Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0C049005.435ON76976939370.0
TDEL0E019005.435ON7628414806e-50
NCAS0F033905.435ON8617104623e-47
NDAI0B056805.435ON8567274127e-41
Smik_4.6355.435ON8637233879e-38
KAFR0E038305.435ON8454273718e-36
YDR369C (XRS2)5.435ON8544063654e-35
ZYRO0F10054g5.435ON6603813527e-34
KLTH0F16038g5.435ON7927043404e-32
SAKL0G02552g5.435ON8344533112e-28
Suva_2.5415.435ON8694013093e-28
Skud_4.6385.435ON8433952923e-26
Kpol_1016.55.435ON8124002701e-23
TPHA0J025905.435ON7757072551e-21
CAGL0A02838g5.435ON8282132522e-21
Kwal_55.214225.435ON7824012389e-20
TBLA0A028205.435ON9251112381e-19
KLLA0E02201g5.435ON8353922155e-17
AER402C5.435ON8691181701e-11
Ecym_47615.435ON7981201638e-11
KLTH0A05918g6.306ON89650890.054
Suva_7.5795.8ON31368742.2
KAFR0E039505.422ON746148725.8
KAFR0A002702.643ON44783716.7
SAKL0G10054g5.310ON580111708.0
Ecym_63301.287ON48092709.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0C04900
         (769 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0C04900 Chr3 (946975..949284) [2310 bp, 769 aa] {ON} Anc_5.4...  1521   0.0  
TDEL0E01900 Chr5 (359266..361554) [2289 bp, 762 aa] {ON} Anc_5.4...   189   6e-50
NCAS0F03390 Chr6 complement(683109..685694) [2586 bp, 861 aa] {O...   182   3e-47
NDAI0B05680 Chr2 complement(1384354..1386924) [2571 bp, 856 aa] ...   163   7e-41
Smik_4.635 Chr4 complement(1135040..1137631) [2592 bp, 863 aa] {...   153   9e-38
KAFR0E03830 Chr5 (759871..762408) [2538 bp, 845 aa] {ON} Anc_5.4...   147   8e-36
YDR369C Chr4 complement(1215016..1217580) [2565 bp, 854 aa] {ON}...   145   4e-35
ZYRO0F10054g Chr6 complement(814872..816854) [1983 bp, 660 aa] {...   140   7e-34
KLTH0F16038g Chr6 (1302028..1304406) [2379 bp, 792 aa] {ON} weak...   135   4e-32
SAKL0G02552g Chr7 complement(209978..212482) [2505 bp, 834 aa] {...   124   2e-28
Suva_2.541 Chr2 complement(965557..968166) [2610 bp, 869 aa] {ON...   123   3e-28
Skud_4.638 Chr4 complement(1137885..1140416) [2532 bp, 843 aa] {...   117   3e-26
Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON} (10036.....   108   1e-23
TPHA0J02590 Chr10 complement(574619..576946) [2328 bp, 775 aa] {...   102   1e-21
CAGL0A02838g Chr1 complement(297872..300358) [2487 bp, 828 aa] {...   101   2e-21
Kwal_55.21422 s55 (830578..832926) [2349 bp, 782 aa] {ON} YDR369...    96   9e-20
TBLA0A02820 Chr1 (678796..681573) [2778 bp, 925 aa] {ON} Anc_5.4...    96   1e-19
KLLA0E02201g Chr5 complement(205466..207973) [2508 bp, 835 aa] {...    87   5e-17
AER402C Chr5 complement(1407938..1410547) [2610 bp, 869 aa] {ON}...    70   1e-11
Ecym_4761 Chr4 (1479649..1482045) [2397 bp, 798 aa] {ON} similar...    67   8e-11
KLTH0A05918g Chr1 complement(487673..490363) [2691 bp, 896 aa] {...    39   0.054
Suva_7.579 Chr7 complement(1012777..1013718) [942 bp, 313 aa] {O...    33   2.2  
KAFR0E03950 Chr5 (781992..784232) [2241 bp, 746 aa] {ON} Anc_5.4...    32   5.8  
KAFR0A00270 Chr1 (51990..53333) [1344 bp, 447 aa] {ON} Anc_2.643...    32   6.7  
SAKL0G10054g Chr7 (853800..855542) [1743 bp, 580 aa] {ON} simila...    32   8.0  
Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar t...    32   9.7  

>KNAG0C04900 Chr3 (946975..949284) [2310 bp, 769 aa] {ON} Anc_5.435
           YDR369C
          Length = 769

 Score = 1521 bits (3937), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 741/769 (96%), Positives = 741/769 (96%)

Query: 1   MWILRYSYESEDHGTVYVSCCLQRSRNYSIGRSSKTNALVIKNDKSISRQHISFQWVSHD 60
           MWILRYSYESEDHGTVYVSCCLQRSRNYSIGRSSKTNALVIKNDKSISRQHISFQWVSHD
Sbjct: 1   MWILRYSYESEDHGTVYVSCCLQRSRNYSIGRSSKTNALVIKNDKSISRQHISFQWVSHD 60

