPETGKTRAIGVSNFSINNLKDLL 181
            E    GF T  +  R+  +++     + T+  +++  + G  ++IG+SNF+   ++DLL
Sbjct: 122 EEKYPPGFYTGVDDAREGILSEAKVPILDTYRALEECVDNGLIKSIGISNFNGVLVQDLL 181

Query: 182 ASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLG------------SADAP 229
              G +I P A Q+E HP L Q++LV++C  KGI + AYS  G             +   
Sbjct: 182 N--GCRIKPVALQIEHHPYLTQEKLVEYCKLKGIQVVAYSSFGPQSFIELDSQLAKSTPS 239

Query: 230 ILKEPVIIEIAKKNGVSA-AQVVISWNVQRGYIVLPKSVNKERIEANLL---TFTLTSED 285
           +L+ P+I +IA  +  S  ++V++ W  QRG  V+PKS  KER+  NL    + TLT E+
Sbjct: 240 LLEHPIIKKIAAAHRSSTPSEVLLRWATQRGIAVIPKSTKKERLLQNLNVEDSITLTEEE 299

Query: 286 FEAVNNISKVQGTKRIIDPDWE 307
              +N IS +    R  DP WE
Sbjct: 300 ---LNEISSLNKNIRFNDP-WE 317

>YHR104W Chr8 (323409..324392) [984 bp, 327 aa] {ON}  GRE3Aldose
           reductase involved in methylglyoxal, d-xylose,
           arabinose, and galactose metabolism; stress induced
           (osmotic, ionic, oxidative, heat shock, starvation and
           heavy metals); regulated by the HOG pathway
          Length = 327

 Score =  173 bits (439), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 114/320 (35%), Positives = 170/320 (53%), Gaps = 30/320 (9%)

Query: 9   TSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVGRAIR 68
           +SL+ LN G  +  +GLG W+      A + +  A++ GYR  D A  YGNE EVG  IR
Sbjct: 2   SSLVTLNNGLKMPLVGLGCWKIDKKVCA-NQIYEAIKLGYRLFDGACDYGNEKEVGEGIR 60

Query: 69  ----ESGVPRGEIFVTTKLWCTQHK--EPELALDQSLKRLGLDYVDLYLMHWPVRMRGEN 122
               E  V R +IFV +KLW   H     +LAL ++L  +GLDY+DLY +H+P+  +   
Sbjct: 61  KAISEGLVSRKDIFVVSKLWNNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFPIAFKYVP 120

Query: 123 MPEGDKIGFPTLPNGKRDIDITDWN--FVKTWELMQKLPETGKTRAIGVSNFSINNLKDL 180
             E    GF T  + ++   IT+ +   + T+  +++  + G  ++IGVSNF  + ++DL
Sbjct: 121 FEEKYPPGFYTGADDEKKGHITEAHVPIIDTYRALEECVDEGLIKSIGVSNFQGSLIQDL 180

Query: 181 LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLG-----------SADAP 229
           L   G +I P A Q+E HP L Q+ LV+FC    I + AYS  G           +   P
Sbjct: 181 LR--GCRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAKTTP 238

Query: 230 ILKEPVIIEIAKKN--GVSAAQVVISWNVQRGYIVLPKSVNKERIEANL---LTFTLTSE 284
            L E  +I+   +N  G + +QV++ W  QRG  V+PKS  KER+  NL     FTLT +
Sbjct: 239 TLFENDVIKKVSQNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLTEQ 298

Query: 285 DFEAVNNISKVQGTKRIIDP 304
           +   + +IS +    R  DP
Sbjct: 299 E---LKDISALNANIRFNDP 315

>ACL107C Chr3 complement(152564..153628) [1065 bp, 354 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR104W
           (GRE3)
          Length = 354

 Score =  173 bits (439), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 117/332 (35%), Positives = 176/332 (53%), Gaps = 32/332 (9%)

Query: 8   NTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVG--- 64
           N   +KLN GA +  +GLG W+      A + V  A++ GYR +D A  Y NE EVG   
Sbjct: 29  NVRTIKLNNGADMPLVGLGCWKIPNEVAA-EQVYEAIKLGYRLLDGAEDYANEREVGQGI 87

Query: 65  -RAIRESGVPRGEIFVTTKLWCTQHKEPEL--ALDQSLKRLGLDYVDLYLMHWPVRMR-- 119
            RAI E  V R E+FV +KLW   H+  ++  AL ++L  LGLDY+DL+ +H+P+  +  
Sbjct: 88  RRAIDEGLVRREELFVVSKLWNNYHRPEDVGKALQRTLSDLGLDYLDLFYIHFPLAFKFV 147

Query: 120 --GENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNL 177
              E  P G   G      G+  +       ++T+  +++L + G+ RAIG+SNF    +
Sbjct: 148 PLEERYPAGLYTGAADEQAGR--LAQEPVPLIETYRALEQLVDEGRIRAIGLSNFQGCLV 205

Query: 178 KDLLASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSAD---------- 227
           +DLL   G +I PAA Q+E HP L Q+ LV +   +G+ +  YS LG             
Sbjct: 206 QDLLR--GCRIRPAALQIEHHPYLTQERLVQYAKSEGLAVVGYSSLGPQSFLELGNTAAQ 263

Query: 228 --APILKEPVIIEIAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANL-LTFTLTSE 284
             AP+L+  V+  IA+++  + A+V++ W  QR   V+PKS  KER+  NL +   LT  
Sbjct: 264 NAAPLLQHEVVCRIAERHTATPAEVLLRWATQRDIAVIPKSSRKERLATNLRVDEALTLA 323

Query: 285 DFEAVNNISKVQGTKRIIDP-DW--EPFKPFV 313
           D E +  +S +    R  DP DW  +P   F+
Sbjct: 324 DDE-LRELSSLNCGLRFNDPWDWSAQPLPTFI 354

>ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {ON}
           highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 327

 Score =  172 bits (435), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 118/332 (35%), Positives = 175/332 (52%), Gaps = 40/332 (12%)

Query: 10  SLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVG----R 65
           S++ LN G  +  +GLG W+    T     +  A+  GYR  D A  YGNE EVG    R
Sbjct: 3   SVVALNNGNKMPLVGLGCWKIPNET-CSQQIYDAISVGYRVFDGAQDYGNEKEVGEGVRR 61

Query: 66  AIRESGVPRGEIFVTTKLWCTQH--KEPELALDQSLKRLGLDYVDLYLMHWPVRMR---- 119
           AI++  V R E+FV +KLW + H  K  +LAL ++L  +GLDY+DL+ +H+P+ ++    
Sbjct: 62  AIKDGLVKREELFVVSKLWNSFHHPKNVKLALKRTLSDMGLDYLDLFYIHFPIALKPVSF 121

Query: 120 GENMPEGDKIGFPTLPNG---KRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINN 176
            E  P G   G      G   +  + I D     T+  +++  E G  ++IGVSNFS + 
Sbjct: 122 EEKYPPGLYTGEADAKAGVLSEEPVPILD-----TYRALEECVEEGLIKSIGVSNFSGSI 176

Query: 177 LKDLLASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLG------------ 224
           + DLL   G +I PAA Q+E+HP L Q+  V +   KGI + AYS  G            
Sbjct: 177 MLDLLR--GARIPPAALQIELHPYLTQERYVKWVQSKGIQVVAYSSFGPQSFVDIGSEVA 234

Query: 225 SADAPILKEPVIIEIAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLT---FTL 281
            A  P+ +  V+ +IA K+ VS +QV++ W  Q+   V+PKS  KER+  NLL     TL
Sbjct: 235 KATPPLFEHDVVKKIAAKHNVSTSQVLLRWATQQKVAVIPKSSKKERLRQNLLVDQEVTL 294

Query: 282 TSEDFEAVNNISKVQGTKRIIDP-DWEPFKPF 312
           T ++ + ++ ++K     R  DP  W    PF
Sbjct: 295 TGDEIKEISGLNK---NLRFNDPFTWSEKTPF 323

>TBLA0A00630 Chr1 complement(126399..127385) [987 bp, 328 aa] {ON} 
          Length = 328

 Score =  170 bits (431), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 112/317 (35%), Positives = 173/317 (54%), Gaps = 40/317 (12%)

Query: 9   TSLLKLNTGATIRAIGLGTWR---SAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVG- 64
           T+++ LN G  +  +GLG W+      A+  Y+    A++ GYR  D AA YGNE EVG 
Sbjct: 2   TAMITLNNGLKMPLVGLGCWKIPNDVCASQVYE----AIKLGYRLFDGAADYGNEKEVGQ 57

Query: 65  ---RAIRESGVPRGEIFVTTKLWCTQHK--EPELALDQSLKRLGLDYVDLYLMHWPVRMR 119
              +A+ E  V R ++F+ +KLW T H     +LAL ++L  LGLDY+DLY +H+P+  +
Sbjct: 58  GINKALSEGIVKRSDLFIISKLWNTFHHPDHVKLALQRTLSDLGLDYLDLYYIHFPLAFK 117

Query: 120 GENMPEGDKIGFPTLPNGKRD-----IDITDWNFVKTWELMQKLPETGKTRAIGVSNFSI 174
              +P  +K   P    G  D     I + +  ++ T+  M+KL + G T++IGVSN   
Sbjct: 118 --YVPFEEKYP-PCFYTGAEDAKIGKISLQNVPYLDTYRAMEKLVDEGLTKSIGVSNLQG 174

Query: 175 NNLKDLLASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLG---------- 224
           + L+D+L   G +I PAA Q+E HP L Q+ LV FC  + I + +YS  G          
Sbjct: 175 SILQDVLM--GCRIRPAALQIEHHPYLTQEHLVQFCKNENIAVVSYSSFGPQSFLELGSK 232

Query: 225 -SADAP-ILKEPVIIEIAKKNG--VSAAQVVISWNVQRGYIVLPKSVNKERIEANLLT-- 278
            + D P +   PVI +IA  +G  V+ ++V++ W  QR   ++PKS  KER+  NL    
Sbjct: 233 RAEDTPALFDHPVIKKIAAAHGKDVTTSEVLLRWATQRDIAIIPKSSRKERLLLNLNVNE 292

Query: 279 -FTLTSEDFEAVNNISK 294
             TLT  +   ++ ++K
Sbjct: 293 KLTLTEAELLEISALNK 309

>NCAS0A06660 Chr1 (1316398..1317378) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  170 bits (430), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 117/323 (36%), Positives = 173/323 (53%), Gaps = 36/323 (11%)

Query: 11  LLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVG----RA 66
           LL LN G  +  +GLG W+      A D V  A++AGYR  D A  Y NE EVG    RA
Sbjct: 4   LLTLNNGMKMPQVGLGCWKIPNDICA-DQVYEAIKAGYRLFDGATDYANEVEVGKGLKRA 62

Query: 67  IRESGVPRGEIFVTTKLWCTQHK--EPELALDQSLKRLGLDYVDLYLMHWPVRMRGENMP 124
           + +  V R ++FV +KLW   H     +L L ++LK LGLDY+DLY +H+P+  +   M 
Sbjct: 63  MDDGIVKRQDLFVVSKLWNNFHHPDHVKLNLKRNLKDLGLDYLDLYYIHFPIAFKFVPME 122

Query: 125 EGDKIGFPTLPNGKRDID---ITDWN--FVKTWELMQKLPETGKTRAIGVSNFSINNLKD 179
           E      P +  GK D     +T+ N   + T+  +++    G  ++IG+SNF+   + D
Sbjct: 123 ERYP---PQMYTGKADEAKGILTEENVPLLDTYRALEECQREGLIKSIGISNFNGGLVAD 179

Query: 180 LLASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGS---ADA-------- 228
           +L   G  I P A Q+E HP L Q++L+++C    + +  YS  G    AD         
Sbjct: 180 ILR--GCSIKPVALQIEHHPYLTQEKLLEYCKIHDVQVVGYSSFGPQSFADCGMDLAKNT 237

Query: 229 -PILKEPVIIEIAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLL---TFTLTSE 284
            P+   PVI +IA+K+ VS A+V++ W  QRG  ++PKS +K+R+ +NL      TLT E
Sbjct: 238 PPLFDHPVIKKIAEKHNVSTAEVLLRWATQRGVAIIPKSSHKKRLLSNLNIDDNVTLTEE 297

Query: 285 DFEAVNNISKVQGTKRIIDP-DW 306
           D ++   IS +    R  DP DW
Sbjct: 298 DLKS---ISGLNQNLRFNDPWDW 317

>Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  170 bits (430), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 113/320 (35%), Positives = 169/320 (52%), Gaps = 30/320 (9%)

Query: 9   TSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVG---- 64
           +SL+ LN G  +  +GLG W+      A + +  A++ GYR  D A  YGNE EVG    
Sbjct: 2   SSLVTLNNGLKMPLVGLGCWKIDKKVCA-NQIYEAIKLGYRLFDGACDYGNEKEVGEGIR 60

Query: 65  RAIRESGVPRGEIFVTTKLWCTQHK--EPELALDQSLKRLGLDYVDLYLMHWPVRMRGEN 122
           RAI E  V R ++FV +KLW   H     +LAL ++L  +GLDY+DLY +H+P+  +   
Sbjct: 61  RAISEGLVARKDVFVVSKLWNNFHHPDHVKLALKKTLNDMGLDYLDLYYIHFPIAFKYVP 120

Query: 123 MPEGDKIGFPTLPNGKRDIDITDWN--FVKTWELMQKLPETGKTRAIGVSNFSINNLKDL 180
             E    GF T  + ++   IT+ +   + T+  +++  + G  ++IG+SNF  + ++DL
Sbjct: 121 FEEKYPPGFYTGVDDEKKGHITEAHVPILDTYRALEECVDEGLIKSIGISNFQGSLVQDL 180

Query: 181 LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLG-----------SADAP 229
           L   G +I P A Q+E HP L Q+ LV+FC    I + AYS  G           +   P
Sbjct: 181 LR--GCRIKPVALQIEHHPYLTQEHLVEFCRLHNIQVVAYSSFGPQSFIEMDLQLAKTTP 238

Query: 230 ILKEPVIIEIAKKN--GVSAAQVVISWNVQRGYIVLPKSVNKERIEANL---LTFTLTSE 284
            L E  +I+    N  G + +QV++ W  QRG  V+PKS  KER+  NL     FTLT +
Sbjct: 239 TLFENDVIKKISLNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLTEQ 298

Query: 285 DFEAVNNISKVQGTKRIIDP 304
           +   +  IS +    R  DP
Sbjct: 299 E---LKEISALNANIRFNDP 315

>KLTH0F16610g Chr6 complement(1346319..1347308) [990 bp, 329 aa]
           {ON} highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 329

 Score =  169 bits (429), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 109/309 (35%), Positives = 170/309 (55%), Gaps = 32/309 (10%)

Query: 12  LKLNTGATIRAIGLGTWR---SAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVGRAIR 68
           +KLN G  +  +GLG W+      A+  Y+    A++ GYR  D A  YGNE EVG+ IR
Sbjct: 8   VKLNNGLEMPLVGLGCWKIPNEVCASQVYE----AIKLGYRLFDGAQDYGNEKEVGQGIR 63

Query: 69  ----ESGVPRGEIFVTTKLWCTQH--KEPELALDQSLKRLGLDYVDLYLMHWPVRMRGEN 122
               E  V R ++FV +KLW + H  K  + AL ++L+ LGL+Y+DL+ +H+P+  +   
Sbjct: 64  KAIDEGIVKREDLFVVSKLWNSYHDPKNVKKALKRTLQDLGLEYLDLFYIHFPLAFKFVP 123

Query: 123 MPEGDKIGFPTLPNGKRD--IDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDL 180
             E    GF T    ++   I +     + T+  +++  + G  +AIGVSNF    L DL
Sbjct: 124 FEERYPPGFYTGAEDEKKGVISLEKVTVLDTYRALEQCVDEGLIKAIGVSNFRGILLHDL 183

Query: 181 LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLG-----------SADAP 229
           LA  G KI PA  Q+E HP L Q++LV++C  +GI + AYS  G           +   P
Sbjct: 184 LA--GAKIPPACLQIEHHPYLTQEKLVEYCKQQGIQVVAYSSFGPQSFLEMDSQLAKSTP 241

Query: 230 ILKE-PVIIEIAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLL---TFTLTSED 285
            L E  V+ ++A  +GVS ++V++ W  QR   ++PKS  KER+  NL      TL+ E+
Sbjct: 242 TLFEHDVVKKVANNHGVSTSEVLLRWATQRRVAIIPKSSKKERLLNNLQINEKLTLSDEE 301

Query: 286 FEAVNNISK 294
            + +++++K
Sbjct: 302 LQEISSLNK 310

>Suva_15.300 Chr15 (525715..526698) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  169 bits (428), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 112/320 (35%), Positives = 166/320 (51%), Gaps = 30/320 (9%)

Query: 9   TSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVGRAIR 68
           +SL+ LN G  +  +GLG W+      A + +  A++ GYR  D A  YGNE EVG  IR
Sbjct: 2   SSLVTLNNGCKMPLVGLGCWKIDNKVCA-NQIYEAIKLGYRLFDGACDYGNEKEVGEGIR 60

Query: 69  ----ESGVPRGEIFVTTKLWCTQHK--EPELALDQSLKRLGLDYVDLYLMHWPVRMRGEN 122
               E  V R +IFVT+KLW   H     +LAL ++L  +GLDY+DLY +H+P+  +   
Sbjct: 61  KAISEGLVTRKDIFVTSKLWNNFHHPDHVKLALKKTLDDMGLDYLDLYYIHFPIAFKYVP 120

Query: 123 MPEGDKIGFPTLPNGKRDIDITDWN--FVKTWELMQKLPETGKTRAIGVSNFSINNLKDL 180
             E    GF T     +   IT+ +   + T+  ++   + G  ++IG+SNF  + ++DL
Sbjct: 121 FEEKYPPGFYTGAEDDKRGHITEAHVPIIDTYRALEACVDEGLIKSIGISNFQGSLVQDL 180

Query: 181 LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLG-----------SADAP 229
           L   G +I P A Q+E HP L Q+ LVD+C    I + AYS  G           +   P
Sbjct: 181 LR--GCRIKPVALQIEHHPYLTQEHLVDYCKLHDIQVVAYSSFGPQSFIEMDLGLAKSTP 238

Query: 230 ILKEPVIIEIAKKN--GVSAAQVVISWNVQRGYIVLPKSVNKERIEANL---LTFTLTSE 284
            L E  +++   +N  G + +QV++ W  QRG  V+PKS  KER+  NL      TLT +
Sbjct: 239 TLFENDVVKKVSENHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKLTLTDQ 298

Query: 285 DFEAVNNISKVQGTKRIIDP 304
           + +    IS +    R  DP
Sbjct: 299 ELK---EISSLNANIRFNDP 315

>Skud_8.165 Chr8 (297201..298184) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  169 bits (427), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 112/323 (34%), Positives = 170/323 (52%), Gaps = 36/323 (11%)

Query: 9   TSLLKLNTGATIRAIGLGTWR---SAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVGR 65
           +SL+ LN G  +  +GLG W+   +A A   Y+    A++ GYR  D A  YGNE EVG 
Sbjct: 2   SSLVTLNNGLKMPLVGLGCWKIDKNACANQIYE----AIKLGYRLFDGACDYGNEKEVGE 57

Query: 66  AIR----ESGVPRGEIFVTTKLWCTQHK--EPELALDQSLKRLGLDYVDLYLMHWPVRMR 119
            IR    E  V R ++FV +KLW   H     +LAL ++L  +GLDY+DLY +H+P+  +
Sbjct: 58  GIRKAIYEGLVTRKDVFVVSKLWNNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFPIAFK 117

Query: 120 GENMPEGDKIGFPTLPNGKRDIDITDWN--FVKTWELMQKLPETGKTRAIGVSNFSINNL 177
                E    GF T    +    IT+ +   + T+  ++K  + G  ++IG+SNF  + +
Sbjct: 118 YIPFEEKYPPGFYTGTEDEEKGHITEAHVPIIDTYRALEKCVDEGLIKSIGISNFQGSLV 177