Query: 61  YVDIVNDGKLTYINDAFLKPKETTRISISASKETNIKVGSAPVIVNLVWEDVFIDMTPIS 120
           YVDIVNDGKLTYINDAFLKPKETTRISISASKETNIKVGSAPVIVNLVWEDVFIDMTPIS
Sbjct: 61  YVDIVNDGKLTYINDAFLKPKETTRISISASKETNIKVGSAPVIVNLVWEDVFIDMTPIS 120

Query: 121 DTGQSLKLIGIYPAGSTHGVNIEDAMKTLCIKIKEIKWPHQLIALIRGANRLYKADLVDL 180
           DTGQSLKLIGIYPAGSTHGVNIEDAMKTLCIKIKEIKWPHQLIALIRGANRLYKADLVDL
Sbjct: 121 DTGQSLKLIGIYPAGSTHGVNIEDAMKTLCIKIKEIKWPHQLIALIRGANRLYKADLVDL 180

Query: 181 MAQQLVDSNENISSFDEIWNRTVDSGQYKEYPNFKVDRNSFRDFTIIYFDNNDSDISGVR 240
           MAQQLVDSNENISSFDEIWNRTVDSGQYKEYPNFKVDRNSFRDFTIIYFDNNDSDISGVR
Sbjct: 181 MAQQLVDSNENISSFDEIWNRTVDSGQYKEYPNFKVDRNSFRDFTIIYFDNNDSDISGVR 240

Query: 241 SCVEFCGGTLLSFVNNESFEKYASTNETLHNVLLLRSERFQVSHPVYEILNKIDICSTGS 300
           SCVEFCGGTLLSFVNNESFEKYASTNETLHNVLLLRSERFQVSHPVYEILNKIDICSTGS
Sbjct: 241 SCVEFCGGTLLSFVNNESFEKYASTNETLHNVLLLRSERFQVSHPVYEILNKIDICSTGS 300

Query: 301 FFKAVTENNVSTLVHRELFLRRYTDITQKEMRRPKEPVEDTAVPLKKRRLNRRKVQPLNP 360
           FFKAVTENNVSTLVHRELFLRRYTDITQKEMRRPKEPVEDTAVPLKKRRLNRRKVQPLNP
Sbjct: 301 FFKAVTENNVSTLVHRELFLRRYTDITQKEMRRPKEPVEDTAVPLKKRRLNRRKVQPLNP 360

Query: 361 LEFFAGGDTATTTKQSSDDGLAATKAVDETEVSDKMHGSGDVLSNSTNNNQDTVATQGKI 420
           LEFFAGGDTATTTKQSSDDGLAATKAVDETEVSDKMHGSGDVLSNSTNNNQDTVATQGKI
Sbjct: 361 LEFFAGGDTATTTKQSSDDGLAATKAVDETEVSDKMHGSGDVLSNSTNNNQDTVATQGKI 420

Query: 421 SPILEMNALSAEVPKGDESSHVVEPDRTYEKDDCLPDNLEVNGMMKEPEPVIEKTRQSSI 480
           SPILEMNALSAEVPKGDESSHVVEPDRTYEKDDCLPDNLEVNGMMKEPEPVIEKTRQSSI
Sbjct: 421 SPILEMNALSAEVPKGDESSHVVEPDRTYEKDDCLPDNLEVNGMMKEPEPVIEKTRQSSI 480

Query: 481 NESLRTPKXXXXXXXXXXXXXXXXXXPTHLKASREASKIVGPESLAPSRDTEVLRPRPAK 540
           NESLRTPK                  PTHLKASREASKIVGPESLAPSRDTEVLRPRPAK
Sbjct: 481 NESLRTPKEPVAEMEDELEEVDEVDEPTHLKASREASKIVGPESLAPSRDTEVLRPRPAK 540

Query: 541 PRNSSSLVETIQSVKDNETRRLQCTLTPVDPSELTDEAIADFSNMAIVEPTVNIVRKKPA 600
           PRNSSSLVETIQSVKDNETRRLQCTLTPVDPSELTDEAIADFSNMAIVEPTVNIVRKKPA
Sbjct: 541 PRNSSSLVETIQSVKDNETRRLQCTLTPVDPSELTDEAIADFSNMAIVEPTVNIVRKKPA 600

Query: 601 MVTESSIRSDRPNFKKFMKVWPKARKGNDSLRNNAYLITRDYVPMKAYNRNEPKVFDEFE 660
           MVTESSIRSDRPNFKKFMKVWPKARKGNDSLRNNAYLITRDYVPMKAYNRNEPKVFDEFE
Sbjct: 601 MVTESSIRSDRPNFKKFMKVWPKARKGNDSLRNNAYLITRDYVPMKAYNRNEPKVFDEFE 660

Query: 661 NVTKAGILPDIIEPPIQPSQSLNHDTPPLLDDKAVSENELFVAEDSDEDEIPAEHARYTD 720
           NVTKAGILPDIIEPPIQPSQSLNHDTPPLLDDKAVSENELFVAEDSDEDEIPAEHARYTD
Sbjct: 661 NVTKAGILPDIIEPPIQPSQSLNHDTPPLLDDKAVSENELFVAEDSDEDEIPAEHARYTD 720

Query: 721 TLPKEAARPRRRLLTTEEQADNSTTHLTXXXXXXXXXXQGPRFKFSRRS 769
           TLPKEAARPRRRLLTTEEQADNSTTHLT          QGPRFKFSRRS
Sbjct: 721 TLPKEAARPRRRLLTTEEQADNSTTHLTSSGDESDSDDQGPRFKFSRRS 769

>TDEL0E01900 Chr5 (359266..361554) [2289 bp, 762 aa] {ON} Anc_5.435
           YDR369C
          Length = 762

 Score =  189 bits (480), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 224/841 (26%), Positives = 369/841 (43%), Gaps = 154/841 (18%)

Query: 1   MWILRYSYESEDHGTVYVSCCLQRSRNYSIGRSSKTNALVIKNDKSISRQHISFQWVSH- 59
           MWIL+Y+YE ED     VS CL + + +SIGRSSK N L IKNDKSISR HIS  W S  
Sbjct: 1   MWILKYTYELEDGTIRRVSSCLVKQQTFSIGRSSK-NPLNIKNDKSISRNHISVVWDSEV 59

Query: 60  DYVDIVNDGKLTYINDAFLKPKETTRI--SISASKETNIKVGSAPVIVNLVWEDVFIDM- 116
             + ++N G+LT     +LK  E+      +   +   I++G+ P+ V +VW+DV  D+ 
Sbjct: 60  KLIRLINQGRLTAAGGKYLKVGESMDFEEKLHIREPIIIELGTKPIKVEVVWQDVVFDLP 119

Query: 117 TPISDTGQSLKLIGIYPAGSTHGVNIE--DAMKTLCIKIKEIKWPHQ-LIALIRGA---N 170
           + +S    +L  +GI       GV  +  D   T  I   +IK+ ++ L  LI GA   N
Sbjct: 120 SQLSQFIDTLDHVGI-------GVKADTVDNRSTTIIVTDKIKFAYKCLFGLINGAVIRN 172

Query: 171 RLYKADLVDLMAQQLVDSNENISSFDEIWNRTVDSGQYKEYP-NFKVDRNSFRDFTIIYF 229
             +  ++ +++++         ++F+E W+  + +  Y  YP N        + +     
Sbjct: 173 SQFLVEVTNILSKP-------TTTFEESWDSLIQNESYMLYPNNLGPHEVILKGYKFYLI 225

Query: 230 DNNDSDISGVRSCVEFCGGTLLSFVNNES-FEKYASTNETLHNVLLLRSERFQVSHPVYE 288
            ++   ++ V+  +E   G L+   N E   ++    N T   ++L   E  ++      
Sbjct: 226 ASDVITMAYVQEALERGNGELIVVENTEQLLDRLKQENSTDDLIVLKAEETTKIPG---- 281

Query: 289 ILNKIDICSTGSFFKAVTENNVSTLV----------------HRELFLRRYTDITQKEMR 332
             +KI + +      AV+ N V TL+                H+    +  T+++  +  
Sbjct: 282 --DKIKLHTLVDLVNAVSHNTVKTLLGGVPPMEAGPGDVIGSHQPTLTK--TEVSSSQSL 337

Query: 333 RPKEPVEDTAV------PLKKRRLNRRKVQPLNPLEFFAGGDTATTTKQSSDDGLAATKA 386
             KE   +  V      P+K+RR NR  V+PL+ L FFAGGD +T   +       +T+ 
Sbjct: 338 SNKEHTPEHTVTPAEKPPVKRRRYNR--VKPLDSLMFFAGGDYSTEEPEQE----ISTQP 391

Query: 387 VDETEVSDKMHGSGDVLSNSTNNN--QDTVATQGKISP--ILEMNA--LSAEVPKGDESS 440
           V+    SD    S     N   N+  Q++ A   K  P  +L+ +A  L+ + P    ++
Sbjct: 392 VNPA-ASDTAKTSITTQINVPENDASQESSAFD-KFQPNIVLKNSAKPLTIDSPGDAHNT 449

Query: 441 HVVEPDRTYEKDDCLPDNLEVNGMMKEPEPVIEKTRQSSINESLRTPKXXXXXXXXXXXX 500
           H +     + KD  +   +E+N    E     +++ Q+++N    TP+            
Sbjct: 450 HEINTANQHVKD--IAQQIEMNHPESE-----QQSEQANLNMVETTPR------------ 490

Query: 501 XXXXXXPTHLKASRE--ASKIVGPESLAPSRDTEVLRPRPAKPRNSSSLVETIQSVKDNE 558
                 PT  K + +   S +  P++ A S               +  LV+ I+  K  E
Sbjct: 491 ------PTARKKTLQDFKSTVNNPDNSASS---------------TEGLVDLIKDAKSRE 529

Query: 559 TRRLQCTLTPVDPSELTDEAIADFSNMAIVEPTVNIVRKKPAMVTESSIRSD-------R 611
            +RL+ TL  VD  ELT++AI    ++AIV+P  +++R++     E+S R+D       R
Sbjct: 530 VKRLKSTLVQVDTDELTEDAINQLGDLAIVQPNDSLIRRQKIDSAETS-RNDQHPPWDGR 588