Query: 178 KDLLASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLG------------S 225
           +DLL   G +I P A Q+E HP L Q+ LV+FC    I + AYS  G             
Sbjct: 178 QDLLR--GCRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAK 235

Query: 226 ADAPILKEPVIIEIAKKN-GVSAAQVVISWNVQRGYIVLPKSVNKERIEANL---LTFTL 281
           A   + +  VI ++++ + G + +QV++ W  QRG  V+PKS  KER+  NL     F+L
Sbjct: 236 ATQTLFENDVIKKVSENHTGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFSL 295

Query: 282 TSEDFEAVNNISKVQGTKRIIDP 304
           T ++   +  IS +    R  DP
Sbjct: 296 TEQE---LKKISALNANIRFNDP 315

>Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to
           Ashbya gossypii ABL209C
          Length = 271

 Score =  167 bits (422), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 103/292 (35%), Positives = 159/292 (54%), Gaps = 43/292 (14%)

Query: 14  LNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVGRAIRE---- 69
           L  G  + ++GLG +     T A   V  AL+ GYRH DTA  YGNE EVG  I      
Sbjct: 8   LTNGCLMPSLGLGCYSIPKNTTA-QVVHQALKCGYRHFDTAVFYGNETEVGEGIAAWLAE 66

Query: 70  --SGVPRGEIFVTTKLWCTQ--HKEPELALDQSLKRLG-LDYVDLYLMHWPVRMRGENMP 124
             S   R ++F  TKLW +Q  + E + A+ Q L+++  L Y+DL L+H           
Sbjct: 67  DPSSNRRQDVFYVTKLWNSQNGYTEAKTAIQQCLQKVAPLGYIDLLLIH----------- 115

Query: 125 EGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDLLASP 184
                  P   + KR         + T+E MQ+  + G  ++IGVSN+  ++L++L A P
Sbjct: 116 ------SPACGSAKR---------LATYEAMQESVDAGIVKSIGVSNYERHHLQELYAMP 160

Query: 185 GNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIAKKNG 244
             K  P  NQ+E+ P LP+ +LVD+C   G+ I+AYSPLG  D   + +P I  +A +  
Sbjct: 161 NLKHNPVVNQIEVTPWLPRNDLVDYCKSIGLAIQAYSPLGCGDR--VNDPYIASLATQKN 218

Query: 245 VSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTF--TLTSEDFEAVNNISK 294
            + AQ++I+W++ +GY  LPK+ N +R+++NL ++  +LT+E+     NI K
Sbjct: 219 CTPAQILIAWSLAKGYAPLPKTQNIQRLQSNLDSYNVSLTAEEL---TNIEK 267

>NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON} 
          Length = 327

 Score =  167 bits (424), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 115/326 (35%), Positives = 170/326 (52%), Gaps = 37/326 (11%)

Query: 9   TSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVG---- 64
           ++L+ LN G  +  +GLG W+   +T A   +  A++ GYR  D A  YGNE EVG    
Sbjct: 2   SALVTLNNGLKMPLVGLGCWKIPTSTCA-QQIYDAIKVGYRLFDGATDYGNEKEVGQGIK 60

Query: 65  RAIRESGVPRGEIFVTTKLWCTQHK--EPELALDQSLKRLGLDYVDLYLMHWPVRMRGEN 122
           RAI E  V R ++F+ +KLW   H     +L L ++LK LGLDYVDLY +H+P+  +   
Sbjct: 61  RAIDEGLVKREDLFIVSKLWNNFHHPDHVKLNLQRNLKDLGLDYVDLYYIHFPIAFK--- 117

Query: 123 MPEGDKIGFPTLPNGKRDID---ITDWN--FVKTWELMQKLPETGKTRAIGVSNFSINNL 177
               D+   P +  GK D     +T+ N   + T+  M+KL + G  ++IG+SN++   +
Sbjct: 118 FVSPDERYPPGMYTGKEDEAKGILTEENVPLIDTYRAMEKLVDEGLIKSIGISNYNGGLV 177

Query: 178 KDLLASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSAD---------- 227
            D L   G +I P A Q+E HP L Q++L+++C    + + AYS  G             
Sbjct: 178 ADTLR--GCRIKPVALQIEHHPYLTQEKLLEYCKIHDVQVVAYSSFGPQSFVDCGQEMAK 235

Query: 228 --APILKEPVIIEIAKK-NGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLL---TFTL 281
              P+   P I +IA K   V+ +QV++ W  QRG  ++PKS  KER+  NL      TL
Sbjct: 236 NTPPLFDHPTIKKIADKYEAVTTSQVLLRWATQRGVAIIPKSSKKERLLENLTIDQKVTL 295

Query: 282 TSEDFEAVNNISKVQGTKRIIDP-DW 306
             ED   +  IS +    R  DP DW
Sbjct: 296 AEED---LREISALNQNLRFNDPWDW 318

>TPHA0E01860 Chr5 complement(373074..374054) [981 bp, 326 aa] {ON}
           Anc_5.409 YHR104W
          Length = 326

 Score =  167 bits (423), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 117/326 (35%), Positives = 167/326 (51%), Gaps = 30/326 (9%)

Query: 9   TSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVG---- 64
           + L+ LN G  +  +GLG W+    T A   V  A++ GYR  D A  YGNE EVG    
Sbjct: 2   SKLITLNNGLKMPIVGLGCWKIPNDTCA-AQVYEAIKLGYRAFDGAQDYGNEKEVGEGIN 60

Query: 65  RAIRESGVPRGEIFVTTKLWCTQH--KEPELALDQSLKRLGLDYVDLYLMHWPVRMRGEN 122
           +AI E  V R E+FV +KLW + H  K  ++AL ++L  + LDY+DLY +H+P+  +   
Sbjct: 61  QAISEGIVKREELFVISKLWNSYHDPKHVKMALQRTLSDMKLDYLDLYYIHFPIAFKFVP 120

Query: 123 MPEGDKIGFPTLPNGKRD-----IDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNL 177
             E    GF T   GK D     I       + T+  M++L   G  ++IG+SNF+   +
Sbjct: 121 FEEKYPAGFYT---GKEDAEKGIISEEVVPLIDTYRAMEQLATDGLIKSIGISNFNGALI 177

Query: 178 KDLLASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLG-----------SA 226
           +DLL S   KI P   Q+E HP L Q  L+++C    I + AYS  G           + 
Sbjct: 178 QDLLRS--CKIKPTCLQIEHHPYLTQPHLIEYCKLNDIQVVAYSSFGPQSFLELNVQKAL 235

Query: 227 DAPILKE-PVIIEIAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSED 285
           DA +L E  VI  IA  + V  +QV++ W  QRG  ++PKS  KER+  NLL     +  
Sbjct: 236 DAKVLFEHEVIKSIATNHSVEPSQVLLRWATQRGIAIIPKSSKKERLLENLLIDEKLTLS 295

Query: 286 FEAVNNISKVQGTKRIIDP-DWEPFK 310
            + ++ IS +    R  DP DW   K
Sbjct: 296 EQELSTISDLNIGLRFNDPWDWNNMK 321

>KNAG0D01370 Chr4 complement(230193..231041) [849 bp, 282 aa] {ON}
           Anc_7.468 YJR096W
          Length = 282

 Score =  164 bits (416), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 108/304 (35%), Positives = 164/304 (53%), Gaps = 43/304 (14%)

Query: 13  KLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVGRAI----- 67
           KL +G  I  IGLGT+     ++    V AAL  GYRH+DTA +YGNEAEV +       
Sbjct: 8   KLASGFNIPTIGLGTY-DLPPSNTTAIVEAALEVGYRHLDTAVLYGNEAEVAQGAMNFLG 66

Query: 68  RESGVPRGEIFVTTKLWCTQ--HKEPELALDQSLKRLG-LDYVDLYLMHWPVRMRGENMP 124
           R   V R +IF TTKLW +Q  +++ + A+ + ++ +G L Y+DL LMH P+   G+ + 
Sbjct: 67  RHPDVSREDIFYTTKLWNSQFGYEKAKRAIRECVECIGGLGYIDLLLMHSPIG--GKQVR 124

Query: 125 EGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDLLASP 184
            G                        TW+ MQ+  + G  R+IGVS++   +L+DL    
Sbjct: 125 RG------------------------TWKAMQEAVDDGLVRSIGVSSYGQRHLEDLFEWS 160

Query: 185 GNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIAKKNG 244
             K  PA NQ+E+ P + +Q+L D+C  KGIV+EAYSPL       L +P ++++A++ G
Sbjct: 161 ELKHAPAVNQIEISPWIMRQQLADYCKSKGIVVEAYSPLTHGYK--LDDPDLLKVAEETG 218

Query: 245 VSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKRIIDP 304
            +  QV++ W++Q GY+ LPK+    R++ NL  F     D+E      K+       +P
Sbjct: 219 KNPGQVLLRWSLQHGYVPLPKTKTVSRLQLNLDVF-----DWELSPEHMKLLDHPEAYEP 273

Query: 305 -DWE 307
            DWE
Sbjct: 274 TDWE 277

>TDEL0E02150 Chr5 complement(403001..403990) [990 bp, 329 aa] {ON}
           Anc_5.409 YHR104W
          Length = 329

 Score =  164 bits (416), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 111/330 (33%), Positives = 173/330 (52%), Gaps = 32/330 (9%)

Query: 9   TSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVGRAIR 68
           + ++ LN G  +  +GLG W+      A   V  A++ GYR  D A  YGNE EVG+ IR
Sbjct: 2   SRVVTLNNGMKMPLVGLGCWKIPNEVCA-SQVYEAIKIGYRLFDGAQDYGNEKEVGQGIR 60

Query: 69  ----ESGVPRGEIFVTTKLWCTQH--KEPELALDQSLKRLGLDYVDLYLMHWPVRMRGEN 122
               E  V R E+FV +KLW + H  K  + AL ++L  + LDY+DL+ +H+P+ ++   
Sbjct: 61  KAIDEGIVKREELFVVSKLWNSFHDPKNVKAALQRTLDDMKLDYLDLFYIHFPIALKFVP 120

Query: 123 MPEGDKIGFPTLPNGKRDIDITDWN--FVKTWELMQKLPETGKTRAIGVSNFSINNLKDL 180
             E    G  T    ++   +++ N   + T+  +++L + G  ++IG+SNFS + + DL
Sbjct: 121 FKEKYPPGLYTGSQDEKQGTMSEENVPIIDTYRALEQLVDEGLIKSIGISNFSGSIIMDL 180

Query: 181 LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLG------------SADA 228
           L   G +I P A Q+E HP L Q+ LV +   +G+ + AYS  G                
Sbjct: 181 LR--GCRIKPVALQIEHHPYLTQERLVHYVKLQGLQVVAYSSFGPQSFIEMGSDLAKTTP 238

Query: 229 PILKEPVIIEIAKKNG--VSAAQVVISWNVQRGYIVLPKSVNKERIEANLL---TFTLTS 283
           P+ + P IIEIAK +G  +S +QV++ W  Q    V+PKS  KER+  NL      TLT 
Sbjct: 239 PLFENPKIIEIAKNHGKEISPSQVLLRWATQNNVAVIPKSSKKERLHDNLHIDDKLTLTD 298

Query: 284 EDFEAVNNISKVQGTKRIIDP-DWEPFKPF 312
           ++ + ++ ++K     R  DP  W    PF
Sbjct: 299 QELKEISALNK---NIRFNDPYTWNDKNPF 325

>SAKL0G01914g Chr7 (162612..163601) [990 bp, 329 aa] {ON} highly
           similar to uniprot|P38715 Saccharomyces cerevisiae
           YHR104W GRE3 Aldose reductase involved in methylglyoxal
           d-xylose and arabinose metabolism stress induced
           (osmotic ionic oxidative heat shock starvation and heavy
           metals) regulated by the HOG pathway
          Length = 329

 Score =  164 bits (416), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 111/320 (34%), Positives = 171/320 (53%), Gaps = 36/320 (11%)

Query: 1   MSATLSKNTSLLKLNTGATIRAIGLGTWR---SAAATDAYDSVIAALRAGYRHIDTAAIY 57
           MSA LSK  +L   N G  +  IGLG W+      A+  Y+    A++ GYR  D A  Y
Sbjct: 1   MSA-LSKTVTL---NNGLEMPLIGLGCWKIPNDVCASQVYE----AIKLGYRLFDGAQDY 52

Query: 58  GNEAEVG----RAIRESGVPRGEIFVTTKLWCTQHK--EPELALDQSLKRLGLDYVDLYL 111
           GNE EVG    +AI E  V R ++FV +KLW + H     +LAL ++L  +GLDY+DL+ 
Sbjct: 53  GNEKEVGQGIKKAIAEGIVKREDLFVVSKLWNSFHHPDNVKLALKKTLDDIGLDYLDLFY 112

Query: 112 MHWPVRMRGENMPEGDKIGFPTLPNGKRD--IDITDWNFVKTWELMQKLPETGKTRAIGV 169
           +H+P+  +     E    GF T    +++  I   D   + T+  ++K  + G  ++IG+
Sbjct: 113 IHFPLAFKFVPFEEKYPPGFYTGAEDEKNGVISQEDVPLIDTYRALEKCVDEGLIKSIGI 172

Query: 170 SNFSINNLKDLLASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLG----- 224
           SNF+ + ++DLL   G +I P A Q+E HP L Q+ LV +C   GI + AYS  G     
Sbjct: 173 SNFNGSLVQDLLR--GARIKPVALQIEHHPYLTQENLVKYCKNVGIQVVAYSSFGPQSFI 230

Query: 225 -------SADAPILKEPVIIEIAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLL 277
                       + +   +  IA  + VS +QV++ W  QRG  V+PKS  KER+  NL 
Sbjct: 231 ELDSELAKTTPTLFRNDTVKLIANNHKVSTSQVLLRWATQRGVAVIPKSSKKERLLENLT 290

Query: 278 ---TFTLTSEDFEAVNNISK 294
              + TL+ ++ +A++ ++K
Sbjct: 291 INDSLTLSDKELKAISALNK 310

>SAKL0F14278g Chr6 (1143922..1144782) [861 bp, 286 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 286

 Score =  162 bits (410), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 100/306 (32%), Positives = 169/306 (55%), Gaps = 46/306 (15%)

Query: 13  KLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVGRAIRE--- 69
           KL++G T+ +IGLGT+   +   + + V  AL+ GYRH+DTA +YGNE EVG  I +   
Sbjct: 11  KLSSGYTLPSIGLGTYDLPSNATS-EIVYEALKCGYRHLDTAVLYGNEREVGEGILKWLK 69

Query: 70  ---SGVPRGEIFVTTKLWCTQ--HKEPELALDQSLKRL-GLDYVDLYLMHWPVRMRGENM 123
              S   R ++F  TKLW +Q  +   + A+ +  +++ GL Y+DL L+H P+       
Sbjct: 70  ENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPL------- 122

Query: 124 PEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDLLAS 183
                       +G R         ++T++ MQ+  + G  R+IGVSN+ ++++ +LL  
Sbjct: 123 ------------SGSR-------KRLETYKAMQEAVDKGIVRSIGVSNYGVHHIDELLNW 163

Query: 184 PGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIAKKN 243
              K  P  NQ+E+ P L +QEL D+C  +G+++EAY+PL       +  P ++ +AK+ 
Sbjct: 164 NELKYKPFVNQIEISPWLMRQELADYCKSRGLIVEAYAPLTHGYK--INHPNVLRVAKEA 221

Query: 244 GVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFT--LTSEDFEAVNNISKVQGTKRI 301
           G ++ QV+I W++Q GY+ LPK+ + +R+ +NL  +   LT E  + ++     + T   
Sbjct: 222 GCNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNIELTQEQMDFLDQPDAYEPT--- 278

Query: 302 IDPDWE 307
              DWE
Sbjct: 279 ---DWE 281

>YJR096W Chr10 (611195..612043) [849 bp, 282 aa] {ON} Putative
           xylose and arabinose reductase; member of the aldo-keto
           reductase (AKR) family; GFP-fusion protein is induced in
           response to the DNA-damaging agent MMS
          Length = 282

 Score =  162 bits (409), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 107/311 (34%), Positives = 162/311 (52%), Gaps = 52/311 (16%)

Query: 11  LLKLNTGATIRAIGLGTW---RSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVGRAI 67
             KL+ G  I +I LGT+   RS  A   Y+ V    + GYRH DTA +YGNE EVG  I
Sbjct: 5   FYKLSNGFKIPSIALGTYDIPRSQTAEIVYEGV----KCGYRHFDTAVLYGNEKEVGDGI 60

Query: 68  RE------SGVPRGEIFVTTKLWCTQ--HKEPELALDQSLKRL-GLDYVDLYLMHWPVRM 118
            +          R EIF TTKLW +Q  +K  + A+ Q L  + GL Y+DL L+H P+  
Sbjct: 61  IKWLNEDPGNHKREEIFYTTKLWNSQNGYKRAKAAIRQCLNEVSGLQYIDLLLIHSPL-- 118

Query: 119 RGENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLK 178
                 EG K+                   ++TW  MQ+  + G  ++IGVSN+   ++ 
Sbjct: 119 ------EGSKLR------------------LETWRAMQEAVDEGLVKSIGVSNYGKKHID 154

Query: 179 DLLASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIE 238
           +LL  P  K  P  NQ+E+ P + +QEL D+C  KG+V+EA++PL       +  P +++
Sbjct: 155 ELLNWPELKHKPVVNQIEISPWIMRQELADYCKSKGLVVEAFAPLCHGYK--MTNPDLLK 212

Query: 239 IAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANL--LTFTLTSEDFEAVNNISKVQ 296
           + K+   +  QV+I W++Q GY+ LPK+   +R+E NL    F L+ E  + +++    +
Sbjct: 213 VCKEVDRNPGQVLIRWSLQHGYLPLPKTKTVKRLEGNLAAYNFELSDEQMKFLDHPDAYE 272

Query: 297 GTKRIIDPDWE 307
            T      DWE
Sbjct: 273 PT------DWE 277

>Kwal_47.18219 s47 (737925..738806) [882 bp, 293 aa] {ON} YJR096W -
           Hypothetical ORF [contig 197] FULL
          Length = 293

 Score =  162 bits (410), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 105/315 (33%), Positives = 174/315 (55%), Gaps = 46/315 (14%)

Query: 5   LSKNT--SLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAE 62
           +SK T     KL++G  + +IGLGT+    A  + + V  AL++GYRH+DTA +YGNE E
Sbjct: 8   MSKTTVPKAYKLSSGYILPSIGLGTYDIPRAETS-EVVYQALKSGYRHLDTAVLYGNEHE 66

Query: 63  VGRAIRE------SGVPRGEIFVTTKLWCTQ--HKEPELALDQSLKRLG-LDYVDLYLMH 113
           VG+ I++          R ++F TTKLW +Q  +   + A+ + ++++  L Y+DL L+H
Sbjct: 67  VGQGIQKWLEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIH 126

Query: 114 WPVRMRGENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFS 173
            P+                   +G R         ++T++ MQ+  + G  R+IGVSN+ 
Sbjct: 127 SPL-------------------SGTR-------RRLETYKAMQEAVDEGIVRSIGVSNYG 160

Query: 174 INNLKDLLASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKE 233
            +++ +LL     K  P  NQ+E+ P + +Q+L D+C  KG+V+EA+SPL       LK 
Sbjct: 161 KHHIDELLTWKELKHKPVVNQIEISPWIMRQDLADYCKSKGLVVEAFSPLTHGYK--LKH 218

Query: 234 PVIIEIAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFE-AVNNI 292
           P ++ +AK+ G  A +V+I W++Q GY+ LPKS + ER++ N+  +     DFE +   +
Sbjct: 219 PDVLLVAKETGTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAY-----DFELSPEQV 273

Query: 293 SKVQGTKRIIDPDWE 307
           S +   +     DWE
Sbjct: 274 SFLDQPQAYEPTDWE 288

>Skud_10.318 Chr10 (568560..569408) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  160 bits (406), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 103/307 (33%), Positives = 160/307 (52%), Gaps = 50/307 (16%)