Query: 612 PNFKKFMKVWPKARK----------GNDSLRNNAYLITRDYVPMKAYNRNEPKVFDEF-- 659
            NFK F+KV  K ++           +D +RN+ YL+TR YVP K Y +   K   +F  
Sbjct: 589 KNFKNFVKVQAKYKEQRMGENYREGSSDFIRNSGYLLTRQYVPSKIYTKESSKEMQDFPE 648

Query: 660 --ENVTKAGILPDIIEPPIQPSQSLNHDTPPLLDDKAVS----ENELFVAEDSDEDEIPA 713
             E  ++   +P +I+ P         D  P    +  S     N LFV ++ D      
Sbjct: 649 ASEQTSRQFSVPQVIDDP--------EDAEPFTFTRHTSGTPANNGLFVVDEDDSQNDVV 700

Query: 714 EHARYTDTLPKEAAR-----PRR-RLLTTEEQADNSTTHLTXXXXXXXXXXQGPRFKFSR 767
             AR +   P+EA +     PRR R L             +            P+FKFSR
Sbjct: 701 LAARES-IRPEEAVQLVDPSPRRSRSLPYSPGKRKRENRRSPYDDDDDEDDDEPKFKFSR 759

Query: 768 R 768
           R
Sbjct: 760 R 760

>NCAS0F03390 Chr6 complement(683109..685694) [2586 bp, 861 aa] {ON}
           Anc_5.435 YDR369C
          Length = 861

 Score =  182 bits (462), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 195/710 (27%), Positives = 321/710 (45%), Gaps = 113/710 (15%)

Query: 1   MWILRYSYESEDHGTVYVSCCLQRSRNYSIGRSSKTNALVIKNDKSISRQHISFQWVSHD 60
           MW+LRY Y+ ED  T  +S C+Q+S  Y+IGRS+K N L IKNDKSISRQH+S +W   +
Sbjct: 1   MWVLRYQYDLEDGSTQKISRCIQKSVCYTIGRSNK-NHLSIKNDKSISRQHLSLKWEDRN 59

Query: 61  YVDIVNDGKLTYINDAFLKPKETTRISISASKETNIKVGSAPVIVNL-VWEDVFIDMTPI 119
            + I+N GKLTYI + +L   ++  ++       +IK+G+ PV+V+L  +   ++    +
Sbjct: 60  DIHIINQGKLTYIGEQYLDVGQS--LTFGNVNSLSIKLGTKPVMVHLEFYSSNWLIPNGL 117

Query: 120 SDTGQSLKLIGIYPAGSTHGVNIEDAMKTLCIKIKEIKWPHQLIALIRGANRL-YKADLV 178
           +   ++LK  G+  A         D    + + + EI     LI L      +  K    
Sbjct: 118 TQFHETLKDFGVNVATQIP----VDQKTQIDLIVDEING-SGLIPLWGFMKDIPVKKPQF 172

Query: 179 DLMAQQLVDSNENISSFDEIWNRTVDSGQ---YKEYPNFKVDRNSFRDFTI-IYFDN--N 232
              A +++ SN+N   FD  W+R  ++        Y + K     F ++ I I FDN  N
Sbjct: 173 FSTACEILSSNDN--DFDNSWHRLQETSNTLFCSHYISLKDRSRLFENYVILILFDNETN 230

Query: 233 DSDISGVRSCVEFCGGTLLSFVNNESFEKYASTNE--TLHNVLLLRSERFQVSH---PVY 287
              +  +++ +   G  +  F +  + + Y +  +  T  ++ L++   F+  +   P  
Sbjct: 231 KDAVKTLKTALNLGGAIVNDFSDLNASKDYINNLKPTTNQHICLVKFGSFKSPNDQLPDL 290

Query: 288 EILNKIDICST---GSFFKAVTENNVSTLVHRELFLR--------------RYTDIT--- 327
           E     DI +        K +T     T+  RE  +               R T+I    
Sbjct: 291 EYFKLEDIITAIRDDKIMKLIT-----TIPEREQVMNQDVSLIPEITYPSDRKTNIQPSH 345

Query: 328 ---------QKEMRRPKEPVEDTAVP--LKKRRLNRRKVQPLNPLEFFAGGDTATTTKQS 376
                    +K +   ++P E T V   +KKRRLNR++V+PL+ L FFAGG +      +
Sbjct: 346 HTVDSIHNDKKNVLSNRDPGEATLVNPIVKKRRLNRQRVKPLDSLAFFAGGASPKIGSPA 405

Query: 377 SDDGLAATKAVDETEVSDKMHGSGDVLSNSTNNNQDTVATQGKISPILEMNALSAEVPKG 436
             +   ATK  DE+  SDK   + + L+  + N+Q  + ++    PI     +  EV + 
Sbjct: 406 VQETAQATK--DESAESDKFR-TNNGLTQPSGNSQPLIHSE----PI-----VLKEVLEA 453

Query: 437 DESSHVVEPDRTYEKDDCLPDNLEVNGMMKEPEPVIEKTRQSSINESLRTPKXXXXXXXX 496
           D + ++ E   T      +P    +     +P    E+ + S I     TP         
Sbjct: 454 DHNKNIQEGPTT-----AVP---VIQSKSTQPLEHTEQNKNSEIGSVAATPTPEVLTGNG 505

Query: 497 XXXXXXXXXXPTH-LKASREASKIVGPESLAPSRDTEVLRPRPAKPRNSSSLVETIQSVK 555
                      T  L ++ +  K +   SL   +                S V+ IQ  K
Sbjct: 506 VERPNTPQVPSTQALVSNHKEKKNLKSNSLEEPK----------------SFVQAIQETK 549

Query: 556 DNETRRLQCTLTPVDPSELTDEAIADFSNMAIVEPTVNIVRKKPAMV---------TESS 606
           + E  RL+ T+  +D  ELT+ AI    ++ IVEP  +++RKK +           ++ +
Sbjct: 550 NREVTRLKSTMVEIDTDELTEGAINQLGSLVIVEPNQSLIRKKASRCECRTPTGEDSDKT 609

Query: 607 IR--SDRPNFKKFMKVWPKARKGN------DSLRNNAYLITRDYVPMKAY 648
            R  S R NFKKF+K++PK  K +      D +RNNA+LITR+YVPMK +
Sbjct: 610 AREWSRRKNFKKFVKIYPKYMKKDTESDTTDLIRNNAFLITRNYVPMKKF 659

>NDAI0B05680 Chr2 complement(1384354..1386924) [2571 bp, 856 aa]
           {ON} Anc_5.435 YDR369C
          Length = 856

 Score =  163 bits (412), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 196/727 (26%), Positives = 312/727 (42%), Gaps = 131/727 (18%)

Query: 1   MWILRYSYESEDHGTVYVSCCLQRSRNYSIGRSSKTNALVIKNDKSISRQHISFQWVSHD 60
           MWILRY Y  ED G   VS CL+RS  YSIGRSSK N L IKNDKSISRQHI+ +W    
Sbjct: 1   MWILRYQYGLEDGGIKKVSICLERSIAYSIGRSSK-NPLSIKNDKSISRQHITIKWEPSG 59

Query: 61  YVDIVNDGKLTYINDAFLKPKETTRISISASKETNIKVGSAPVIVNLVWEDVFIDMTPIS 120
            + +VN GKLT + + +L   E+   ++  +KE ++ +G+ PVIV + W+ + + +  + 
Sbjct: 60  QLHLVNQGKLTSVKERYLAIDESLIFNVVDTKELDVHLGTNPVIVQIRWQPMNLYIPNMY 119

Query: 121 DTGQSLKLIGIYPAGSTHGVNIEDAMKTLCIKIKEIKWPHQLIALIRGANRLYKADLVDL 180
           +  Q   L+  Y    T  +  ED+  T  +      +   L+AL  G   ++K+  +  
Sbjct: 120 E--QFRGLLTKYGIEVTSDILQEDSHITAVVMTPN-DYYVPLLALALGI-PVFKSQYLTE 175

Query: 181 MAQQLVDSNENISSFDEIWNRTVDSGQYKEYPNFKVDRNS---FRDFTIIYFDNNDS--- 234
           ++  L   N    +FD    +       K  P+F +  NS   F+D+  I   N  S   
Sbjct: 176 VSNMLRPDN---ITFDTDVQKINSMESLKLVPSFSLSNNSKNFFQDYFFIITLNKSSVSE 232

Query: 235 --DISGV-RSCVEFCGGTLLSFVN----NESFEKYASTNETLHNVLLLRSE----RFQVS 283
             D S + R  ++  GG      +      S  K  ST  +  N++++  E    R  ++
Sbjct: 233 HADKSFILRKSLQLIGGEEEIIKDPTELQNSVTKILST--SGKNIVIVTDEDNGKRMIMN 290

Query: 284 HPVYEILNKIDICSTGSFFK--------AVTENNVSTLVHRELFLRRYTDITQKEMRRPK 335
              +E  N  DI    SF K         +TE  V +    E+F        +K M   +
Sbjct: 291 ---FECRNVKDIFD--SFVKNDPKLLKSNLTETGVVSPKAPEIFE------NEKLMVEIQ 339

Query: 336 EPVEDTAV----------------PLKKRRLNRRK-----VQPLNPLEFFAGGDTATTTK 374
           EP  + A+                P+    + +R+     V+PL  L+FF GG T  T  
Sbjct: 340 EPPIEAAITEESTSSKNLKHTPPEPVTTHIVKKRRLARKRVKPLESLDFFVGGSTTGTPF 399

Query: 375 QSSDDGLAATKAVDETEVSDKMHGSGDVLSNSTNNNQDTVATQGKISPILEMNALSAEVP 434
           ++S   L   + + E +V D                         ++PIL      ++V 
Sbjct: 400 ETSSTTLQ--QEIIEPKVPD-------------------------VAPILNEQIQQSQVN 432