Query: 14  LNTGATIRAIGLGTW---RSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVGRAI--- 67
           L+ G  I +I LGT+   RS  A   Y+ +    + GYRH DTA +YGNE EVG  I   
Sbjct: 8   LSNGYRIPSIALGTYDIPRSQTAEIVYEGI----KCGYRHFDTAVLYGNEKEVGDGIIKW 63

Query: 68  ---RESGVPRGEIFVTTKLWCTQ--HKEPELALDQSLKRL-GLDYVDLYLMHWPVRMRGE 121
                    R +IF TTKLW +Q  +K  + A+ Q L  + GL Y+DL L+H P+     
Sbjct: 64  LNENPESNKREKIFYTTKLWNSQNGYKRAKAAIQQCLNEVSGLKYIDLLLIHSPL----- 118

Query: 122 NMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDLL 181
              EG K+                   ++TW+ MQ+  + G  ++IGVSN+   ++ +LL
Sbjct: 119 ---EGSKLR------------------LETWQAMQEAVDEGVVKSIGVSNYGKKHIDELL 157

Query: 182 ASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIAK 241
             P     P  NQ+E+ P + +QEL D+C  KG+++EA++PL       +  P ++++ K
Sbjct: 158 TWPDLTYKPVVNQIEISPWVMRQELADYCKSKGLIVEAFAPLCHGYK--MTNPDLLKVCK 215

Query: 242 KNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKRI 301
           +   +  QV+I W++Q GY+ LPK+   +R+E NL  +     DFE ++   K+      
Sbjct: 216 EVDRNPGQVLIRWSLQHGYLPLPKTKTVKRLEGNLAAY-----DFELLDKQMKILDHPDA 270

Query: 302 IDP-DWE 307
            +P DWE
Sbjct: 271 YEPTDWE 277

>KLTH0G05786g Chr7 complement(460135..460995) [861 bp, 286 aa] {ON}
           highly similar to uniprot|P47137 Saccharomyces
           cerevisiae YJR096W
          Length = 286

 Score =  160 bits (405), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 102/306 (33%), Positives = 167/306 (54%), Gaps = 46/306 (15%)

Query: 13  KLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVGRAIRE--- 69
           KL++G  + ++GLGT+    A  A + V  AL+AGYRH+DTA +YGNE EVG  + +   
Sbjct: 11  KLSSGYVLPSLGLGTYDIPRAETA-EVVYQALKAGYRHLDTAVLYGNEREVGEGVEKWLK 69

Query: 70  ---SGVPRGEIFVTTKLWCTQ--HKEPELALDQSLKRLG-LDYVDLYLMHWPVRMRGENM 123
                  R ++F TTKLW +Q  +   + A+ + L ++  L Y+D+ L+H P+       
Sbjct: 70  EDPKNHRRHDVFYTTKLWNSQNGYSNAKRAIQECLDKVRPLGYIDMLLIHSPL------- 122

Query: 124 PEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDLLAS 183
                       +G R         ++T++ MQ+  + G  R+IGVSN+  +++ +LLA 
Sbjct: 123 ------------SGTR-------RRLETYKAMQEAVDAGIVRSIGVSNYGKHHIDELLAW 163

Query: 184 PGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIAKKN 243
              K  P  NQ+E+ P + +Q+L D+C  KG+V+EA+SPL       +K P ++ +A++ 
Sbjct: 164 EELKHKPVVNQIEISPWVMRQDLADYCKSKGLVVEAFSPLTHGYK--IKHPNVVRVAEEV 221

Query: 244 GVSAAQVVISWNVQRGYIVLPKSVNKERIEANL--LTFTLTSEDFEAVNNISKVQGTKRI 301
           G +  QV+I W++Q GY+ LPKS + ER++ NL    F L+ E    ++     + T   
Sbjct: 222 GRNTGQVLIRWSLQHGYVPLPKSRSVERLKGNLEVYDFELSPEQITFLDQPQAYEPT--- 278

Query: 302 IDPDWE 307
              DWE
Sbjct: 279 ---DWE 281

>KAFR0G00920 Chr7 complement(215664..216524) [861 bp, 286 aa] {ON}
           Anc_7.468 YJR096W
          Length = 286

 Score =  159 bits (401), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 106/306 (34%), Positives = 158/306 (51%), Gaps = 45/306 (14%)

Query: 13  KLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVGRAI----- 67
           KL++   I  + LGT+    +++  + V  AL  GYRH DTA +Y NE EV + I     
Sbjct: 10  KLSSNYYIPTVALGTY-DLPSSETTEIVENALDVGYRHFDTAVLYDNEEEVAQGISNWLI 68

Query: 68  RESGVPRGEIFVTTKLWCTQ--HKEPELALDQSLKRL-GLDYVDLYLMHWPVRMRGENMP 124
           R     R EIF TTKLW +Q  ++  + A+ + + ++  L Y+DL LMH P         
Sbjct: 69  RHPETKRDEIFYTTKLWNSQFGYQNAKRAIRECVDKVQDLKYIDLLLMHSP--------- 119

Query: 125 EGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDLLASP 184
               IG P +               +TW  MQ+  + G  ++IGVSNF I +LK+L    
Sbjct: 120 ----IGGPQIRE-------------ETWRAMQEAVDEGIVKSIGVSNFGIKHLKELFQWD 162

Query: 185 GNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIAKK-- 242
           G K  P  NQ+E+ P L +QEL DFC  +G+V+EAY+PL       +  P +I+I+ +  
Sbjct: 163 GLKYRPVVNQIEISPWLMRQELADFCKMEGLVVEAYAPLTHGYK--INHPDLIKISNELN 220

Query: 243 NGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKRII 302
           N  +  Q++I W++Q GY+ LPK+    R+E+NL  +     DFE   +  K        
Sbjct: 221 NTKNTGQILIRWSLQHGYVPLPKTKTIGRLESNLDVY-----DFELTEDQMKFLDHPEAY 275

Query: 303 DP-DWE 307
           +P DWE
Sbjct: 276 EPTDWE 281

>NCAS0H00560 Chr8 complement(96020..96874) [855 bp, 284 aa] {ON}
           Anc_7.468
          Length = 284

 Score =  159 bits (401), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 99/305 (32%), Positives = 159/305 (52%), Gaps = 46/305 (15%)

Query: 14  LNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVGRAIRE---- 69
            N G  I +I LGT+    +  A   V  AL+AGYRH DTA +YGNE +VG  I +    
Sbjct: 10  FNNGNQIPSIALGTYDIPQSITA-KIVYEALKAGYRHFDTAVLYGNEHQVGEGILQWIQE 68

Query: 70  --SGVPRGEIFVTTKLWCTQ--HKEPELALDQSLKRL-GLDYVDLYLMHWPVRMRGENMP 124
                 R ++F TTKLW +Q  + + + A+ + L ++ GL Y+D+ L+H P+  R + + 
Sbjct: 69  DPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPLEGRTKRL- 127

Query: 125 EGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDLLASP 184
                                    +TW  MQ+  E+G  + IGVSN+   ++++LL   
Sbjct: 128 -------------------------ETWRAMQEAVESGLVKNIGVSNYGRQHVEELLQWE 162

Query: 185 GNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIAKKNG 244
              I P  NQ+E+ P + + EL D+C   G+V+EA++PL       L +  ++ ++K+ G
Sbjct: 163 RLTIKPVVNQIEISPWVMRSELADYCKSVGLVVEAFAPLTHGYK--LHDADLVRVSKEVG 220

Query: 245 VSAAQVVISWNVQRGYIVLPKSVNKERIEANL--LTFTLTSEDFEAVNNISKVQGTKRII 302
            S  QV+I W++Q GY+ LPK+   +R+E NL    F LT+E  + +++    + T    
Sbjct: 221 RSTVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNFQLTTEQMQLIDHPDAYEPT---- 276

Query: 303 DPDWE 307
             DWE
Sbjct: 277 --DWE 279

>KLLA0E21627g Chr5 complement(1929294..1930283) [990 bp, 329 aa]
           {ON} highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 329

 Score =  159 bits (402), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 112/320 (35%), Positives = 163/320 (50%), Gaps = 36/320 (11%)

Query: 14  LNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVG----RAIRE 69
           LN G  +  +GLG W+      A D +  A++ GYR  D A  Y NE EVG    RAI+E
Sbjct: 10  LNNGEKMPLVGLGCWKMPNDVCA-DQIYEAIKIGYRLFDGAQDYANEKEVGQGVNRAIKE 68

Query: 70  SGVPRGEIFVTTKLWCTQHKEPEL--ALDQSLKRLGLDYVDLYLMHWPVRMRGENMPEGD 127
             V R ++ V +KLW + H    +  AL+++L  L LDYVD++ +H+P+  +     E  
Sbjct: 69  GLVKREDLVVVSKLWNSFHHPDNVPRALERTLSDLQLDYVDIFYIHFPLAFKPVPFDEKY 128

Query: 128 KIGFPTLPNGKRD-----IDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDLLA 182
             GF T   GK D     I+      + TW  ++KL + GK +++G+SNFS   ++DLL 
Sbjct: 129 PPGFYT---GKEDEAKGHIEEEQVPLLDTWRALEKLVDQGKIKSLGISNFSGALIQDLLR 185

Query: 183 SPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSA------DAPILKEPVI 236
             G +I P A Q+E HP L Q+ L+ +    GI + AYS  G        +   L  P +
Sbjct: 186 --GARIKPVALQIEHHPYLTQERLIKYVKNAGIQVVAYSSFGPVSFLELENKKALNTPTL 243

Query: 237 IE------IAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLL---TFTLTSEDFE 287
            E      IA K+ V+  QV++ W  Q G  ++PKS  KER+  NL      TLT ++ +
Sbjct: 244 FEHDTIKSIASKHKVTPQQVLLRWATQNGIAIIPKSSKKERLLDNLRINDALTLTDDELK 303

Query: 288 AVNNISKVQGTKRIIDPDWE 307
               IS +    R  DP WE
Sbjct: 304 ---QISGLNQNIRFNDP-WE 319

>Suva_12.184 Chr12 (289608..290456) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  157 bits (397), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 100/310 (32%), Positives = 163/310 (52%), Gaps = 50/310 (16%)

Query: 11  LLKLNTGATIRAIGLGTW---RSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVGRAI 67
             K + G  + +I LGT+   RS  A   Y+ +    + GYRH DTA +YGNE EVG  I
Sbjct: 5   FYKFSNGYKVPSIALGTYDIPRSQTAEIVYEGI----KCGYRHFDTAVLYGNEKEVGDGI 60

Query: 68  RE------SGVPRGEIFVTTKLWCTQ--HKEPELALDQSLKRL-GLDYVDLYLMHWPVRM 118
            +          R ++F TTKLW +Q  +K  ++A+ Q L  + GL Y+DL L+H P+  
Sbjct: 61  TKWLHEDPENNKREDVFYTTKLWNSQNGYKRAKVAIQQCLNEVSGLKYIDLLLIHSPL-- 118

Query: 119 RGENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLK 178
                 EG K+                   ++TW+ MQ+  + G  ++IGVSN+   ++ 
Sbjct: 119 ------EGSKLR------------------LETWQAMQEAVDEGMVKSIGVSNYGKKHVD 154

Query: 179 DLLASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIE 238
           +LL     K  P  NQ+E+ P + +QEL D+C  K +V+EA++PL       + +P +++
Sbjct: 155 ELLNWSQLKHKPVVNQIEISPWIMRQELADYCKSKNLVVEAFAPLCHGYK--MTDPDLLK 212

Query: 239 IAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGT 298
           + K+   +  QV+I W++Q GY+ LPK+   +R+E+NL  +     +FE  ++  K+   
Sbjct: 213 VCKEVDRNPGQVLIRWSLQHGYLPLPKTKTVKRLESNLAAY-----NFELSDDQMKILDH 267

Query: 299 KRIIDP-DWE 307
               +P DWE
Sbjct: 268 PDAYEPTDWE 277

>SAKL0F02574g Chr6 complement(220827..221696) [870 bp, 289 aa] {ON}
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 289

 Score =  157 bits (397), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 102/310 (32%), Positives = 178/310 (57%), Gaps = 47/310 (15%)

Query: 14  LNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAE----VGRAIRE 69
           L  G  +  +GLG +++    +  + V  AL+ GYR +D+A +YGNE E    + + + E
Sbjct: 11  LKNGVKMPCLGLGLYQTPKE-ETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEE 69

Query: 70  S-GVPRGEIFVTTKLWCTQHKEPELA---LDQSLKRLG-LDYVDLYLMHWPVRMRGENMP 124
           S  V R +IF TTK+  TQ +  E A   +++SL R+  LDY+DL+L+H P         
Sbjct: 70  SPKVSRSDIFFTTKI-KTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAP--------- 119

Query: 125 EGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDLLASP 184
                    L N ++ +         TW+  Q+  ETGK +AIGVSN+ I +L+++    
Sbjct: 120 ---------LTNKEKRLG--------TWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWD 162

Query: 185 GNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIAKKN- 243
           G KI P  NQ E++P L ++EL ++CH KG+VI+AYSPL  A    L++P ++++ + + 
Sbjct: 163 GLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPLTRARR--LQDPELVKLVEDSY 220

Query: 244 -GVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLT--FTLTSEDFEAVNNISKVQGTKR 300
              ++AQ++++W++Q G++ L K+V+++R++ N+ +  F L+S D + + +  +      
Sbjct: 221 PEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTHDDQY----Y 276

Query: 301 IIDPDWEPFK 310
           +  P W+P K
Sbjct: 277 LSQPKWDPIK 286

>Smik_10.384 Chr10 (600097..600945) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  157 bits (396), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 101/311 (32%), Positives = 162/311 (52%), Gaps = 52/311 (16%)

Query: 11  LLKLNTGATIRAIGLGTW---RSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVGRAI 67
             KL+ G  I +I LGT+   RS  A   Y+ +    + GYRH DTA +YGNE EVG  I
Sbjct: 5   FYKLSNGIKIPSIALGTYEIPRSQTAEIVYEGI----KCGYRHFDTAVLYGNEKEVGDGI 60

Query: 68  RE------SGVPRGEIFVTTKLWCTQ--HKEPELALDQSLKRL-GLDYVDLYLMHWPVRM 118
                       R +IF TTKLW +Q  +++ + A+ Q L  + GL+Y+DL L+H P+  
Sbjct: 61  TRWLNEDPKNNKRTDIFYTTKLWNSQNGYRKAKAAIQQCLNEVSGLEYIDLLLIHSPL-- 118

Query: 119 RGENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLK 178
                 EG K+                   ++TW  MQ+  + G  ++IGVSN+   ++ 
Sbjct: 119 ------EGSKLR------------------LETWRAMQEAVDAGVVKSIGVSNYGRKHID 154

Query: 179 DLLASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIE 238
           +LL     +  P  NQ+E+ P + +QEL D+C  KG+++EA++PL       +  P ++ 
Sbjct: 155 ELLNWSELRHYPVVNQIEISPWIMRQELADYCKSKGLIVEAFAPLCHGYK--MTNPDLLI 212

Query: 239 IAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANL--LTFTLTSEDFEAVNNISKVQ 296
           + K+   +  QV+I W++Q GY+ LPK+   +R+E NL   +F L+ E  + +++    +
Sbjct: 213 VCKEVDRNPGQVLIRWSLQHGYLPLPKTRTVKRLEGNLAAYSFELSDEQMKTLDHPDAYE 272

Query: 297 GTKRIIDPDWE 307
            T      DWE
Sbjct: 273 PT------DWE 277

>Kpol_1013.82 s1013 complement(200564..201421) [858 bp, 285 aa] {ON}
           complement(200564..201421) [858 nt, 286 aa]
          Length = 285

 Score =  155 bits (392), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 103/314 (32%), Positives = 162/314 (51%), Gaps = 46/314 (14%)

Query: 5   LSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVG 64
           ++K     KL+ G +I ++GLGT+       A + V  AL+AGYRH DTA +YGNE EVG
Sbjct: 2   VNKVAKFYKLSNGYSIPSVGLGTYDIPNNVTA-NVVYEALKAGYRHFDTAVLYGNEEEVG 60

Query: 65  RAIRE------SGVPRGEIFVTTKLWCTQ--HKEPELALDQSLKRL-GLDYVDLYLMHWP 115
           + I            R  +F TTKLW +Q  +++   A+   L ++  L+Y+DL L+H P
Sbjct: 61  QGIHRWLLEDPENNRREAVFYTTKLWNSQNGYEKATKAIKNCLDKVKALEYIDLLLIHSP 120

Query: 116 VRMRGENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSIN 175
           +         G K+                   ++TW+ MQ+  + G  ++IGVSN+ ++
Sbjct: 121 LG--------GTKLR------------------LETWKAMQEAVDHGMVKSIGVSNYGMH 154

Query: 176 NLKDLLASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPV 235
           ++ +LL     K  P  NQ+E+ P L +QEL D+C    I +E YSPL       L +  
Sbjct: 155 HIDELLTWQYLKYKPVVNQIEISPWLMRQELADYCKSNSIFVECYSPLTHGYK--LNDQD 212

Query: 236 IIEIAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANL--LTFTLTSEDFEAVNNIS 293
           + ++A + G +  QV+I W++Q GYI LPK+    R++ NL    F LTS+    +++  
Sbjct: 213 LKKVANETGKNVGQVLIRWSLQHGYIPLPKTRTINRLKTNLDVYDFNLTSDQMTILDHPL 272

Query: 294 KVQGTKRIIDPDWE 307
             + T      DWE
Sbjct: 273 SYEPT------DWE 280

>Kwal_47.18893 s47 (1017098..1017967) [870 bp, 289 aa] {ON} YJR096W
           - Hypothetical ORF [contig 189] FULL
          Length = 289

 Score =  155 bits (392), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 102/309 (33%), Positives = 167/309 (54%), Gaps = 45/309 (14%)

Query: 14  LNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVG----RAIRE 69
           L  G  I  + LG +  A   +   +V  AL++GYRH+D A +YGNE EVG    + ++E
Sbjct: 11  LTNGVKIPVLALGVYE-APKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFLKE 69

Query: 70  S-GVPRGEIFVTTKLWCTQH--KEPELALDQSLKRLG-LDYVDLYLMHWPVRMRGENMPE 125
           +  V R EIF TTK+    H  ++ + ++ +SL+ +  ++Y+DL L+H P+    E +  
Sbjct: 70  TPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEERL-- 127

Query: 126 GDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDLLASPG 185
                                    TW+ +Q+    GK RAIGVSN+SI +L++L    G
Sbjct: 128 ------------------------GTWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEG 163

Query: 186 NKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIAKKN-- 243
            K+ P  NQ E++P L ++EL ++C  KG+V+EA+SPL         +P + E+ K +  
Sbjct: 164 LKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLTRGQK--FSDPQLQELIKTSYP 221

Query: 244 GVSAAQVVISWNVQRGYIVLPKSVNKERIEANL--LTFTLTSEDFEAVNNISKVQGTKRI 301
             + AQ++I W++Q G+I LPKS N +R  +NL  L F ++ +D +A+ +      T  +
Sbjct: 222 NQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKALTH----DDTYFL 277

Query: 302 IDPDWEPFK 310
              D++P K
Sbjct: 278 ATEDFDPIK 286

>TDEL0C03320 Chr3 (591171..592022) [852 bp, 283 aa] {ON} Anc_7.468
           YJR096W
          Length = 283

 Score =  154 bits (389), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 100/305 (32%), Positives = 164/305 (53%), Gaps = 46/305 (15%)

Query: 14  LNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVGRAIRE---- 69
           L+ G  I ++ LGT+    +T A + V  AL+ GYRH DTA +Y NE +VG  I +    
Sbjct: 9   LSNGVKIPSLALGTYDLPKSTTA-NIVYEALKCGYRHFDTAVLYNNERKVGEGIYQWLQE 67

Query: 70  --SGVPRGEIFVTTKLWCTQ--HKEPELALDQSLKRL-GLDYVDLYLMHWPVRMRGENMP 124
                 R ++F TTKLW +Q  ++  + A+ + L+++  L Y+DL L+H P+        
Sbjct: 68  DPKNNKREDVFYTTKLWNSQNGYQPAKQAIKECLQKVEKLGYIDLLLIHSPL-------- 119

Query: 125 EGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDLLASP 184
                      +G R         ++T++ MQ+  + G  ++IGVSN+  ++L++LL+  
Sbjct: 120 -----------SGSR-------KRLETYKAMQEAVDEGIVKSIGVSNYGQHHLEELLSWE 161

Query: 185 GNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIAKKNG 244
           G K  P  NQ+E+ P   +QEL  +C  +GIV+E Y+PL       LK+P ++++A++ G
Sbjct: 162 GLKYKPVVNQIEISPWCMRQELAQWCQSQGIVVEDYAPLTHGYK--LKDPQLVKVAEEVG 219

Query: 245 VSAAQVVISWNVQRGYIVLPKSVNKERIEANL--LTFTLTSEDFEAVNNISKVQGTKRII 302
            +  QV+I W++Q GY+ LPK+ N +R+  NL    F LT    +A  +    + T    
Sbjct: 220 KNTGQVLIRWSLQHGYLPLPKTSNVDRLPGNLDVYDFKLTESQIKAFEHPEAHEPT---- 275

Query: 303 DPDWE 307
             DWE
Sbjct: 276 --DWE 278

>Kwal_55.21536 s55 complement(877191..878180) [990 bp, 329 aa] {ON}
           YHR104W (GRE3) - a keto-aldose reductase [contig 128]
           FULL
          Length = 329

 Score =  153 bits (386), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 104/319 (32%), Positives = 168/319 (52%), Gaps = 38/319 (11%)

Query: 5   LSKNTSLLKLNTGATIRAIGLGTWR---SAAATDAYDSVIAALRAGYRHIDTAAIYGNEA 61
           ++  +  +KLN G  +  +GLG W+      A+  Y+    A++ GYR  D A  YGNE 
Sbjct: 1   MTYTSETVKLNNGLQMPLVGLGCWKIPNEVCASQVYE----AIKLGYRLFDGAQDYGNEK 56

Query: 62  EVG----RAIRESGVPRGEIFVTTKLWCTQH--KEPELALDQSLKRLGLDYVDLYLMHWP 115
           EVG    +AI E  V R ++FV +KLW + H  K  + AL ++L+ + L+Y+DL+ +H+P
Sbjct: 57  EVGQGIHKAIDEGIVKREDLFVVSKLWNSYHDPKNVKKALKRTLEDMELEYLDLFYIHFP 116

Query: 116 VRMRGENMPEGDKIGFPTLPNGKRD-----IDITDWNFVKTWELMQKLPETGKTRAIGVS 170
           +  +     E    GF T   G  D     I +     + T+  +++  + G  ++IG+S
Sbjct: 117 LAFKYVPFEEKYPPGFYT---GAEDAKKGVISLEQVPIIDTYRALEECVKEGLIKSIGIS 173

Query: 171 NFSINNLKDLLASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLG-----S 225
           NF    + DLLA  G  I P   Q+E HP L Q++L+++C  + I + AYS  G      
Sbjct: 174 NFRGILIHDLLA--GATIKPVCLQIEHHPYLTQEKLIEYCAQEQIQVVAYSSFGPQSFLE 231

Query: 226 ADAPILKE-PVIIE------IAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLT 278
            D+ + K  P + E      IA  +GVS++QV++ W  QR   ++PKS  KER+  NL  
Sbjct: 232 LDSELAKSTPTLFEHEGIQKIATNHGVSSSQVLLRWATQRRIAIIPKSSKKERLLDNLQI 291

Query: 279 ---FTLTSEDFEAVNNISK 294
               TLT  + + ++ ++K
Sbjct: 292 NEKLTLTEAELQEISALNK 310

>CAGL0C04543g Chr3 (434137..435000) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096w
          Length = 287

 Score =  151 bits (381), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 90/276 (32%), Positives = 155/276 (56%), Gaps = 38/276 (13%)

Query: 13  KLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVGRAI----- 67
           +L  G  I ++ LGT+    +  A   V  AL+ GYRH DTA +YGNE EVG+ I     
Sbjct: 12  ELQDGRKIPSLALGTYDIPNSVTA-KVVTEALKCGYRHFDTAVLYGNEREVGQGIVNWIN 70

Query: 68  -RESGVPRGEIFVTTKLWCTQ--HKEPELALDQSLKRL-GLDYVDLYLMHWPVRMRGENM 123
             ++   R ++F TTKLW +Q  + E + A+ + ++++ GL Y+D+ L+H P+       
Sbjct: 71  EDKAHNKREDVFYTTKLWNSQNGYNEAKRAIKECMQKVSGLGYIDMLLIHSPL------- 123

Query: 124 PEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDLLAS 183
                       +G+R         ++TW+ MQ+  + G  ++IGVSN+  +++++LL  
Sbjct: 124 ------------SGQR-------RRLETWKAMQEAVDEGIVKSIGVSNYGKHHIEELLGW 164

Query: 184 PGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIAKKN 243
              K  P  NQ+E+ P + +QEL D+C    +V+EAY+P+  A    + +P + EI+K+ 
Sbjct: 165 DELKYKPVVNQIEISPWVMRQELADYCKSVNLVVEAYAPM--AHGYKMNDPGLREISKET 222

Query: 244 GVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTF 279
           G++  Q++I W++Q GY+ LPK+    R+ +NL  +
Sbjct: 223 GMNPGQLLIRWSLQHGYLPLPKTKTVARLASNLDVY 258

>KLTH0G02420g Chr7 complement(188767..189636) [870 bp, 289 aa] {ON}
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 289

 Score =  149 bits (377), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 102/320 (31%), Positives = 177/320 (55%), Gaps = 48/320 (15%)

Query: 1   MSATLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNE 60
           MS T S   +L     G  I  +G GT+ +     A   V AA + GYRH+DTA +Y NE
Sbjct: 1   MSITASTTKTL---TNGVKIPVLGFGTYETPKE-KAESIVHAAFKQGYRHVDTAQLYENE 56

Query: 61  AE----VGRAIRES-GVPRGEIFVTTKLWCTQH--KEPELALDQSLKRLG-LDYVDLYLM 112
            E    V + ++ES  V R ++F TTK+    H  ++ + ++ +SL+    L+YVDL+L+
Sbjct: 57  RECATAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLI 116

Query: 113 HWPVRMRGENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNF 172
           H P                      KR         + T++ +Q+  + GK +AIGVS++
Sbjct: 117 HNPC-----------------AETEKR---------LGTYKALQEFYKAGKIKAIGVSSY 150

Query: 173 SINNLKDLLASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILK 232
           SI +L++L +  G ++ P  NQ E++P L +++LV +C  + +VIEA+SP+  +      
Sbjct: 151 SIKHLEELYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPITRSKR--FS 208

Query: 233 EPVIIEIAKKN--GVSAAQVVISWNVQRGYIVLPKSVNKERIEANL--LTFTLTSEDFEA 288
           +PV+ ++ K++  G + AQ++I W++Q G++ LPKSV+++R E+NL  L F +++ED + 
Sbjct: 209 DPVVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKT 268

Query: 289 VNNISKVQGTKRIIDPDWEP 308
           + +     G   +  P ++P
Sbjct: 269 LTH----DGEHFLAQPGFDP 284

>KLLA0F05775g Chr6 (560270..561199) [930 bp, 309 aa] {ON} highly
           similar to uniprot|Q07551 Saccharomyces cerevisiae
           YDL124W NADPH-dependent alpha-keto amide reductase
           reduces aromatic alpha-keto amides aliphatic alpha-keto
           esters and aromatic alpha-keto esters
          Length = 309

 Score =  149 bits (375), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 102/310 (32%), Positives = 161/310 (51%), Gaps = 58/310 (18%)

Query: 11  LLKLNTGATIRAI---GLGT-WRSAAATDA------YDSVIAALRA--GYRHIDTAAIYG 58
              L+ G  I A+   G GT W  +  TDA       D V   L    G  HID A IY 
Sbjct: 6   FFTLSNGNKIPAVAIVGTGTAWYKSEETDATFSQPLVDIVKKTLDTVPGVVHIDAAEIYR 65

Query: 59  NEAEVGRAIRESGVPRGEIFVTTKLWCTQH--KEPELALDQSLKRLGLDYVDLYLMHWPV 116
              E+G A++++  PR EIF+T K    +   + P++AL+ SLK+LG+DYVDLYL+H P+
Sbjct: 66  TYPELGAALKDTKKPRDEIFITDKYSTLKQLSENPKVALETSLKKLGVDYVDLYLLHSPI 125

Query: 117 RMRGENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINN 176
                            +   K D++         W+ +++L ++GK + IGVSNF++ +
Sbjct: 126 -----------------IKESKLDVE-------ANWKYLEELYKSGKAKNIGVSNFAVKD 161

Query: 177 LKDLLASPGNKIVPAANQVEMHPLLPQQE--LVDFCHGKGIVIEAYSPLGSADAPILKEP 234
           L+ LLA    ++ P  NQ+E  P L  Q   +V+F    GI++EAYSPLG    P+ + P
Sbjct: 162 LEKLLAVA--EVKPQVNQIEFSPFLQNQTPGIVEFSQKNGILLEAYSPLG----PLQRRP 215

Query: 235 ----------VIIEIAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIE--ANLLTFTLT 282
                      I E++KK   S AQ+++SW  +RG + +  S   ERI+   ++ +F+L 
Sbjct: 216 EDADKLPFYQYIAELSKKYNKSEAQILLSWVYERGILPVTTSSKIERIQQAQDIFSFSLA 275

Query: 283 SEDFEAVNNI 292
           +E+ + +  +
Sbjct: 276 NEEVQKITQL 285

>ZYRO0G17600g Chr7 (1455426..1456277) [852 bp, 283 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 283

 Score =  147 bits (372), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 99/305 (32%), Positives = 159/305 (52%), Gaps = 52/305 (17%)

Query: 17  GATIRAIGLGTW---RSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVGRAIRE---- 69
           G  I ++ LG +   RS  A   Y+    AL+ GYRH DTA +YGNE EVG  I +    
Sbjct: 12  GIKIPSLALGCYDIPRSQTANVVYE----ALKRGYRHFDTAVLYGNEKEVGEGIYKWLKE 67

Query: 70  --SGVPRGEIFVTTKLWCTQ--HKEPELALDQSLKRLG-LDYVDLYLMHWPVRMRGENMP 124
             +   R ++F TTKLW +Q  +   +  + + + ++  L Y+DL L+H P+        
Sbjct: 68  DPANNKREDVFYTTKLWNSQNGYSPAKRGISECMNKVKELGYIDLLLIHSPL-------- 119

Query: 125 EGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDLLASP 184
                      +G R         ++T++ MQ+  + G  ++IGVSN+   ++++L    
Sbjct: 120 -----------SGPR-------RRLETYQAMQEAVDDGIVKSIGVSNYGKQHIEELYKWD 161

Query: 185 GNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIAKKNG 244
             K  P ANQ+E+ P   +++L  +C  KG+++EA+SPL       LKEP ++ +AKK G
Sbjct: 162 KLKHKPVANQIEISPWCMREDLTSWCQSKGLIVEAFSPLTHGYK--LKEPGLVSLAKKLG 219

Query: 245 VSAAQVVISWNVQRGYIVLPKSVNKERIEANL--LTFTLTSEDFEAVNNISKVQGTKRII 302
               QV+I W++QRG + LPK+ N  R+ +NL    F LT ED + +++    + T    
Sbjct: 220 RDTGQVLIRWSLQRGLLPLPKTQNPARLSSNLEVYDFELTPEDVKELDHPEAYEPT---- 275

Query: 303 DPDWE 307
             DWE
Sbjct: 276 --DWE 278

>ABL209C Chr2 complement(11410..12342) [933 bp, 310 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR096W
          Length = 310

 Score =  143 bits (360), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 92/295 (31%), Positives = 150/295 (50%), Gaps = 39/295 (13%)

Query: 7   KNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVGRA 66
           ++    +L+ G  I ++GLG ++ +  T   D V  AL  GYR  D+A  Y NE  V R 
Sbjct: 8   EDCHFRRLSDGTQIPSVGLGVYQVSEQT-VQDLVYEALEVGYRLFDSAQAYHNEDGVARG 66

Query: 67  I-----RESGVPRGEIFVTTKLWCTQH--KEPELALDQSLKRLG-LDYVDLYLMHWPVRM 118
           I        G  R +++ TTK+    H  +  + +L++SL   G L Y+DL L+H P+  
Sbjct: 67  IAAWLKHAPGRRREDVYFTTKINTQNHGYEATKKSLEKSLHAAGPLGYIDLVLVHAPMSD 126

Query: 119 RGENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLK 178
           R   +                           TW+ +++    G+ R+IGVSN+   +L 
Sbjct: 127 RTRRL--------------------------GTWQALEEAVVEGQVRSIGVSNYGQQHLS 160

Query: 179 DLLASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIE 238
           +LL   G KI P  NQVE++P L +QELV +C    I ++A+SPL       L +P++ +
Sbjct: 161 ELLGWEGLKIRPVVNQVEINPWLCRQELVQYCRENNIAVQAFSPLMRGKR--LDDPILQK 218

Query: 239 IAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEAN--LLTFTLTSEDFEAVNN 291
           +A +     AQ+++ W++Q G+IVLPK+  KER+  N  +  F L++E    + +
Sbjct: 219 VAHQYDKGVAQILVRWSIQMGFIVLPKAAKKERLAPNFDIWDFELSAETMSELTH 273

>Kpol_1020.13 s1020 (27790..28731) [942 bp, 313 aa] {ON}
           (27790..28731) [942 nt, 314 aa]
          Length = 313

 Score =  143 bits (360), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 106/325 (32%), Positives = 158/325 (48%), Gaps = 56/325 (17%)

Query: 5   LSKNTSLLKLNTG---ATIRAIGLGT-W--RSAAATDAYDSVIAALRA-----GYRHIDT 53
           +S       LN G    +I  IG GT W  R  +     D ++  ++      G  HID 
Sbjct: 1   MSLTQKFFDLNNGNQIPSISIIGTGTRWFKRPGSEHTFSDELVEQIKYALSLPGIIHIDA 60

Query: 54  AAIYGNEAEVGRAIRESGVPRGEIFVTTKLWCTQHK---EPELALDQSLKRLGLDYVDLY 110
           A  YG   E+ +A++ES  PR EIF+T K + TQ K   +P   L+  LK LGLDYVDLY
Sbjct: 61  AECYGTYPELAKALKESSKPRSEIFITDK-YSTQTKFTNDPIEGLNTGLKTLGLDYVDLY 119

Query: 111 LMHWPVRMRGENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVS 170
           L+H P                   P  K  + +      K W+ M+ L + GK ++IGVS
Sbjct: 120 LIHSPFFD----------------PEFKGSLTLE-----KVWKDMETLYKEGKAKSIGVS 158

Query: 171 NFSINNLKDLLASPGNKIVPAANQVEMHPLLPQQE--LVDFCHGKGIVIEAYSPLGSADA 228
           NFS+ N++++L   G  I P  NQ+E +  L  Q   +V++C    I +EAYSPLG    
Sbjct: 159 NFSVKNIEEILKIAG--IKPQVNQIEFNAFLQNQTPGIVNYCQKNNIQLEAYSPLG---- 212

Query: 229 PILKEP----------VIIEIAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERI--EANL 276
           P+ K P           I E+A K G + +Q++++W   RG + +  S   +RI    N+
Sbjct: 213 PLQKRPENSNELPFYNYIDELASKYGKTDSQILLNWVYNRGILPITTSSKTQRIIDAQNI 272

Query: 277 LTFTLTSEDFEAVNNISKVQGTKRI 301
            +F LT ++ + +  +   Q   RI
Sbjct: 273 FSFNLTKDEVDTLTKLGLEQPALRI 297

>Kwal_33.13276 s33 (153537..154445) [909 bp, 302 aa] {ON} YDL124W -
           Hypothetical ORF [contig 119] FULL
          Length = 302

 Score =  142 bits (359), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 101/292 (34%), Positives = 153/292 (52%), Gaps = 49/292 (16%)

Query: 1   MSATLSKN-TSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGN 59
           M+ T+  N  +  KLN G  I  IG G +      D  D V +AL+ GYRHIDTA +Y N
Sbjct: 1   MAHTIDINRETRYKLNNGQQIPVIGFGVY-EIPKEDTADLVYSALKDGYRHIDTAVLYKN 59

Query: 60  EAEVGRAIR----ESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLD------YVDL 109
           + E  + +R    E+G  R  I+ TTKLW +Q    E   +++L+ +  D      YVDL
Sbjct: 60  QKEAAQGVRKYLDETGEARENIWFTTKLWDSQFGREET--EKALQEVAADVKEYIGYVDL 117

Query: 110 YLMHWPVRMRGENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELM-QKLPETG----KT 164
            L+H P   RG                 KR ++        TW ++ Q + E G    + 
Sbjct: 118 LLLHSP---RG---------------GAKRRLE--------TWAILEQAVQEPGSKALEI 151

Query: 165 RAIGVSNFSINNLKDLLASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLG 224
           ++IGVSNF +++L++LL     K+ P  +Q+E+HP LP+ EL  +   K I  EAYSPL 
Sbjct: 152 KSIGVSNFGVDHLEELLKVA--KVKPVLDQLELHPWLPRVELRKYLKEKDIFAEAYSPLT 209

Query: 225 SADAPILKEPVIIEIAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANL 276
                 L++P ++ +  K G++ A +++ W+  +G++VL KS N ERI  NL
Sbjct: 210 QGYR--LQDPELLALEAKTGINKAVILLRWSFLQGFVVLVKSSNPERIRQNL 259

>Smik_4.113 Chr4 (216885..217823) [939 bp, 312 aa] {ON} YDL124W
           (REAL)
          Length = 312

 Score =  142 bits (357), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 107/312 (34%), Positives = 155/312 (49%), Gaps = 52/312 (16%)

Query: 8   NTSLLKLNTGATIRAI---GLGT-WRSAAATDA------YDSVIAALR-AGYRHIDTAAI 56
           N   + LN G  I AI   G GT W     TDA       + ++ AL+  G  HID A I
Sbjct: 4   NQQFITLNNGNKIPAIAIIGTGTRWYKEEETDATFSNSLVEQIVYALKLPGIIHIDAAEI 63

Query: 57  YGNEAEVGRAIRESGVPRGEIFVTTKLWCTQHK---EPELALDQSLKRLGLDYVDLYLMH 113
           Y    EVG+A+  +  PR EIF+T K + TQ K    P + LD +LK++G DYVDLYL+H
Sbjct: 64  YRTYPEVGKALSLTEKPRNEIFLTDK-YSTQIKVSESPAVGLDIALKKMGTDYVDLYLLH 122

Query: 114 WPVRMRGENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFS 173
            P   +  N       GF                  + W+ M++L  +GK + IGVSNF+
Sbjct: 123 SPFVSKETN-------GF---------------TLEEAWKDMEQLYRSGKAKNIGVSNFA 160

Query: 174 INNLKDLLASPGNKIVPAANQVEMHPLLPQQE--LVDFCHGKGIVIEAYSPLGSADAPIL 231
           + +L+ +L     +I P  NQ+E  P L  Q   +  FC    I++EAYSPLG       
Sbjct: 161 MKDLERILKVA--EIRPQVNQIEFSPFLQNQTPGIYKFCQENDILLEAYSPLGPLQKRTT 218

Query: 232 KE------PVIIEIAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIE--ANLLTFTLTS 283
           K+        + E+++K   S AQ+ + W  +RG + +  S   +RI    NL +F LT 
Sbjct: 219 KDESLPFFEYVKELSEKYIKSEAQITLRWVTRRGVLPVTTSSKPQRISDAQNLFSFDLTD 278

Query: 284 EDFEAVNNISKV 295
           E+   VN I+++
Sbjct: 279 EE---VNQITEL 287

>KLTH0F01892g Chr6 (149177..150085) [909 bp, 302 aa] {ON} similar to
           uniprot|P47137 Saccharomyces cerevisiae YJR096W
          Length = 302

 Score =  142 bits (357), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 94/279 (33%), Positives = 144/279 (51%), Gaps = 48/279 (17%)