Query: 435 KG--DESSHVVEPDRTYEKDDCLPDNLEVNGMMKEPEPVIEKTRQSSINESLRTPKXXXX 492
           K   + +  +     +  K+        ++  M+EP   I+      I+ S   P     
Sbjct: 433 KSINEPAKDIYSIGGSDRKETAALTYATIDKHMQEPTQQIDDIPSQHIDIS---PHGNSN 489

Query: 493 XXXXXXXXXXXXXXPTHLKASREASKIVGPESLAPSRDTEVLRPRPAKPRNSSSLVETIQ 552
                          T      +  KI   ++L   +  +  R     P++    ++ I 
Sbjct: 490 EQEKRSNSSEKSPMITQQVNDEKDEKISNAKALKIGKREDSKRYSETTPKSMVETIQDI- 548

Query: 553 SVKDNETRRLQCTLTPVDPSELTDEAIADFSNMAIVEPTVNIVRK-----KPAMVTESSI 607
             K+ E  RLQ ++  VD  ELT++AI +FSN+AIVE   +++R+          T S +
Sbjct: 549 --KNREVTRLQSSIAHVDAEELTEDAINEFSNLAIVESNASLIRRTENNDNTNKSTNSVV 606

Query: 608 RSDRP-----------NFKKFMKVWPK-ARKGNDS------------LRNNAYLITRDYV 643
           R D P           NFK+F+KV+PK  +  NDS            +RNNA+LITR+YV
Sbjct: 607 RHDSPDNIMNVLEGRRNFKRFVKVYPKYIQNKNDSNNERGDNGASDFIRNNAFLITRNYV 666

Query: 644 PMKAYNR 650
           P+K Y++
Sbjct: 667 PLKQYSK 673

>Smik_4.635 Chr4 complement(1135040..1137631) [2592 bp, 863 aa] {ON}
           YDR369C (REAL)
          Length = 863

 Score =  153 bits (387), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 192/723 (26%), Positives = 323/723 (44%), Gaps = 114/723 (15%)

Query: 1   MWILRYSYESEDHGTVYVSCCLQRSRNYSIGRSSKTNALVIKNDKSISRQHISFQWVS-- 58
           MW++RY    ED     +SCCLQ S++YSIGRSSK N L+IK+DKSISRQHI+ +W S  
Sbjct: 1   MWVVRYQNILEDGTISVISCCLQASKSYSIGRSSK-NPLIIKHDKSISRQHITLKWQSNS 59

Query: 59  -----HDYVDIVNDGKLTYINDAFLKPKETTRI-SISASKETNIKVGSAPVIVNLVWEDV 112
                H+ + ++N GKLT IN+ F+K  ET  I ++  S  T I++G+ P+ + + W++ 
Sbjct: 60  GSDSNHNSLCLINQGKLTSINNKFMKVGETFIIEALGVSNSTFIELGATPIRIEVEWKNQ 119

Query: 113 FIDM-TPISDTGQSLKLIGIYPAGSTHGV--NI---------EDAMKTLCIKIKEIKWPH 160
             ++ + ++    +L   GI    S + V  NI         ++ ++ LC   + I    
Sbjct: 120 VWNIPSHLAQFRTALSQFGISTETSINEVPTNIMISDYPSSDDNVIRELCALAENIPLKK 179

Query: 161 QLIALIRGANRLYKADLVDLMAQQLVDSNENISSFDEIWNRTVDSGQYKEY---PNFKVD 217
             + L++  N L  A + DL             +FDE WN  V S +Y  +   P+    
Sbjct: 180 SQL-LVKLCNTLLSASITDL-------------TFDERWNDIVKSPEYDVFDANPDLLFS 225

Query: 218 R-NSFRDFTIIYFDNNDSDISGVRSCVEFCGGTLLSFVNNESFEKYASTNETLHNVLLLR 276
           +     D TI+   +N+  +    S +      L  FV+  S  K+  + +     L+L 
Sbjct: 226 KFMKLSDITILTTISNEPYLP---SILRRFNIKLFDFVDINSLYKHVDSLKPSTKYLILT 282

Query: 277 SERFQVSHPVYEILNKIDICSTGSFFKAVTENNVSTLVHRELFLRRYTDITQKEMRRPKE 336
           S   + +  +        +C+T     ++ ++ ++++++ +       +  +  +R P++
Sbjct: 283 SMNKKENGQI--------LCTTKCLLTSLIKDTLASVINTKSVSFEAPN-NETPVRDPEK 333

Query: 337 ---------PVEDTAVPL--KKRRLNRRKVQPLNPLEFFAGGDTATTTKQSSD------- 378
                     +E  A P+  KKRRLNRR+V PL+ L FFAGG     + +S D       
Sbjct: 334 LSSASKIHHTIETEASPVILKKRRLNRRRVLPLDSLNFFAGGLNVKASSESKDITDVKES 393

Query: 379 -DGLAATKAVDETEVSDKMHGSGDVLSNSTNNNQDTVATQGKISPILEMNALSAEVPKGD 437
             GL + K+V  + +  +      ++S      QDT    G I      N+  A +    
Sbjct: 394 RCGLDS-KSVISSPIIGRAEEKHSLIS------QDTQKVAGDIEKENGHNSTGAIIVSSP 446