Query: 13  KLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAE----VGRAIR 68
           KLN G  +  IG G +      +    V  AL+ GYRHIDTA +Y N+ +    V R + 
Sbjct: 14  KLNNGTEVPVIGFGVY-DIPVEETAQRVYTALQEGYRHIDTAVVYENQKQAAQGVHRFLE 72

Query: 69  ESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLD------YVDLYLMHWPVRMRGEN 122
           E+G PR E++ TTKLW TQ      A  ++L+ +  D      YVDL L+H P       
Sbjct: 73  ETGTPREEVWFTTKLWNTQQGRD--ATPRALEEIAADVKEFIGYVDLLLLHSP------- 123

Query: 123 MPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKT-----RAIGVSNFSINNL 177
                      L + +R ++        TW ++++  +   +     RAIGVSNF + +L
Sbjct: 124 -----------LTDAQRRLE--------TWAVLERAVQEPASSALEIRAIGVSNFGVRHL 164

Query: 178 KDLLASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVII 237
           ++LL     K  P  +Q+E+HP LP+ EL  F    GI+ EAYSPL       L++P ++
Sbjct: 165 QELLEVATVK--PVVDQLELHPWLPRAELRAFLRENGILAEAYSPL--TQGVRLQDPELL 220

Query: 238 EIAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANL 276
            +  K+G+S  ++++ W+  +G+ VL KS N +RI  NL
Sbjct: 221 ALEAKSGLSKGEILLRWSFLQGFAVLVKSNNPQRIRDNL 259

>NCAS0A13740 Chr1 complement(2699208..2700137) [930 bp, 309 aa] {ON}
           Anc_7.285
          Length = 309

 Score =  140 bits (354), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 110/314 (35%), Positives = 151/314 (48%), Gaps = 53/314 (16%)

Query: 11  LLKLNTGATIRAI---GLGT-WRSAAATDA------YDSVIAALRA-GYRHIDTAAIYGN 59
              LN G  I AI   G GT W     TDA       D +  AL   G  HID A IY  
Sbjct: 7   FFTLNNGNKIPAIAVIGTGTRWFKTEETDATFSQQLVDELKVALTLPGIVHIDAAEIYRT 66

Query: 60  EAEVGRAIRESGVPRGEIFVTTKLWCTQHK---EPELALDQSLKRLGLDYVDLYLMHWPV 116
             EV  A+RES  PR EIF+T K + TQ K   +P   L+ SLK LGLDYVDLYL+H P 
Sbjct: 67  YPEVAAALRESNRPRDEIFITDK-YSTQLKLSDDPIAGLNISLKTLGLDYVDLYLLHSPF 125

Query: 117 RMRGENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINN 176
              G  + E                          W+ M+KL ++GK + IGVSNF + +
Sbjct: 126 IKNGSTLEE-------------------------CWKQMEKLYKSGKAKNIGVSNFRVED 160

Query: 177 LKDLLASPGNKIVPAANQVEMHPLLPQQE--LVDFCHGKGIVIEAYSPLGS----ADAPI 230
           L+ +L      I P  NQ+E +  L  Q   +V FC    I +EAY+PLG      D P 
Sbjct: 161 LEKILKIAT--IKPQINQIEFNAALQNQSPGIVKFCKENNIQLEAYTPLGPFQRIQDTPE 218

Query: 231 LK--EPVIIEIAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIE--ANLLTFTLTSEDF 286
            K     I E++KK   + AQ+++ W  +RG + +  S   +R+    NL +F L S + 
Sbjct: 219 AKPFYDYIAELSKKYNKTEAQILLRWVTKRGILPVTTSSKPQRLHDAQNLFSFDLESSEV 278

Query: 287 EAVNNIS-KVQGTK 299
           + +  +  K++ T+
Sbjct: 279 DKITELGLKLKATR 292

>NDAI0A02300 Chr1 (516594..517535) [942 bp, 313 aa] {ON} Anc_7.285
          Length = 313

 Score =  139 bits (349), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 106/325 (32%), Positives = 154/325 (47%), Gaps = 56/325 (17%)

Query: 5   LSKNTSLLKLNTGATIRAI---GLGT-WRSAA------ATDAYDSVIAALR-AGYRHIDT 53
           +S +     LN G  I AI   G GT W          + +  D +  AL   G  HID 
Sbjct: 1   MSFSQEFFTLNNGNKIPAISIIGTGTKWHHGKLESGKFSDELVDQLQYALTLPGIIHIDA 60

Query: 54  AAIYGNEAEVGRAIRESGVPRGEIFVTTKLWCTQHK---EPELALDQSLKRLGLDYVDLY 110
           A +Y    EV +A++ +   R EIF+T K +    K    P   L +SLK L LDYVDLY
Sbjct: 61  AEMYNTYPEVNKALKSTSKVRDEIFITDKYYSGSPKLTENPIAGLTKSLKELELDYVDLY 120

Query: 111 LMHWPVRMRGENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVS 170
           L+H P   +                      +   +   + W+ M+KL + GK + IGVS
Sbjct: 121 LLHSPFITK----------------------ESCGYTMEEAWKQMEKLYKDGKAKNIGVS 158

Query: 171 NFSINNLKDLLASPGNKIVPAANQVEMHPLLPQQE--LVDFCHGKGIVIEAYSPLGSADA 228
           NFS+++LK +L     +I P  NQ+E +  L  Q   +V FC    I++EAYSPLG    
Sbjct: 159 NFSVDDLKRILKI--CEIKPQINQIEFNAFLQNQTPGIVKFCQDHDILVEAYSPLG---- 212

Query: 229 PILKEPV----------IIEIAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIE--ANL 276
           P+ K+P           I E+AKK G S  QV++ W  +R  + +  S  +ERI+   +L
Sbjct: 213 PLRKKPTDRDPGPFYQYIEELAKKYGKSEGQVLLRWVTKRKILPITTSGKEERIKDAQDL 272

Query: 277 LTFTLTSEDFEAVNNISKVQGTKRI 301
            +F LTSE+ E +  +       R+
Sbjct: 273 FSFDLTSEEVEKITKLGLAHEPSRL 297

>Skud_4.131 Chr4 (235946..236884) [939 bp, 312 aa] {ON} YDL124W
           (REAL)
          Length = 312

 Score =  137 bits (344), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 104/316 (32%), Positives = 155/316 (49%), Gaps = 57/316 (18%)

Query: 5   LSKNTSLLKLNTGATIRAI---GLGT-WRSAAATDA------YDSVIAALR-AGYRHIDT 53
           +S +   + LN G  I AI   G GT W     TDA       + ++ AL   G  HID 
Sbjct: 1   MSFHQKFIVLNNGNKIPAIAIIGTGTRWFKNVETDATFSNSLVEQIMYALELPGIVHIDA 60

Query: 54  AAIYGNEAEVGRAIRESGVPRGEIFVTTKLWCTQHK---EPELALDQSLKRLGLDYVDLY 110
           A IY    EVG+A+  +  PR EIF+T K + TQ K    P   L+ SLK++G DYVDLY
Sbjct: 61  AEIYRTYPEVGKALSLTKKPRDEIFLTDK-YSTQIKVSDSPAAGLEVSLKKMGTDYVDLY 119

Query: 111 LMHWPVRMRGENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVS 170
           L+H P   +  N       GF                  + W+ M++L + GK + IGVS
Sbjct: 120 LLHSPFVSKEAN-------GF---------------TLEEAWKDMEQLYKAGKAKNIGVS 157

Query: 171 NFSINNLKDLLASPGNKIVPAANQVEMHPLLPQQE--LVDFCHGKGIVIEAYSPLGSADA 228
           NF++ +L+ +L     ++ P  NQ+E  P L  Q   +  FC    I++EAYSPL    A
Sbjct: 158 NFAVKDLEKILKIA--EVKPQVNQIEFSPFLQNQTPGIYKFCQDNNILLEAYSPL----A 211

Query: 229 PILKEPV----------IIEIAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIE--ANL 276
           P+ K+            + E+++K   S AQ+++ W  +RG + +  S   +RI    NL
Sbjct: 212 PLQKKTAQDDSKPFFEYVKELSEKYFKSEAQIILRWVSKRGVLPVTTSSKPQRISDAQNL 271

Query: 277 LTFTLTSEDFEAVNNI 292
            +F LT E+ + +  +
Sbjct: 272 FSFDLTDEEVDEITEL 287

>Kwal_47.19278 s47 complement(1169418..1170362) [945 bp, 314 aa]
           {ON} YDL124W - Hypothetical ORF [contig 344] FULL
          Length = 314

 Score =  136 bits (343), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 96/316 (30%), Positives = 157/316 (49%), Gaps = 55/316 (17%)

Query: 6   SKNTSLLKLNTGATIRAIGLGT---WRSAAA---------TDAYDSVIAALRAGYRHIDT 53
           SK  +L    +G  I  IG G+   WR A A         T+  D V +A+ AG+ HID 
Sbjct: 3   SKIPTLRLKGSGDEIPIIGFGSGTKWRIAKASGEKKDQFITELADQVTSAINAGFNHIDA 62

Query: 54  AAIYGNEAEVGRAIRESGVPRGEIFVTTKL--WCTQHKE---PELALDQSLKRLGLDYVD 108
           A  Y    EVGR ++ SGVPR ++++T K   W    ++   P  +L  SL+++ + YVD
Sbjct: 63  AEAYKTHPEVGRGVKNSGVPRDKLWITDKYTPWSWDWRKGTGPLESLSLSLEKMQMSYVD 122

Query: 109 LYLMHWPVRMRGENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIG 168
           LYL+H P               F T+     D+        + W  M+++ + G  + IG
Sbjct: 123 LYLLHVP---------------FITVQTAGIDLK-------EAWRQMEEIYDRGLAKNIG 160

Query: 169 VSNFSINNLKDLLASPGNKIVPAANQVEMHPLLPQQE--LVDFCHGKGIVIEAYSPLGSA 226
           VSNF + +L+ +  +   K +P  NQ+E +  L QQ   ++ +C    IV+E YSPL   
Sbjct: 161 VSNFDVESLEYI--TKIGKYLPVVNQIEFNAYLQQQSPGIIAYCKDHDIVVEGYSPL--- 215

Query: 227 DAPILK------EPVIIEIAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIE--ANLLT 278
             P+ K      + ++  +A+K   S  Q+++ W  Q G +V+  S  + R++   N+  
Sbjct: 216 -VPLTKGRPGPLDKLLPALAEKYHKSELQILLRWVTQNGVVVITTSAQQARVKESVNIFD 274

Query: 279 FTLTSEDFEAVNNISK 294
           F LT+EDF+++  I +
Sbjct: 275 FELTAEDFDSITKIGR 290

>ZYRO0E09614g Chr5 complement(765913..766839) [927 bp, 308 aa] {ON}
           similar to uniprot|Q07551 Saccharomyces cerevisiae
           YDL124W NADPH-dependent alpha-keto amide reductase
           reduces aromatic alpha-keto amides aliphatic alpha-keto
           esters and aromatic alpha-keto esters
          Length = 308

 Score =  135 bits (339), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 100/312 (32%), Positives = 144/312 (46%), Gaps = 69/312 (22%)

Query: 15  NTGATIRAIGLGT---WRSAAAT---------DAYDSVIAALRAGYRHIDTAAIYGNEAE 62
            T   I  +G GT   WR A               D ++ A+  G+ HIDTA  Y    E
Sbjct: 13  ETHTHIPVLGFGTGTQWRIAKREGETKGQFIDKLVDQLVTAVDLGFNHIDTAEFYLTHEE 72

Query: 63  VGRAIRESGVPRGEIFVTTK--------LWCTQHKEPELALDQSLKRLGLDYVDLYLMHW 114
           VG A+R S +PR ++F+T K        L C+    P  A  + L+ LG+ Y DLY++H 
Sbjct: 73  VGEALRRSQLPRDKLFITDKYNQGAWTGLDCSG---PIQAAKKGLEALGIKYFDLYMLHR 129

Query: 115 PVRMRGENMPEGDKIGFPTLPNGKRDIDITDWN----FVKTWELMQKLPETGKTRAIGVS 170
           P                          DIT  N      + W  +++L E G  +AIGVS
Sbjct: 130 P--------------------------DITKENAGIDLQEAWRQVEELYEAGIAKAIGVS 163

Query: 171 NFSINNLKDLLASPGNKIVPAANQVEMHPLLPQQE--LVDFCHGKGIVIEAYSPLGSADA 228
           NF +  LK + +    + +P  +QVE HP L  Q   +V++C  K IV+EAYSPL    A
Sbjct: 164 NFPLETLKQMESY--CRYLPMVHQVEFHPYLQNQSPGVVEWCQNKHIVVEAYSPL----A 217

Query: 229 PILK------EPVIIEIAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANL--LTFT 280
           P+ +      + ++  + KK G S  Q+V+ W + RG + L  S  +ERI   L  L F 
Sbjct: 218 PLFRARPGPLDDILPNLMKKYGKSETQIVLRWVIDRGIVALTTSSKEERIHEILGTLDFE 277

Query: 281 LTSEDFEAVNNI 292
           L   D E +N +
Sbjct: 278 LEKSDVELINEV 289

>Kpol_381.8 s381 complement(20844..21359,21366..21695,21698..21781)
           [930 bp, 309 aa] {ON}
           complement(20844..21359,21366..21695,21698..21781) [930
           nt, 310 aa]
          Length = 309

 Score =  134 bits (338), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 110/333 (33%), Positives = 161/333 (48%), Gaps = 63/333 (18%)

Query: 5   LSKNTSLLKLNTGATIRA---IGLGT-WRSAA-----ATDAYDSVIAALRA-GYRHIDTA 54
           +S N     LN G  IRA   IG GT W++ A     + +  D    AL   G  H+D A
Sbjct: 1   MSLNQQFFTLNNGNKIRAVAIIGTGTKWKTEAQAHLLSNELVDQAKFALSLPGIVHVDAA 60

Query: 55  AIYGNEAEVGRAIRESGVPRGEIFVTTKLWCTQHK---EPELALDQSLKRLGLDYVDLYL 111
             Y    E+ +A++ES  PR EIF+T K + T  K    P  AL+ +L  LGLDYVDLY+
Sbjct: 61  EYYRTYPELNKALKESSKPRNEIFITDK-FSTLLKITANPIEALNTALDSLGLDYVDLYV 119

Query: 112 MHWPVRMRGENMPEGDKIGFPTLPNGKRDIDI-TDWNFVKTWELMQKLPETGKTRAIGVS 170
           +H+P     E  PE             +D+ I T W        M+ L + GK + IGVS
Sbjct: 120 LHFP-----EFDPE------------YKDLSIETAW--------MELLYKEGKAKNIGVS 154

Query: 171 NFSINNLKDLLASPGNKIVPAANQVEMHPLLPQQE--LVDFCHGKGIVIEAYSPLGSADA 228
           NFSI +L+ ++     K  P  NQ+E +  L  Q   +V +C   G  +EAYSPL    A
Sbjct: 155 NFSIEHLERVMKIADVK--PQVNQIEFNAFLQNQTPGIVKYCQQNGFQLEAYSPL----A 208

Query: 229 PILKEP----------VIIEIAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERI--EANL 276
           P+ ++P           I E++ K G + +++++ W  +RG + +  S   ERI    NL
Sbjct: 209 PLQRKPKNFNELPFYKYIDEVSAKYGKTDSEILLRWVTKRGIVPITTSSRHERIVNAQNL 268

Query: 277 LTFTLTSEDFEAVNNISKVQGTKRIIDPDWEPF 309
            +F LT E+ + +  +   Q   R+    W  F
Sbjct: 269 FSFDLTDEEVDKITKLGLEQPALRLY---WNEF 298

>YDL124W Chr4 (240259..241197) [939 bp, 312 aa] {ON} NADPH-dependent
           alpha-keto amide reductase; reduces aromatic alpha-keto
           amides, aliphatic alpha-keto esters, and aromatic
           alpha-keto esters; member of the aldo-keto reductase
           (AKR) family
          Length = 312

 Score =  134 bits (338), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 97/312 (31%), Positives = 153/312 (49%), Gaps = 49/312 (15%)

Query: 5   LSKNTSLLKLNTGATIRAI---GLGT-WRSAAATDA------YDSVIAALR-AGYRHIDT 53
           +S +     LN G  I AI   G GT W     TDA       + ++ AL+  G  HID 
Sbjct: 1   MSFHQQFFTLNNGNKIPAIAIIGTGTRWYKNEETDATFSNSLVEQIVYALKLPGIIHIDA 60

Query: 54  AAIYGNEAEVGRAIRESGVPRGEIFVTTKLWCTQHK---EPELALDQSLKRLGLDYVDLY 110
           A IY    EVG+A+  +  PR  IF+T K +  Q K    P   LD +LK++G DYVDLY
Sbjct: 61  AEIYRTYPEVGKALSLTEKPRNAIFLTDK-YSPQIKMSDSPADGLDLALKKMGTDYVDLY 119

Query: 111 LMHWPVRMRGENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVS 170
           L+H P   +                      ++   +  + W+ M++L ++GK + IGVS
Sbjct: 120 LLHSPFVSK----------------------EVNGLSLEEAWKDMEQLYKSGKAKNIGVS 157

Query: 171 NFSINNLKDLLASPGNKIVPAANQVEMHPLLPQQE--LVDFCHGKGIVIEAYSPLGSADA 228
           NF++ +L+ +L     ++ P  NQ+E  P L  Q   +  FC    I++EAYSPLG    
Sbjct: 158 NFAVEDLQRILKVA--EVKPQVNQIEFSPFLQNQTPGIYKFCQEHDILVEAYSPLGPLQK 215

Query: 229 PILKE------PVIIEIAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIE--ANLLTFT 280
              ++        + E+++K   S AQ+++ W  +RG + +  S   +RI    NL +F 
Sbjct: 216 KTAQDDSQPFFEYVKELSEKYIKSEAQIILRWVTKRGVLPVTTSSKPQRISDAQNLFSFD 275

Query: 281 LTSEDFEAVNNI 292
           LT+E+ + +  +
Sbjct: 276 LTAEEVDKITEL 287

>KAFR0B01200 Chr2 (224411..225358) [948 bp, 315 aa] {ON} Anc_7.285
           YDL124W
          Length = 315

 Score =  132 bits (332), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 104/311 (33%), Positives = 153/311 (49%), Gaps = 56/311 (18%)

Query: 9   TSLLKLNTGATIRAIGLGT-WRSAAAT------DAYDSVIAALRA-GYRHIDTAAIYGNE 60
           T+L   N   +I  IG GT W     T      +  D +  AL   G  HID A +Y   
Sbjct: 9   TTLNNGNKMPSIAIIGTGTAWYKTEETPETFSQELVDQIKYALTLPGIVHIDAAEVYRTY 68

Query: 61  AEVGRAIRESG--VPRGEIFVTTKLWCTQHK---EPELALDQSLKRLGLDYVDLYLMHWP 115
            EVG+A+RES    PR EIF+T K + TQ K    P + L   LK+LGLDYVDLYL+H P
Sbjct: 69  PEVGKALRESHNVKPRDEIFITDK-YSTQLKISENPMVGLTNGLKKLGLDYVDLYLLHSP 127

Query: 116 VRMRGENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSIN 175
              + +N       GF                  + W+ M+ L + GK + IGVSNFS+ 
Sbjct: 128 FISKEKN-------GF---------------TMEEAWKYMEDLYKAGKVKNIGVSNFSMA 165

Query: 176 NLKDLLASPGNKIVPAANQVEMHPLLPQQE--LVDFCHGKGIVIEAYSPLGSADAPILKE 233
           +L+ +L S   ++ P  NQ+E +  L  Q   +V+FC    I + AY+PLG    P+ ++
Sbjct: 166 DLQRILKSC--EVKPQVNQIEFNAFLQNQTPGIVNFCRENDIQVVAYTPLG----PLQRK 219

Query: 234 P----------VIIEIAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIE--ANLLTFTL 281
                       + ++A+K   S AQ+++ W  +RG I +  S  ++RI+    L TF L
Sbjct: 220 SKNFEQENFHKFVKQLAEKYDKSEAQILLRWVSKRGIIPVTTSSKEKRIKDAQYLFTFDL 279