Query: 438 ESSHVVEPDRTYEKDDCLPDNLEVNGMMKEPEPV------IEKTRQSSINESLRTPKXXX 491
           ES  V    R     D  P     N   ++ +         E    SS+ E   T     
Sbjct: 447 ESDAVRTSKRFL---DISPQQSSTNMTRRDSQKKSADFVNFETAATSSMEEDKATKAYSI 503

Query: 492 XXXXXXXXXXXXXXXPTHLKASREASKIVGPESLAPSRDTEVLRPRPAKPRNSSSLVETI 551
                                S++ S  +  +  +P ++    R + + P    S V+ I
Sbjct: 504 TGHPTHSVTQTSEGSHELFNYSQKLSFPLKADLESPVKEVS-FREKSSAPH---SFVQAI 559

Query: 552 QSVKDNETRRLQCTLTPVDPSELTDEAIADFSNMAIVEPTVNIVRKKP----AMVTESS- 606
           Q  K  E +R++ T+  ++  EL++EAI     +AIVE   +++RK P      V+ S+ 
Sbjct: 560 QQTKKREVKRVKSTIVELEDDELSEEAINQLERLAIVEANNDLLRKLPDYRLNTVSSSTE 619

Query: 607 ------IRSD---RPNFKKFMKVWPKAR----------KGNDSLRNNAYLITRDYVPMKA 647
                 IR +   R NFK F+K WPK +          + +D +R  A+LITR+YVP+K 
Sbjct: 620 KGGNGVIRQEWQRRKNFKTFVKAWPKFKAQKEGSKNDTQKSDFIRGAAFLITRNYVPLKK 679

Query: 648 YNR 650
           Y++
Sbjct: 680 YSK 682

>KAFR0E03830 Chr5 (759871..762408) [2538 bp, 845 aa] {ON} Anc_5.435
           YDR369C
          Length = 845

 Score =  147 bits (371), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 128/427 (29%), Positives = 191/427 (44%), Gaps = 66/427 (15%)

Query: 1   MWILRYSYESEDHGTVYVSCCLQRSRNYSIGRSSKTNALVIKNDKSISRQHISFQWVSHD 60
           MWILRY  E ED     VSCCLQ+ + YSIGRSSK N L IKNDKSISRQHI+ +W  ++
Sbjct: 1   MWILRYENELEDGTLRKVSCCLQKWKMYSIGRSSK-NPLTIKNDKSISRQHITIRWDCNN 59

Query: 61  -----YVDIVNDGKLTYINDAFLKPKETTRISISASKETNIKVGSAPVIVNLVWEDVFID 115
                 + +VN GKLT I++ ++K  E+            +K+G+ PV+V + W  +F D
Sbjct: 60  EGTGTVLSVVNQGKLTAIDENYMKSDESKAFDDETYSTVVVKLGTKPVVVRISWTPIFWD 119

Query: 116 MTP-ISDTGQSLKLIGIYPAGSTHGVNIEDAMKTLCIKIKEIKWPHQLIALIRGANRLYK 174
           ++       +S+  +GI         N+ D   +L I  ++  W   + AL++    L K
Sbjct: 120 LSKDFLQFEKSINSMGI--CTQMQSSNVRDI--SLVINDEKSNWSRIMFALLKQNCTLVK 175

Query: 175 ADLVDLMAQQLVDSNENISSFDEIWNRTVDS-GQYKEYPNFKVDRNS-FRDFTIIYFDNN 232
             L+  +   L+   +  ++FDEIW +  +S   Y  YP F V+ N   R F  + F   
Sbjct: 176 PVLLSEVCNVLLADCQ--TNFDEIWAQLFESFSNYTVYPGFTVEGNDILRAFQDVQFYTV 233

Query: 233 DS----DISGVRSCVEFCGGTLLSFVNNESFEKYAST-NETLHNVLLLRSERFQVSHPVY 287
            S    D+  +++ V    G   SF   +    Y  T N  L   + L+ E      P  
Sbjct: 234 GSISHDDLLYLKATVSELQGNFKSFDTADDLVTYIKTVNHNLLKCIALKQE-----DPAP 288

Query: 288 EILNKIDICSTGSFFKAVTENNVSTL---VHRELFLRR---------YTDITQKE----- 330
           + +  I I +     +A+ + N   L   + R    R+         Y +  Q+      
Sbjct: 289 DEIQGIKIYAIKEIVQAILDGNFKNLPTHIGRSNTSRKRNFTDSISHYNEDAQRNSHVHP 348

Query: 331 --------------------MRRPKEPVEDTAV----PLKKRRLNRRKVQPLNPLEFFAG 366
                                R   E +E   V    P K+RRL RR V+PL+ L FFAG
Sbjct: 349 DNTSTLNTNTHATISAAAEASREGGESLEPPTVMGPSPTKRRRLVRRTVKPLDSLSFFAG 408

Query: 367 GDTATTT 373
           G T  +T
Sbjct: 409 GSTNPST 415

 Score = 99.4 bits (246), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 49/112 (43%), Positives = 74/112 (66%), Gaps = 2/112 (1%)