Query: 282 TSEDFEAVNNI 292
           T  + E +  +
Sbjct: 280 TDSEVEKITQL 290

>CAGL0J09394g Chr10 (925839..926774) [936 bp, 311 aa] {ON} similar
           to uniprot|Q07551 Saccharomyces cerevisiae YDL124w
          Length = 311

 Score =  132 bits (331), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 101/310 (32%), Positives = 146/310 (47%), Gaps = 54/310 (17%)

Query: 11  LLKLNTGAT---IRAIGLGT-WRSAAATDA------YDSVIAALRA-GYRHIDTAAIYGN 59
             KLN G     +  +G GT W     TD        D +  AL   G  H+D A  Y  
Sbjct: 6   FFKLNNGHEMPGVAIVGTGTKWHKVNETDENFSQTLVDQLKYALSLPGVVHLDAAEFYMT 65

Query: 60  EAEVGRAIRESGVPRGEIFVTTKLWCTQH--KEPELALDQSLKRLGLDYVDLYLMHWPVR 117
             EVGRA+ E+  PR EIF+T K W      + P + L+  LKRLGL+YVDLYL+H P  
Sbjct: 66  YREVGRALAETSKPRDEIFITDKYWTLSKVTENPIVGLETGLKRLGLEYVDLYLLHSPFI 125

Query: 118 MRGENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNL 177
            +  N       GF               +  + W +M++L  +GK + IGVSNF+  +L
Sbjct: 126 SKETN-------GF---------------SLEEAWGMMEELYHSGKAKNIGVSNFAKEDL 163

Query: 178 KDLLASPGNKIVPAANQVEMHPLLPQQE--LVDFCHGKGIVIEAYSPLGSADAPILKEPV 235
           + +L     K+ P  NQ+E +  L  Q   + +FC    I + AYSPLG    P+ K+P 
Sbjct: 164 ERVLKVC--KVKPQVNQIEFNAFLQNQTPGIYNFCKQNDIQLAAYSPLG----PLQKKPA 217

Query: 236 ----------IIEIAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSED 285
                     I ++A+    +  QV++ W  +RG + +  S  KERI+     F    +D
Sbjct: 218 DGNSQPFYSYINKLAQHYNKTPGQVLLRWVTKRGVVAVTTSEKKERIKQAQEIFEFDLKD 277

Query: 286 FEAVNNISKV 295
            E V  I+K+
Sbjct: 278 DE-VTEITKL 286

>KLTH0G00638g Chr7 (43280..44221) [942 bp, 313 aa] {ON} similar to
           uniprot|Q07551 Saccharomyces cerevisiae YDL124W
           NADPH-dependent alpha-keto amide reductase reduces
           aromatic alpha-keto amides aliphatic alpha-keto esters
           and aromatic alpha-keto esters
          Length = 313

 Score =  131 bits (329), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 97/308 (31%), Positives = 148/308 (48%), Gaps = 55/308 (17%)

Query: 16  TGATIRAIGLGT---WRSAAA---------TDAYDSVIAALRAGYRHIDTAAIYGNEAEV 63
           +G  +  IG G+   WR A A          +  D V  A++AG+ HID A  Y    EV
Sbjct: 13  SGDKLPVIGFGSGTKWRIAKAEGEKKDQFIQELADQVSNAIKAGFNHIDAAEAYKTHPEV 72

Query: 64  GRAIRESGVPRGEIFVTTKL--WC---TQHKEPELALDQSLKRLGLDYVDLYLMHWPVRM 118
           G  I  SGVPR +++VT K   W     + K P  +L+ SL ++ + YVDLYL+H P   
Sbjct: 73  GAGIANSGVPREKLWVTDKYTPWSWTWRKGKGPLESLELSLGKMQMQYVDLYLVHVPFI- 131

Query: 119 RGENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLK 178
                PE   I                 +  + W  M+++ + G  + IGVSNF + +L+
Sbjct: 132 ----NPETAGI-----------------DLKEAWRQMEEIYDRGWAKNIGVSNFDVESLE 170

Query: 179 DLLASPGNKIVPAANQVEMHPLLPQQE--LVDFCHGKGIVIEAYSPLGSADAPILK---- 232
            +      K  P  NQ+E    + QQ   ++ +C   GI IE YSPL     P+ K    
Sbjct: 171 YIRTI--GKYQPVVNQIEFSAYMQQQSPGIISYCKKHGIAIEGYSPL----VPLTKGKPG 224

Query: 233 --EPVIIEIAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANL--LTFTLTSEDFEA 288
             + ++  +AKK G S  Q+++ W VQ G I +  S  ++RI+ +L    F L+SEDF +
Sbjct: 225 PLDDILPLMAKKYGKSELQILLRWVVQNGVIAITTSAQQKRIDESLDIFDFELSSEDFTS 284

Query: 289 VNNISKVQ 296
           +  + K +
Sbjct: 285 ITEVGKTK 292

>KNAG0C04110 Chr3 (806389..807324) [936 bp, 311 aa] {ON} Anc_7.285
           YDL124W
          Length = 311

 Score =  130 bits (326), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 101/311 (32%), Positives = 146/311 (46%), Gaps = 47/311 (15%)

Query: 5   LSKNTSLLKLNTGATIRA---IGLGT-WRSAAATDAYDS--VIAALR-----AGYRHIDT 53
           +S N + + LN G  + A   IG GT W      D   S  +I  L       G  HID 
Sbjct: 1   MSHNQAFVTLNNGHKMPAVAIIGTGTHWHHKKEKDHALSHELIEQLEFALSLPGVVHIDA 60

Query: 54  AAIYGNEAEVGRAIRESGVPRGEIFVTTK--LWCTQHKEPELALDQSLKRLGLDYVDLYL 111
           A +YG   E+  A+R +  PR EIF+T K  L     K+P   L+ SLK   LDYVDLYL
Sbjct: 61  AEMYGTYPELSAALRMTEKPRSEIFITDKHALHAAMSKDPIAGLEDSLKANNLDYVDLYL 120

Query: 112 MHWPVRMRGENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSN 171
           +H P   +       +K G  TL                 W  M++L + GK + IGVSN
Sbjct: 121 LHSPFVAK-------EKPGL-TLEGA--------------WRQMEQLYKDGKAKNIGVSN 158

Query: 172 FSINNLKDLLASPGNKIVPAANQVEMHPLLPQQE--LVDFCHGKGIVIEAYSPLGSADAP 229
           FS+ +LK +L+    +I P  NQ+E HP L  Q   ++ FC  + I +EA++PLG     
Sbjct: 159 FSVEDLKRVLSVA--EIKPQVNQIEFHPFLQNQTPGILKFCQDENIELEAFTPLGPLQVK 216

Query: 230 ILKE------PVIIEIAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERI--EANLLTFTL 281
             ++        I  ++ K   + AQ+++ W  +RG I +  S   +RI    NL  F L
Sbjct: 217 TQEDENDEFFKYISSLSGKYQKTEAQIILRWVTKRGVIPVTTSRRHDRIADAQNLFEFDL 276

Query: 282 TSEDFEAVNNI 292
             E+   +  +
Sbjct: 277 EDEEVTKITRL 287

>SAKL0F09746g Chr6 complement(746292..747230) [939 bp, 312 aa] {ON}
           highly similar to uniprot|Q07551 Saccharomyces
           cerevisiae YDL124W NADPH-dependent alpha-keto amide
           reductase reduces aromatic alpha-keto amides aliphatic
           alpha-keto esters and aromatic alpha-keto esters
          Length = 312

 Score =  130 bits (326), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 105/314 (33%), Positives = 152/314 (48%), Gaps = 53/314 (16%)

Query: 5   LSKNTSLLKLNTGATIRA---IGLGT-W------RSAAATDAYDSVIAALRA-GYRHIDT 53
           +S       LN G  I A   IG GT W       S  + +  D V  AL   G  HID 
Sbjct: 1   MSIKQEFFTLNNGNKIPAVAVIGTGTKWFKTEENASKFSDELVDQVKYALTLPGVVHIDA 60

Query: 54  AAIYGNEAEVGRAIRESGVPRGEIFVTTKLWCTQHK---EPELALDQSLKRLGLDYVDLY 110
           A IY    E+G+A+RE+  PR EI++T K + T  K    P +  +  LK LG+DY+DLY
Sbjct: 61  AEIYRTYPELGKALRETKKPRNEIWITDK-YSTSLKLSDNPIVGFENGLKELGVDYIDLY 119

Query: 111 LMHWPVRMRGENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVS 170
           L+H P    G N       GF                  + W+ +++L ++GK + IGVS
Sbjct: 120 LLHSPFITEGRN-------GF---------------TLEQAWKYLEELYKSGKAKNIGVS 157

Query: 171 NFSINNLKDLLASPGNKIVPAANQVEMHPLLPQQE--LVDFCHGKGIVIEAYSPLG---- 224
           NF+  +L+ +L     +I P  NQ+E    L  Q   + +F     I++EAYSPLG    
Sbjct: 158 NFAKEDLERILKIA--EIKPQVNQIEYSAFLQNQTPGIYNFAKENDILLEAYSPLGPLQR 215

Query: 225 ---SADA-PILKEPVIIEIAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIE--ANLLT 278
               AD+ P  K   I E+A+K G S AQV++ W  +RG + +  S    R+    ++ T
Sbjct: 216 RPEEADSLPFYK--YINELAEKYGKSEAQVLLRWVSKRGVLPVTTSSKPHRVHDAQHIFT 273

Query: 279 FTLTSEDFEAVNNI 292
           F LTS + E +  +
Sbjct: 274 FDLTSTEVEKITEL 287

>TBLA0F01980 Chr6 (493378..494286) [909 bp, 302 aa] {ON} Anc_7.285
           YDL124W
          Length = 302

 Score =  129 bits (323), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 95/315 (30%), Positives = 148/315 (46%), Gaps = 43/315 (13%)

Query: 5   LSKNTSLLKLNTGATI---RAIGLGT-WRSAAATDAY-DSVIAALR-----AGYRHIDTA 54
           +S  TSL+ LN G  I     IG GT W      D Y D+++  +       G  HID A
Sbjct: 1   MSYQTSLITLNNGNKIPGISIIGTGTRWYKYNPEDKYSDALVKQIENALELPGMLHIDCA 60

Query: 55  AIYGNEAEVGRAIRESGVPRGEIFVTTKLWCTQH--KEPELALDQSLKRLGLDYVDLYLM 112
            +Y   AEVG A+R S  PR EIF+T K    +     P+  L  +L+++GL+YVDLYL+
Sbjct: 61  EMYQTHAEVGEALRNSKKPRDEIFITDKYAIPRKFSSNPKEGLKLALEKMGLEYVDLYLL 120

Query: 113 HWPVRMRGENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNF 172
           H+P+                       D  + D+   + W++M+ L   G  + IGVSNF
Sbjct: 121 HFPI----------------------IDPKLYDFTLEEAWKMMEDLYNEGLAKNIGVSNF 158

Query: 173 SINNLKDLLASPGNKIVPAANQVEMHPLLPQQE--LVDFCHGKGIVIEAYS---PLGSAD 227
            + +L+ L  S    I P  NQ+E +  L  Q   + D+C    I +EA+    PL   +
Sbjct: 159 RVEDLEQL--SKSWVIKPQINQIEFNAYLQNQTPGIYDYCIKNNIQLEAFCPLVPLREVN 216

Query: 228 APILKEPVIIEIAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIE--ANLLTFTLTSED 285
              L    + ++A+K   +  Q+++ W  QR  I +  S   ER+    ++ +F LT ++
Sbjct: 217 EKDLLPLYVKQLAQKYSKTENQIMLRWVSQRKVIPVTTSSRPERVRDAYDIFSFELTQDE 276

Query: 286 FEAVNNISKVQGTKR 300
            E +  +     T R
Sbjct: 277 VEFITKLGSQHDTIR 291

>TDEL0D02790 Chr4 complement(533517..534506) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  127 bits (320), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 98/310 (31%), Positives = 150/310 (48%), Gaps = 47/310 (15%)

Query: 5   LSKNTSLLKLNTGATIRAI---GLGT-WRSAAATDA------YDSVIAALR-AGYRHIDT 53
           ++ +     LN G  I A+   G GT W     T++       + +  AL   G  H+D 
Sbjct: 20  MAFHQEFFTLNNGNKIPAVAVVGTGTTWFKNEETESNFSKELVEQIKYALTLPGIVHLDA 79

Query: 54  AAIYGNEAEVGRAIRESGVPRGEIFVTTKLWCT--QHKEPELALDQSLKRLGLDYVDLYL 111
           A  Y    E+G+A+RES  PR EIF+T K   T   H       +  +K++G+DYVDLYL
Sbjct: 80  AECYNTYQELGQALRESPKPRDEIFITDKFSPTPKNHGGVLERFESGIKKMGVDYVDLYL 139

Query: 112 MHWPVRMRGENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSN 171
           +H P       + E +K G                   + W+ ++KL E GK + IGVSN
Sbjct: 140 IHSP-------LIEKEKNGV---------------TLEEVWKDLEKLYEAGKAKNIGVSN 177

Query: 172 FSINNLKDLLASPGNKIVPAANQVEMHPLLPQQE--LVDFCHGKGIVIEAYSPLG----- 224
           F + +L+ +L     K+ P  NQ+E H  L  Q   +V F     I +EAY+PLG     
Sbjct: 178 FRVEDLQRILKVA--KVKPQVNQIEFHVFLQNQTPGIVKFSQDNNIQLEAYTPLGPLQRK 235

Query: 225 SADAPILKEPVIIEIAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEA--NLLTFTLT 282
            +DA       + E+AKK G + AQV++ W  +R  + +  S   +RI+A  +L +F LT
Sbjct: 236 QSDAGDFYN-YVEELAKKYGKTEAQVLLRWVTRRHVLPITTSSKPQRIQAAQDLFSFDLT 294

Query: 283 SEDFEAVNNI 292
            E+ + +  +
Sbjct: 295 DEEVKKITEL 304

>SAKL0F00704g Chr6 (60941..61888) [948 bp, 315 aa] {ON} similar to
           uniprot|Q07551 Saccharomyces cerevisiae YDL124W
           NADPH-dependent alpha-keto amide reductase reduces
           aromatic alpha-keto amides aliphatic alpha-keto esters
           and aromatic alpha-keto esters
          Length = 315

 Score =  126 bits (316), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 93/306 (30%), Positives = 146/306 (47%), Gaps = 55/306 (17%)

Query: 16  TGATIRAIGLGT---WRSAAAT--------DAY-DSVIAALRAGYRHIDTAAIYGNEAEV 63
           +G  + +IG G+   WR A ++        DA  D V  A++ G+ HIDTA  Y    EV
Sbjct: 14  SGDLLPSIGFGSGTKWRIAKSSGKTKGVYIDALADQVTNAIQCGFNHIDTAEAYKTYKEV 73

Query: 64  GRAIRESGVPRGEIFVTTKL--WCTQHKE---PELALDQSLKRLGLDYVDLYLMHWPVRM 118
           G  I  + VPR  +++T K   W  + ++   P  +L  SLK + LDYVDLY++H     
Sbjct: 74  GTGISNAQVPRETLWITDKYTPWSWEWRKGSGPLESLTLSLKEMNLDYVDLYMIH----- 128

Query: 119 RGENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLK 178
                        P +      ID+ +      W  M+++      R IGVSNF + +L+
Sbjct: 129 ------------VPNITTKTAGIDLKE-----AWLQMEEIYTRKMARNIGVSNFDVESLE 171

Query: 179 DLLASPGNKIVPAANQVEMHPLLPQQE--LVDFCHGKGIVIEAYSPLGSADAPILK---- 232
            + +    K  P  NQ+E    + QQ   ++ +C    IV+E YSPL     P+ K    
Sbjct: 172 YIKSFA--KYQPVVNQIEFSAYMQQQSPGILKYCRENNIVVEGYSPL----VPLTKGKPG 225

Query: 233 --EPVIIEIAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEA--NLLTFTLTSEDFEA 288
             + ++  IA K G S  QV++ W  Q G +V+  +  KER+    N+  F L+ EDF+ 
Sbjct: 226 PLDEILPGIAAKYGKSQLQVLLRWVTQNGIVVITTTGKKERLNESLNIFDFELSKEDFDQ 285

Query: 289 VNNISK 294
           + N+ +
Sbjct: 286 ITNVGR 291

>ZYRO0C09196g Chr3 complement(698826..699764) [939 bp, 312 aa] {ON}
           highly similar to uniprot|Q07551 Saccharomyces
           cerevisiae YDL124W NADPH-dependent alpha-keto amide
           reductase reduces aromatic alpha-keto amides aliphatic
           alpha-keto esters and aromatic alpha-keto esters
          Length = 312

 Score =  122 bits (307), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 100/332 (30%), Positives = 150/332 (45%), Gaps = 50/332 (15%)

Query: 5   LSKNTSLLKLNTGATIRA---IGLGT-WRSAAATDAYDS-------VIAALRAGYRHIDT 53
           ++ +     LN G  I A   IG GT W     TDA  S         A    G  H+D 
Sbjct: 1   MAFHQEFFTLNNGNKIPAVAVIGTGTRWYKKEETDANFSHALVKQIEYALTLPGVVHVDH 60

Query: 54  AAIYGNEAEVGRAIRESGVPRGEIFVTTKLWCTQHK---EPELALDQSLKRLGLDYVDLY 110
           A +Y    E   A++ +  PR EIFVT K +  Q K   +P   LD  LKR GL+YVDLY
Sbjct: 61  AEVYRTYPEFSEALKNTKKPRNEIFVTDK-YSVQEKITNDPREGLDTGLKRTGLEYVDLY 119

Query: 111 LMHWPVRMRGENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVS 170
           L+H P   + +N       GF                  + W  +++L   GK + IGVS
Sbjct: 120 LLHSPFASKEKN-------GF---------------TIEEAWAQLEELYHEGKAKNIGVS 157

Query: 171 NFSINNLKDLLASPGNKIVPAANQVEMHPLLPQQE--LVDFCHGKGIVIEAYSPLG---S 225
           NF + +L+ +L     K+ P  NQ+E    L  Q   +V F     I +EAY+PLG    
Sbjct: 158 NFRVEDLEKILKVA--KVKPQVNQIEFSAFLQNQTPGVVKFSQDHDIQLEAYAPLGPLSK 215

Query: 226 ADAPILKEPV---IIEIAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIE--ANLLTFT 280
            D     +P    I ++ +K   + AQ+++ W  +RG + +  S   +RIE   NL  F 
Sbjct: 216 RDESEQAKPFYDYIKKLTEKYSKTEAQILLRWVSKRGILPVTTSGQPKRIEDAQNLFGFD 275

Query: 281 LTSEDFEAVNNISKVQGTKRII-DPDWEPFKP 311
           LT ++ + +  +       R+  +P ++ + P
Sbjct: 276 LTKDEVDEITKLGLAHPALRLYWNPLYDQYNP 307

>Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON}
           similar to Saccharomyces cerevisiae YDL124W
          Length = 311

 Score =  115 bits (288), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 97/323 (30%), Positives = 153/323 (47%), Gaps = 57/323 (17%)

Query: 5   LSKNTSLLKLNTGATIRAI---GLGT-W-RSAAATDAYDSVIAALRA-----GYRHIDTA 54
           + +      LN G +I AI   G+G  W +     D   +++  L+      G+ HI TA
Sbjct: 2   VGRTKRFFTLNNGNSIPAITTVGVGNKWTKIYGIRDGAKNLMEYLKEILALPGFLHIMTA 61

Query: 55  AIYGNEAEVGRAIRESGVPRGEIFVTTKLWCTQHK---EPELALDQSLKRLGLDYVDLYL 111
             Y N   +  A++ S  PR EI++T K +C+Q K    P  AL++SL RLG DYVDLYL
Sbjct: 62  EFYPNNGLLSAALKASQKPRHEIWITDK-YCSQCKLSSSPIEALERSLDRLGFDYVDLYL 120

Query: 112 MHWPVRMRGENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSN 171
           +H P                 + PNG         +  K W+ M+ L +TGK + IGVSN
Sbjct: 121 IHNPC--------------LDSSPNG--------ISLEKAWKQMELLYKTGKVKNIGVSN 158

Query: 172 FSINNLKDLLASPGNKIVPAANQVEMHPLLPQQ--ELVDFCHGKGIVIEAYSPL------ 223
           F I +L+ L  +   +I P  N++E H  L  Q   + ++     +++  YSPL      
Sbjct: 159 FRIEDLERLKDA---EIKPQVNEIEFHAFLQNQTPNIYEYAKTHDLLLCGYSPLFPLETK 215

Query: 224 --GSADAPILKEPVIIEIAKKNGVSAAQVVISWNVQRGYIVLPKSVNKE----RIEANLL 277
                D P  +   II +A+K   + AQ+++ W    G  VLP   N +    +  ++++
Sbjct: 216 TEDFMDFPFYR--YIIGLAEKYNKTEAQILLHWMNCLG--VLPVITNTKVKWYKEASDII 271

Query: 278 TFTLTSEDFEAVNNISKVQGTKR 300
           +F LTSE+ + +  + K     R
Sbjct: 272 SFELTSEELDMITELGKKHKPHR 294

>Kwal_33.13274 s33 (151643..151969) [327 bp, 108 aa] {ON} YJR096W
          - Hypothetical ORF [contig 119] FULL
          Length = 108

 Score = 65.5 bits (158), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 52/97 (53%), Gaps = 6/97 (6%)

Query: 1  MSATLSKN-TSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGN 59
          M+ T+  N  +  KLN G  I  IG G +      D  D V +AL+ GYRHIDTA +Y N
Sbjct: 1  MTHTIDINRETRYKLNNGQQIPVIGFGVY-EIPKEDTADRVYSALKDGYRHIDTAVLYRN 59

Query: 60 EAEVGRAIR----ESGVPRGEIFVTTKLWCTQHKEPE 92
          + E  + +R    E+G  R  I+ TTKLW +Q    E
Sbjct: 60 QKEAAQGVRKYLDETGEARENIWFTTKLWDSQFGREE 96

>Suva_4.122 Chr4 (228898..228945,228942..229163,229167..229517) [621
           bp, 206 aa] {ON} YDL124W (REAL)
          Length = 206

 Score = 47.8 bits (112), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 76/180 (42%), Gaps = 32/180 (17%)

Query: 51  IDTAA--IYGNE-AEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELAL--DQSLKRLGLD 105
           ID AA  IY     EVG A+  +  P+ EIF+T K          LA+  D +LK++ ++
Sbjct: 7   IDIAASEIYKQTYPEVGEALSLTKKPKTEIFLTDKSSTQTEVSATLAMRPDMALKKISVE 66

Query: 106 YVDLYLMHWPVRMRGENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTR 165
           YVD++ +H P   +  N+               +D   TD            L  + K  
Sbjct: 67  YVDMHFLHSPFVFKQANVL------------NLKDAMHTDH-----------LRRSNKAN 103

Query: 166 AIGVSNFSINNLKDLLASPGNKIVPAANQVEMHPLLPQQE--LVDFCHGKGIVIEAYSPL 223
             G S+ ++  L+ +L +   +  P  NQ+++   L  Q   +   C    I++  YS L
Sbjct: 104 NRGASSVNVEELRRVLKTEDEE--PQVNQIKLRSSLRNQTPGISKLCQENDILMAVYSTL 161

>Suva_12.272 Chr12 complement(441543..442262,442266..442340) [795
           bp, 265 aa] {ON} YDL124W (REAL)
          Length = 265

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 66/289 (22%), Positives = 105/289 (36%), Gaps = 83/289 (28%)

Query: 20  IRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIY-GNEAEVGR---------AIRE 69
           I+ I  G   S  +    + ++  L+AG + IDTA IY  NE  +G            + 
Sbjct: 1   IKIIYGGYTFSLLSNQNSNEIVTVLKAGVKDIDTARIYPDNEKAIGELQLPDRFTIHTKA 60

Query: 70  SGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRGENMPEGDKI 129
           SG   G         C        ++++SL  LG+  V+ +L+H P              
Sbjct: 61  SGFSGG---------CLTRDNINKSIEESLSLLGVPSVETFLLHSPD------------- 98

Query: 130 GFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDL--LASPGNK 187
             P +P              +T + +  L E GK    G+SNFS  ++K +   A   + 
Sbjct: 99  --PEIP------------LEETLDAINSLYEQGKFEKFGLSNFSTEDVKRIYDYAKSKDY 144

Query: 188 IVPAANQVEMHPLLPQ--QELVDFCHGKGIVIEAYSPLGS---ADAP--ILKE------- 233
           ++P   Q   + L      +L        I + AYSP+     A+ P  IL E       
Sbjct: 145 VLPTVYQGNYNALSRAIVNDLFPLLKELHISLYAYSPIARGFLAETPEEILGEKSGRFDN 204

Query: 234 --------------PVII-------EIAKKNGVSAAQVVISWNVQRGYI 261
                         P II       ++AKK G+S   +   W V   ++
Sbjct: 205 STMIGQMYLKLYNRPAIIKGLEEWNKLAKKTGISKYSLAYRWIVHNSFL 253

>KNAG0M02340 Chr13 complement(431237..432166) [930 bp, 309 aa] {ON}
           Anc_2.604 YMR041C
          Length = 309

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/147 (27%), Positives = 66/147 (44%), Gaps = 33/147 (22%)

Query: 45  RAGYRHIDTAAIYGN-EAEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLG 103
           R  +  +DT+  YG+ E  VG+A+RE  +PRGEI+V TK                + R+G
Sbjct: 38  RRCFNAVDTSPYYGDSELLVGQALRELQIPRGEIYVCTK----------------VGRVG 81

Query: 104 ---LDY----VDLYLMHWPVRMRGENMPEGDKIGFPTLPNGKRDIDITDWN-FVKTWELM 155
               DY    V + +M    R+ G    EG  +    L     D++       +   + +
Sbjct: 82  VSEFDYSRENVRMSVMRSVERLVG----EGGYLDVVYL----HDVEFQPQEACLAALDEL 133

Query: 156 QKLPETGKTRAIGVSNFSINNLKDLLA 182
           QKL   G  R +GVS + ++ L  L++
Sbjct: 134 QKLKRAGIVRNVGVSGYPLSKLYSLVS 160

>Ecym_2296 Chr2 complement(574287..575309) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii ABR094W
          Length = 340

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 65/148 (43%), Gaps = 41/148 (27%)

Query: 43  ALRAGYRHIDTAAIYG-NEAEVGRAIRE--SGVPRGEIFVTTKL-------WCTQHKEPE 92
           A+  G   IDT+  YG +E   G+A++E     PR E F+ TK+       +    +   
Sbjct: 50  AMSRGINAIDTSPYYGPSEIIYGKALQEIKDEFPREEYFICTKVGRVGRAEFNYSKENVR 109

Query: 93  LALDQSLKRLGLDYVDLYLMHWPVRMRGENMPEGDKIGFPTLPNGKRDIDITDWNFVKTW 152
            ++ +S +RL  DY+DL  +H                          DI+  +++  K W
Sbjct: 110 FSVKRSCERLHTDYLDLVYLH--------------------------DIEYVEYD--KIW 141

Query: 153 EL---MQKLPETGKTRAIGVSNFSINNL 177
           E    ++KL + G  R IG+S + ++ L
Sbjct: 142 EALRELRKLKDEGVIRHIGISGYPVDLL 169

>Kwal_26.8377 s26 (759190..760206) [1017 bp, 338 aa] {ON} YMR041C -
           Hypothetical ORF [contig 59] FULL
          Length = 338

 Score = 37.0 bits (84), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 62/144 (43%), Gaps = 42/144 (29%)

Query: 43  ALRAGYRHIDTAAIYGN-EAEVGRAIR--ESGVPRGEIFVTTKLWCTQHKEPELALD--- 96
           A++ G R IDT+  YG+ E   G+A+   +  +PR   F+ TK+   +  E + + +   
Sbjct: 52  AVQHGIRAIDTSPYYGDSEKLFGKALESLKDEIPRENYFICTKVGRIRLDEFDYSREHVR 111

Query: 97  ----QSLKRLGLDYVDLYLMHWPVRMRGENMPEGDKIGFPTLPNGKRDIDITDWNFVKTW 152
               +S +RL  DY+D+  +H                               D  FV+T 
Sbjct: 112 SSVLRSCERLRTDYLDVVFLH-------------------------------DVEFVETA 140

Query: 153 ELMQKLPETGKTRAIGV-SNFSIN 175
           ++++ L E  K +  GV  NF I+
Sbjct: 141 QVLEALKELRKLKDEGVLHNFGIS 164

>NCAS0A12950 Chr1 complement(2551851..2552822) [972 bp, 323 aa] {ON}
           Anc_2.604 YMR041C
          Length = 323

 Score = 36.6 bits (83), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 37/81 (45%), Gaps = 10/81 (12%)

Query: 43  ALRAGYRHIDTAAIYGN-EAEVGRAIRESG--VPRGEIFVTTKLWCTQHKEPELALD--- 96
           A   G   IDT+  YGN E  +G+A+   G   PR    + TK+        + + D   
Sbjct: 33  AFENGINCIDTSPYYGNSEILIGKALHNLGDKFPRDSYLICTKVGRLSLDSFDYSADNVR 92

Query: 97  ----QSLKRLGLDYVDLYLMH 113
               +S KRL  DY+DL  +H
Sbjct: 93  RSVVRSCKRLNSDYLDLVYLH 113

>KLTH0D08844g Chr4 (738727..739749) [1023 bp, 340 aa] {ON} similar
           to uniprot|Q04212 Saccharomyces cerevisiae YMR041C
           Hypothetical ORF
          Length = 340

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 71/173 (41%), Gaps = 48/173 (27%)

Query: 38  DSVIAALRAGYRHIDTAAIYGNEAEVGRAIRES---GVPRGEIFVTTKLWCTQHKEPE-- 92
           D +  A++ G R IDT+  YG+   +  A  ES    +PR   F+ TK+   + +E +  
Sbjct: 47  DMIRFAMQFGVRAIDTSPYYGDSEVLYGAALESLKEELPRENYFICTKVGRIRLEEFDYS 106

Query: 93  -----LALDQSLKRLGLDYVDLYLMHWPVRMRGENMPEGDKIGFPTLPNGKRDIDITDWN 147
                 ++ +S +RL   Y+D+  +H                               D  
Sbjct: 107 RSHIHFSVLRSCERLKTKYLDVVFLH-------------------------------DVE 135

Query: 148 FVKTWELMQKLPETGKTRAIGV-SNFSINNLKDLLASPGNKIVPAANQVEMHP 199
           FV+T ++++ L E  K R  GV  NF I+        P + ++  A + + HP
Sbjct: 136 FVETEQVLEALQELRKLRDEGVILNFGISGY------PVDFLLNIALKCKTHP 182

>YDL243C Chr4 complement(17577..18566) [990 bp, 329 aa] {ON}
           AAD4Putative aryl-alcohol dehydrogenase; involved in
           oxidative stress response; similar to P. chrysosporium
           aryl-alcohol dehydrogenase; expression induced in cells
           treated with the mycotoxin patulin
          Length = 329

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 45/99 (45%), Gaps = 21/99 (21%)

Query: 36  AYDSVIAALRAGYRHIDTAAIYGNEAE---VGRAIRESGVPRGEIFVTTKL--------- 83
           A++ + A   AG   IDTA  Y NE     +G  ++   + R +I + TK          
Sbjct: 9   AFELLDAFYEAGGNCIDTANSYQNEESEIWIGEWMKSRKL-RDQIVIATKFTGDYKKYEV 67

Query: 84  -------WCTQHKEP-ELALDQSLKRLGLDYVDLYLMHW 114
                  +C  HK    +++  SL++L  D++D+  +HW
Sbjct: 68  GGGKSANYCGNHKHSLHVSVRDSLRKLQTDWIDILYVHW 106

>YNL331C Chr14 complement(16118..17248) [1131 bp, 376 aa] {ON}
           AAD14Putative aryl-alcohol dehydrogenase; similar to P.
           chrysosporium aryl-alcohol dehydrogenase; mutational
           analysis has not yet revealed a physiological role
          Length = 376

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 50/118 (42%), Gaps = 21/118 (17%)

Query: 17  GATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAE---VGRAIRESGVP 73
           GA+I     G   S     A++ + A   AG   IDTA  Y NE     +G  +    + 
Sbjct: 36  GASIGDAWSGFMGSMNKEQAFELLDAFYEAGGNCIDTANSYQNEESEIWIGEWMASRKL- 94

Query: 74  RGEIFVTTKL----------------WCTQHKEP-ELALDQSLKRLGLDYVDLYLMHW 114
           R +I + TK                 +C  HK    +++  SL++L  D++D+  +HW
Sbjct: 95  RDQIVIATKFTGDYKKYEVGGGKSANYCGNHKRSLHVSVRDSLRKLQTDWIDILYIHW 152

>TPHA0C02560 Chr3 (568135..569157) [1023 bp, 340 aa] {ON} Anc_2.604
           YMR041C
          Length = 340

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 42/86 (48%), Gaps = 10/86 (11%)

Query: 38  DSVIAALRAGYRHIDTAAIYGN-EAEVGRAIRESGV--PRGEIFVTTKLWCTQHKEPELA 94
           D +  A R G   IDT+  YG+ E   G+A++   +  PR   F+ TK+      E + +
Sbjct: 45  DMIRFAFRNGITAIDTSPYYGDSEIIYGKALKSIKIEFPRDTYFICTKVGRIGSNEFDYS 104

Query: 95  LD-------QSLKRLGLDYVDLYLMH 113
            +       +S KRL  +Y+D+  +H
Sbjct: 105 ANNVRKSILRSCKRLNTNYLDVVYLH 130

>TBLA0B10110 Chr2 complement(2432572..2433609) [1038 bp, 345 aa]
           {ON} 
          Length = 345

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 59/270 (21%), Positives = 89/270 (32%), Gaps = 77/270 (28%)

Query: 15  NTGATIRAIGLGT----------WRSAAATDAYDSVIAALRAGYRHIDTAAIYGN---EA 61
           NTG  I     GT          W      DAY  +  A   G R  DTA  Y N   E 
Sbjct: 11  NTGLKISPFIFGTMTFGNKKNMQWAIEEMEDAYKILKYAYDRGIRTFDTADAYANGLSET 70

Query: 62  EVGRAIRESGVPRGEIFVTTKLWCTQHKEPEL---------------------------- 93
            +G  ++   +PR  + + TK++       EL                            
Sbjct: 71  ILGSFLKHYNIPRETVVIMTKVFYRVDDTIELNPTDLLFGNNEELNLRLVNQKGLSRKHI 130

Query: 94  --ALDQSLKRLGLDYVDLYLMHWPVRMRGENMPEGDKIGFPTLPNGKRDIDITDWNFVKT 151
             A   S++RLG  Y+D+Y +H   R   E                          F +T
Sbjct: 131 LEAAKNSVRRLG-TYIDVYQIH---RCDHET------------------------PFEET 162

Query: 152 WELMQKLPETGKTRAIGVSNF---SINNLKDLLASPG-NKIVPAANQVEMHPLLPQQELV 207
              +  + E G  R IG S+         + +    G +K V       +     ++E++
Sbjct: 163 MRALNDVVEQGYARYIGASSMLGTEFAEYQFIAEKHGWHKFVNMQTCYNLLYREDEREML 222

Query: 208 DFCHGKGIVIEAYSPL--GSADAPILKEPV 235
            FC    + I  +SPL  G    PI ++ V
Sbjct: 223 PFCKKNNVAITPWSPLQMGFLARPITEKSV 252

>YFL056C Chr6 complement(14793..15431) [639 bp, 212 aa] {ON}
           AAD6Putative aryl-alcohol dehydrogenase; involved in
           oxidative stress response; similar to P. chrysosporium
           aryl-alcohol dehydrogenase; expression induced in cells
           treated with the mycotoxin patulin
          Length = 212

 Score = 34.3 bits (77), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 47/105 (44%), Gaps = 21/105 (20%)

Query: 30  SAAATDAYDSVIAALRAGYRHIDTAAIYGNE---AEVGRAIRESGVPRGEIFVTTKL--- 83
           S +   A++ + A   AG   IDTA  Y NE   A +G  +    + R +I + TK    
Sbjct: 49  SMSKERAFELLDAFYEAGGNFIDTANNYQNEQSEAWIGEWMVSRKL-RDQIVIATKFTTD 107

Query: 84  -------------WCTQHKEP-ELALDQSLKRLGLDYVDLYLMHW 114
                        +C  HK    +++  SL++L  D++D+  +HW
Sbjct: 108 YKKYDVGGGKSANYCGNHKRSLHVSVRDSLRKLQTDWIDILYVHW 152

>Skud_10.383 Chr10 (684416..685546) [1131 bp, 376 aa] {ON} YNL331C
           (REAL)
          Length = 376

 Score = 34.7 bits (78), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 45/99 (45%), Gaps = 21/99 (21%)

Query: 36  AYDSVIAALRAGYRHIDTAAIYGNE---AEVGRAIRESGVPRGEIFVTTKL--------- 83
           A++ + A   AG   IDTA  Y NE   A +G  +    + R +I + TK          
Sbjct: 55  AFELLDAFFEAGGNFIDTANNYQNEQSEAWIGEWMVSRKL-RDQIVIATKFTTDYKKYEV 113

Query: 84  -------WCTQHKEP-ELALDQSLKRLGLDYVDLYLMHW 114
                  +C  HK    +++  SL++L  D++D+  +HW
Sbjct: 114 GKGRSANFCGNHKHSLHVSVRDSLRKLQTDWIDILYVHW 152

>Kpol_449.4 s449 (14334..15359) [1026 bp, 341 aa] {ON}
           (14334..15359) [1026 nt, 342 aa]
          Length = 341

 Score = 34.3 bits (77), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 57/264 (21%), Positives = 95/264 (35%), Gaps = 67/264 (25%)

Query: 22  AIGLGTWRSAAATD---AYDSVIAALRAGYRHIDTAAIYGN---EAEVGRAIRESGVPRG 75
           + G  TW      D   A+  +  A   G R  DTA +Y N   E  +G  +R+  +PR 
Sbjct: 25  SFGSKTWDEWVQDDKEEAFKILKHAYDRGIRSYDTANVYSNGQSEIILGEFLRKYNIPRE 84

Query: 76  EIFVTTKLWC---------TQHKEPELALD-----------------QSLKRLGLDYVDL 109
            + + TKL            ++  PE+ L+                  S+KRLG  Y+D+
Sbjct: 85  TVVIMTKLRFPADENMDIDFKNMTPEMKLNVVNMQGLSRKSIFSSSRASVKRLG-TYIDI 143

Query: 110 YLMHWPVRMRGENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGV 169
             +H     RG+          P  P            F +T   +  +   G TR +G 
Sbjct: 144 LQIH-----RGD----------PDTP------------FEETMGALNDVVIEGLTRYVGA 176

Query: 170 SNFSINNLKDL-LASPGNKIVPAANQVEMHPLL---PQQELVDFCHGKGIVIEAYSPLGS 225
           S        ++   +  +      N    + L+    ++EL+ F     I +  +SPL  
Sbjct: 177 SLMLATEFAEMQFVAEKHGWFKFVNSQSCYHLMYREDERELIPFAKRHNIALTPFSPLNR 236

Query: 226 ADAPILKEPVIIEIAKKNGVSAAQ 249
               +L  P+  E  + N  S  +
Sbjct: 237 G---LLCRPLGTETTRSNSDSVIK 257

>TBLA0G01120 Chr7 complement(285827..286858) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 34.3 bits (77), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 70/349 (20%), Positives = 117/349 (33%), Gaps = 109/349 (31%)

Query: 15  NTGATIRAIGLGT----------WRSAAATDAYDSVIAALRAGYRHIDTAAIYGN---EA 61
           NTG  I  I +G           W      + +  +  A  +G R  DTA  Y N   E 
Sbjct: 11  NTGLKISPIIVGCMSYGSKDWHPWIIEDKNEVFKILKTAYDSGLRTFDTADGYSNGQSEI 70

Query: 62  EVGRAIRESGVPRGEIFVTTKLWC----------------------------TQHKEPEL 93
            +G  ++E  +PR  + + TK+W                                K    
Sbjct: 71  LLGEFLKEYEIPRETVIIMTKVWAPVDSSLEGFQRTGPMNEDQKVHFANQQGLSRKHIIE 130

Query: 94  ALDQSLKRLGLDYVDLYLMHWPVRMRGENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWE 153
           A   S++RLG  Y+D+Y +H     R +                       D    +T  
Sbjct: 131 ACKNSVRRLGT-YIDVYQIH-----RADQ----------------------DTPMEETMR 162

Query: 154 LMQKLPETGKTRAIGVSNFSINNLKDL-LASPGNKIVPAANQVEMHPLL---PQQELVDF 209
            +  + + G TR IG S+       +    +  N      N  + + LL    ++E++ +
Sbjct: 163 ALNDVVQQGLTRYIGASSMLGTEFAEYQFIAEKNGWSKFVNMQDCYNLLYREEEREMIPY 222

Query: 210 CHGKGIVIEAYSPLGSADAPILKEPV-------------------------------IIE 238
               GI    +SPL      +L  PV                               + +
Sbjct: 223 IKKHGIAQTPWSPLQRG---LLSRPVEVSSYREDNDRVLKGRRLNQYEDFEIEIINRVEQ 279

Query: 239 IAKKNGVSAAQVVISWNVQRGY--IVLPKSVNKERIEANLLTFTLTSED 285
           +A K G++ A+V  +W + +G   I+   SV + +     L  TLT E+
Sbjct: 280 VAVKKGITMAEVATAWLLSKGTFPILGLNSVQRVKEAIKALDVTLTEEE 328

>NCAS0C02450 Chr3 complement(455582..456613) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 33.9 bits (76), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 62/292 (21%), Positives = 115/292 (39%), Gaps = 65/292 (22%)

Query: 47  GYRHIDTAAIYGN---EAEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSL---- 99
           G R  DTA +Y N   E  +G  ++   + R  + + +K++          +D+SL    
Sbjct: 53  GLRTFDTADVYSNGTSERILGEFLKRFNIKRETVVIMSKIF--------FPVDESLDLHQ 104

Query: 100 -KRLGLDYVDLYLMHWPVRMRGENMP----EGDKIG--FPTLPNGKRDIDITDWNFVKTW 152
             ++  +Y+DL L       R   M       +++G     L   + D + +        
Sbjct: 105 GSKVDQEYIDLQLSFQQGLNRKHIMAGVANSVERLGTYIDILQIHRLDKEAS------ME 158

Query: 153 ELMQKLPE---TGKTRAIGVSNFSINNLKDL-LASPGNKIVPAANQVEMHPLLPQQ---E 205
           E+M+ L +   +G+ R IG S+       +L   +  N      N    + +L ++   E
Sbjct: 159 EIMRSLNDVVVSGQVRYIGASSMLATEFAELQFIAKQNGWFQFINVQSYYNVLNREDENE 218

Query: 206 LVDFCHGKGIVIEAYSP--LGSADAP-------ILKEPVIIE------------------ 238
           L+ FC   G+ +  +SP   G    P       +L +P  I+                  
Sbjct: 219 LIPFCKKHGVGLTVWSPNARGVLTRPADKTGTRMLSDPTFIKMGLDKLDESDKEIIGVVE 278

Query: 239 -IAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANL--LTFTLTSEDFE 287
            IAKK G+S A V ++W + +G   +    + ER++  +  +    T E+ E
Sbjct: 279 AIAKKKGISMAMVSMAWILNKGANAIAGLNSIERVDEAIRAIDVKFTVEELE 330

>ZYRO0F00858g Chr6 (68107..69147) [1041 bp, 346 aa] {ON} similar to
           uniprot|Q04212 Saccharomyces cerevisiae YMR041C
           Hypothetical ORF
          Length = 346

 Score = 33.9 bits (76), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 39/86 (45%), Gaps = 10/86 (11%)

Query: 38  DSVIAALRAGYRHIDTAAIYG-NEAEVGRAIRE--SGVPRGEIFVTTKLWCTQHKEPELA 94
           D +      G R IDT+  YG +E   G+A+       PR   ++ TK+   Q  E + +
Sbjct: 44  DMLKHGFNHGIRAIDTSPYYGPSEILYGQALEHIRDEFPRNSYYICTKVGRIQLDEFDYS 103

Query: 95  LDQ-------SLKRLGLDYVDLYLMH 113
            +        S +RL  DY+DL  +H
Sbjct: 104 REHVRFSVLRSCQRLKTDYLDLVYLH 129

>KAFR0C03670 Chr3 complement(747792..748823) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 33.5 bits (75), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 69/334 (20%), Positives = 130/334 (38%), Gaps = 68/334 (20%)

Query: 15  NTGATIRAIGLGTWRSAAAT------DAYDSVIAALRAGY----RHIDTAAIYGN---EA 61
           NTG  I  I +G     +        D  +++   L+  Y    R  DTA  Y N   E 
Sbjct: 12  NTGLKISPIIVGCMSYGSKNWAEWVEDDKNTIFGILKYCYDKGLRTFDTADYYSNGLSEK 71

Query: 62  EVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLG-LDYVDLYLMHWPVRMRG 120
            +G  + +  + R  + + TK++    +   L  +  L  L  LD V+          RG
Sbjct: 72  LLGEFLVKYNIKRETVVIMTKIFFPFDETLNLKSNTPLSELQELDVVN---------QRG 122

Query: 121 ---ENMPEGDKIGFPTLPNGKRDIDITDWN----FVKTWELMQKLPETGKTRAIGVSNFS 173
              +++ +G +     L      + I  ++      +T + +  + E+G  R IG S+  
Sbjct: 123 LSRKHILDGVEKAIARLGTYIDVLQIHRFDPETPIKETMKALNDVIESGHVRYIGASSML 182

Query: 174 INNLKDL--LASPGN--KIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSP------- 222
                ++  +A   N  + V A +   +     ++EL+ FC    I +  +SP       
Sbjct: 183 ATQFAEMQFIADKYNWFQFVNAQSMYNLVYREDERELIPFCKRHNIALTPWSPNHRGFLT 242

Query: 223 --LGS---------------------ADAPILKEPVIIEIAKKNGVSAAQVVISWNVQRG 259
             +G+                     +D  I+K   + E+A+K GVS A +  +W V +G
Sbjct: 243 RPIGTKSLRSESDRFTINKLRDNVLESDIKIVKR--VEELAEKKGVSMAAISTAWVVSKG 300

Query: 260 YIVLPKSVNKERIEANL--LTFTLTSEDFEAVNN 291
              +      ER++  +  L+ T T E+ + + +
Sbjct: 301 CQPIIGLSKTERVDDAISALSVTFTDEELKYLED 334

>Smik_14.1 Chr14 complement(607..1737) [1131 bp, 376 aa] {ON}
           YNL331C (REAL)
          Length = 376

 Score = 33.5 bits (75), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 45/99 (45%), Gaps = 21/99 (21%)

Query: 36  AYDSVIAALRAGYRHIDTAAIYGNEAE---VGRAIRESGVPRGEIFVTTKL--------- 83
           A++ + A   AG   +DTA  Y NE     +G  ++   V R +I + TK          
Sbjct: 55  AFELLDAFYEAGGNCVDTANSYQNEQSETWIGEWMKLRKV-RDQIVICTKYTGDYKKYEA 113

Query: 84  -------WCTQHKEP-ELALDQSLKRLGLDYVDLYLMHW 114
                  +C  H+    +++  SL++L  D++D+  +HW
Sbjct: 114 GDGKSANYCGNHRRSLHVSVRDSLRKLQTDWIDILYIHW 152

>Suva_14.10 Chr14 complement(10349..11479) [1131 bp, 376 aa] {ON}
           YNL331C (REAL)
          Length = 376

 Score = 33.1 bits (74), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 44/99 (44%), Gaps = 21/99 (21%)

Query: 36  AYDSVIAALRAGYRHIDTAAIYGNE---AEVGRAIRESGVPRGEIFVTTKL--------- 83
           A+  + A   AG   IDTA  Y NE   A +G  + ES   R +I + TK          
Sbjct: 55  AFKLLDAFYEAGGNFIDTANTYQNEQSEAWIGEWM-ESRKLRDQIVIATKFSTDYKWYDV 113

Query: 84  -------WCTQHKEP-ELALDQSLKRLGLDYVDLYLMHW 114
                  +C   K    +++  SL++L  D++D+  +HW
Sbjct: 114 GKNRSANFCGNSKHSLHVSVRDSLRKLQTDWIDILYIHW 152

>Smik_4.627 Chr4 complement(1123137..1125149) [2013 bp, 670 aa] {ON}
           YDR362C (REAL)
          Length = 670

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 30/53 (56%), Gaps = 6/53 (11%)

Query: 126 GDKIGFPTLPNGKRDIDITDWNFVKT---WELMQKLPETGKT---RAIGVSNF 172
           GDKI FP LPNG+R+  I +   + T   W  ++K  ETGK     A+ VS +
Sbjct: 267 GDKIEFPVLPNGRRNGFIYNVGGLVTDIAWLNIEKNNETGKEIQYLAVAVSQY 319

>TDEL0F00160 Chr6 (17872..19386) [1515 bp, 504 aa] {ON} 
          Length = 504

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 69/183 (37%), Gaps = 21/183 (11%)

Query: 149 VKTWELMQKLPETGKTRAIGVSNF--SINNLKDLLASPG-NKIVPAANQVEMHPLLPQQE 205
           V  +ELM+     G   A+G   F      + + +  P  NK +   N  E+ PLLP+ +
Sbjct: 297 VGPYELMKLRLLNGTHSAMGYLGFLAGYQYIHEAITDPLINKYIRTMNHEEVIPLLPKIK 356

Query: 206 LVDFCHGKGIVIEAYSP------------LGSADAPILKEPVIIE-IAKKNGVSAAQV-- 250
            +DF      V+E +S             +GS   P    P I E +AK +G        
Sbjct: 357 GIDFGEYSHTVLERFSNPAIKDQVSRICLMGSGKMPKYVLPSITEQLAKADGKYELLTLG 416

Query: 251 VISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKRIIDPDWEPFK 310
           V  W     Y+     V KE    +++  TL     E   N   +   K + D D    K
Sbjct: 417 VAGW---FRYLTGYDMVGKEFEIQDVMASTLIQAAREGGRNPQPLLNIKTLFDADLRDNK 473

Query: 311 PFV 313
            FV
Sbjct: 474 EFV 476

>KLTH0D13750g Chr4 complement(1120534..1121550) [1017 bp, 338 aa]
           {ON} similar to uniprot|Q06494 Saccharomyces cerevisiae
           YPR127W Hypothetical ORF
          Length = 338

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 37/189 (19%), Positives = 76/189 (40%), Gaps = 40/189 (21%)

Query: 150 KTWELMQKLPETGKTRAIGVSNFSINNLKDLLASPGNKIVPAANQVEM-HPLLPQQELVD 208
           +T+E + +  + G    + +S  +   ++ + A  G  I     +  + HP +    +VD
Sbjct: 141 ETFETLVEYIKKGSLGGLSLSEVNAEQIRAIHAKYGEYICCVEVEFSLYHPEILTNGIVD 200

Query: 209 FCHGKGIVIEAYSPL------GSADAP------------------ILKEPVII------E 238
            C+  GI I  YSPL      G+  +P                   LK  + +      E
Sbjct: 201 ACNELGIPIVCYSPLCRGLLTGAITSPEDLKAGDFKSMLKKFKGEALKHNLKLVDFLQKE 260

Query: 239 IAKK--NGVSAAQVVISW-------NVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAV 289
           I  K  +G++   + ++W        +   ++ +P + + +R+E N  ++ LT E+   +
Sbjct: 261 IVSKRSDGLTLPSLALAWIRSFNSKYLGTKFVPIPGASSAKRVEQNFTSYDLTQEELAKI 320

Query: 290 NNISKVQGT 298
           +   K   T
Sbjct: 321 DGFLKTFKT 329

>KAFR0F03890 Chr6 complement(761303..762262) [960 bp, 319 aa] {ON} 
          Length = 319

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 51/276 (18%), Positives = 105/276 (38%), Gaps = 50/276 (18%)

Query: 28  WRSAAATDAYDSVIAALRAGYRHIDTAAIYGN---EAEVGRAIRESGVPRGEIFVTTKLW 84
           W        ++++      G R  DTA  Y N   E  +G  +++  + R  + + TK++
Sbjct: 11  WVEEDKEKVFNTLKYCYDKGLRTFDTADYYSNGYSEILLGEFLKKYKIKRETVVILTKIF 70

Query: 85  CTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRG---ENMPEGDKIGFPTLPNGKRDI 141
               +  +L L +  + +G+D +D+      V  RG   +++ +G K     L      +
Sbjct: 71  FPVDETLDLHLGE--EPIGVDQLDV------VNQRGLSRKHIVDGVKRSVERLGTYIDVL 122

Query: 142 DITDWN----FVKTWELMQKLPETGKTRAIGVSNFSINNLKDL-LASPGNKIVPAANQVE 196
            I  ++      +  + +  + E G  R IG S+       ++   +   +     N   
Sbjct: 123 QIHRFDQDTPIKERMKALNDVVEKGHVRYIGASSMLATEFAEMQFVAEKYEWFQFVNSQS 182

Query: 197 MHPLL---PQQELVDFCHGKGIVIEAYSP---------LGSADAPILKEPVII------- 237
           ++ L+    ++EL+ FC    I +  +SP         +GS       +P +        
Sbjct: 183 LYNLIYREDERELIPFCKRHNIALTPWSPNHQGLLTRPIGSTTERSENDPFVKCTLTKKL 242

Query: 238 ------------EIAKKNGVSAAQVVISWNVQRGYI 261
                       E+AKK   S A +  +W + +G +
Sbjct: 243 EKSDIEIINRVEELAKKKKCSMAVISTAWVISKGCV 278

>NCAS0J01680 Chr10 complement(302247..308384) [6138 bp, 2045 aa]
           {ON} Anc_4.280 YKL182W
          Length = 2045

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 24/45 (53%)

Query: 4   TLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGY 48
           T+S +     +N G  I   G G + +   TDA DSVI+ ++ GY
Sbjct: 601 TVSPDFVAATINAGYQIELAGGGYFSAQGMTDAIDSVISQIKKGY 645

>NDAI0J02670 Chr10 (667719..673874) [6156 bp, 2051 aa] {ON}
           Anc_4.280 YKL182W
          Length = 2051

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 24/45 (53%)

Query: 4   TLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGY 48
           T+S +     +N G  I   G G + +   TDA DSVI+ ++ GY
Sbjct: 609 TVSPDFVAATINAGYQIELAGGGYFSAQGMTDAIDSVISQIKKGY 653

>Suva_13.210 Chr13 complement(341369..342400) [1032 bp, 344 aa] {ON}
           YMR041C (REAL)
          Length = 344

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 10/81 (12%)

Query: 43  ALRAGYRHIDTAAIYG-NEAEVGRAIR--ESGVPRGEIFVTTKL-------WCTQHKEPE 92
           A   G   IDT+  YG +E   G+A+   +   PR   F+ TK+       +    +   
Sbjct: 57  AFTHGINAIDTSPYYGPSEILYGKALNNLKDDFPRNTYFICTKVGRIAEDDFDYSREFVR 116

Query: 93  LALDQSLKRLGLDYVDLYLMH 113
            ++ +S KRL   Y+DL  +H
Sbjct: 117 FSVHRSCKRLNTTYLDLVYLH 137

>Skud_3.179 Chr3 (292171..293205) [1035 bp, 344 aa] {ON} YPL088W
           (REAL)
          Length = 344

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 63/299 (21%), Positives = 110/299 (36%), Gaps = 64/299 (21%)

Query: 46  AGYRHIDTAAIYGN---EAEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRL 102
            G R  DTA +Y N   E  +G  ++   + R  + + TK++          +D+SL+  
Sbjct: 54  GGMRTFDTADVYSNGLSERILGEFLKHYKIKRETVVILTKVY--------YPVDESLELT 105

Query: 103 GLDYVDLYLMHWPVRMRG----------ENMPEGDKIGFPTLPNGKRDIDITDWNFVKTW 152
               V  + M   V   G          +N  E        L   K D D      +K  
Sbjct: 106 HFGKVSEFDMLGLVNQSGLSRKHILEAAKNSVERLGTYIDVLQIHKLDHDTPMEEIMKA- 164

Query: 153 ELMQKLPETGKTRAIGVSNFSINNLKDL--LASPGN--KIVPAANQVEMHPLLPQQELVD 208
             +  + E G TR IG S+       +L  +A   +  K + + +   +     ++EL+ 
Sbjct: 165 --LNGVVELGYTRYIGASSMLATEFAELQFIAEKRDWTKFICSQSCYSLLYREDERELIP 222

Query: 209 FCHGKGIVIEAYSPLGSADAPILKEPV-------------------------------II 237
           F    GI +  +SP       IL  P+                               + 
Sbjct: 223 FAKKHGIGLIPWSPNARG---ILTRPLNQATDRKNSDPTFKRLKFDCLESHEKGIVNRVE 279

Query: 238 EIAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANL--LTFTLTSEDFEAVNNISK 294
           E+AKK G+S A V I+W + +G   +    + ER++  +  +   LT E+ + +  + K
Sbjct: 280 ELAKKKGISMAMVSIAWVLSKGACPIVGLNSIERVDEAIRAVNVQLTEEEIQYLEELYK 338

>SAKL0H09438g Chr8 (803426..804454) [1029 bp, 342 aa] {ON} highly
           similar to uniprot|Q02895 Saccharomyces cerevisiae
           YPL088W Putative aryl alcohol dehydrogenase
           transcription is activated by paralogous transcription
           factors Yrm1p and Yrr1p along with genes involved in
           multidrug resistance
          Length = 342

 Score = 30.0 bits (66), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 238 EIAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANL--LTFTLTSED 285
           EIA+K GV+ A V I+W + +G   +    + ER++  +  + F LT E+
Sbjct: 278 EIAEKRGVTMAVVSIAWVLSKGCYPIVGLSSTERVDETIKAVEFKLTEEE 327

>KLLA0B09658g Chr2 complement(837873..838901) [1029 bp, 342 aa] {ON}
           similar to uniprot|Q06494 Saccharomyces cerevisiae
           YPR127W
          Length = 342

 Score = 29.6 bits (65), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 28/120 (23%), Positives = 51/120 (42%), Gaps = 20/120 (16%)

Query: 106 YVDLYLMHWPVRMRGENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTR 165
           YVD+Y    P R+  E + +  +  FP                 +T++ + +  + GK  
Sbjct: 120 YVDIY---EPARLDLELIKKTGESVFPR----------------ETFDTIVEYVKKGKIG 160

Query: 166 AIGVSNFSINNLKDLLASPGNKIVPAANQVEMHPL-LPQQELVDFCHGKGIVIEAYSPLG 224
            I +S  +   ++ +    G  +V    ++ M    +    +VD C+  G+ I AYSPLG
Sbjct: 161 GISLSEVTAEQIRAIHKEYGEYLVCVEVELSMFSAEILSNGIVDTCNELGLPIVAYSPLG 220

>Smik_3.208 Chr3 (305264..306298) [1035 bp, 344 aa] {ON} YPL088W
           (REAL)
          Length = 344

 Score = 29.6 bits (65), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 32/59 (54%), Gaps = 2/59 (3%)

Query: 238 EIAKKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANL--LTFTLTSEDFEAVNNISK 294
           E+AKK G+S A V I+W + +G   +    + ER++  +  +   LT E+ + +  + K
Sbjct: 280 EVAKKKGISMAMVSIAWVLSKGACPIVGLNSIERVDEAIRAVDVQLTEEEIQYLEELYK 338

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,397,713
Number of extensions: 1389722
Number of successful extensions: 3814
Number of sequences better than 10.0: 151
Number of HSP's gapped: 3520
Number of HSP's successfully gapped: 154
Length of query: 313
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 204
Effective length of database: 40,982,805
Effective search space: 8360492220
Effective search space used: 8360492220
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)