Query: 540 KPRNSSSLVETIQSVKDNETRRLQCTLTPVDPSELTDEAIADFSNMAIVEPTVNIVRKKP 599
           + ++ ++ +E +QS K  E +R++  +  V PSEL++EAI   SN+ IVE   N++R++ 
Sbjct: 575 RSKSPAAFIEAVQSTKTREVKRIRTKIVDVSPSELSEEAINKLSNLTIVESNPNLIRERR 634

Query: 600 AMVTES--SIRSDRPNFKKFMKVWPKARKGNDSLRNNAYLITRDYVPMKAYN 649
           A   +S   +   R NFKKF KVWP+ R G DSLRNNA+LI R+YV +K Y+
Sbjct: 635 ADKNDSVNDMWKGRRNFKKFNKVWPQHRDGYDSLRNNAFLIIRNYVELKPYD 686

>YDR369C Chr4 complement(1215016..1217580) [2565 bp, 854 aa] {ON}
           XRS2Protein required for DNA repair; component of the
           Mre11 complex, which is involved in double strand
           breaks, meiotic recombination, telomere maintenance, and
           checkpoint signaling
          Length = 854

 Score =  145 bits (365), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 119/406 (29%), Positives = 194/406 (47%), Gaps = 60/406 (14%)

Query: 1   MWILRYSYESEDHGTVYVSCCLQRSRNYSIGRSSKTNALVIKNDKSISRQHISFQW---- 56
           MW++RY    ED    ++SCCLQ  + YSIGRSSK N L+IKNDKSISRQHI+F+W    
Sbjct: 1   MWVVRYQNTLEDGSISFISCCLQAFKTYSIGRSSK-NPLIIKNDKSISRQHITFKWEINN 59

Query: 57  ---VSHDYVDIVNDGKLTYINDAFLKPKETTRISIS-ASKETNIKVGSAPVIVNLVWEDV 112
              + H  + +VN GKLT +N  F+K  ET  I+ S   K T I++G+ P+ +   W + 
Sbjct: 60  SSDLKHSSLCLVNKGKLTSLNKKFMKVGETFTINASDVLKSTIIELGTTPIRIEFEWINE 119

Query: 113 FIDMTPISDTGQSLKLIGIYPAGSTHGVNIEDAMKTLCIKIKEIKWP-------HQLIAL 165
             ++ P         L       S +G++ E ++  +   +    +P        +L AL
Sbjct: 120 VWNIPP--------HLTQFRTMLSEYGISTEISINDIPANLMISDYPKSEDNSIRELYAL 171

Query: 166 IRGANRLYKADLVDLMAQQLVDSNENISSFDEIWNRTVDSGQYKEY---PNFKVDR---- 218
           +          L++L    L  S  N+  FDE+WN  + + +Y  +   PN  + +    
Sbjct: 172 VSTIPMKKSRFLMELCNTLLPTSKTNL-KFDEMWNDMISNPEYNVFDFDPNILLSKFMRL 230

Query: 219 NSFRDFTIIYFDNNDSDISGVRSCVEFCGGTLLSFVNNESFEKYASTNETLHNVLLLRSE 278
           N+ R  T I  +        + S +      L +F N +S  KY  + E     L+L + 
Sbjct: 231 NNIRVLTTIKSE------PRLSSLLRTFNINLFAFDNIDSLYKYVDSLEASTEYLILTTT 284

Query: 279 RFQVSHPVYEILNKIDICSTGSFFKAVTENNVSTLVH------RELFLRRYTDITQ---- 328
             + +  +        +C+  +   ++ +  +S +++      R L   ++  I++    
Sbjct: 285 DKKENGKI--------LCTIKTMLTSIIDGTLSAVINMKGASSRTLDNGKFDQISEGMST 336

Query: 329 --KEMRRPKEPVEDTAVPLKKRRLNRRKVQPLNPLEFFAGGDTATT 372
             K  R P+  VE + V  KKR+LNRR+V PL+ L+FFAGG +  T
Sbjct: 337 ILKTSRAPE--VEASPVVSKKRKLNRRRVLPLDSLDFFAGGLSTKT 380

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 86/162 (53%), Gaps = 28/162 (17%)

Query: 513 SREASKIVGPESLAPSRDTEVLRPRPAKPRNSSSLVETIQSVKDNETRRLQCTLTPVDPS 572
           SRE S  +     +P ++  + + +   P    + VE IQ  K+ E +R++ T+  +   
Sbjct: 529 SREISSPLQENCKSPVKELSI-KEKSGTPH---AFVEAIQETKNREVKRVKSTIVELKDE 584

Query: 573 ELTDEAIADFSNMAIVEPTVNIVRK-------KPAMVTESSIRS-------DRPNFKKFM 618
           EL++EAI    N+AIVEP+ N++RK       K +  TE    S        R NFK F+
Sbjct: 585 ELSEEAINQLKNLAIVEPSNNLLRKSFDSEGNKTSRTTEKWENSLMEPEWHKRKNFKTFV 644

Query: 619 KVWPKAR----------KGNDSLRNNAYLITRDYVPMKAYNR 650
           KV PK++          + +D +RN A+LITR+YVP+K Y++
Sbjct: 645 KVRPKSKAHKEEGKNNTQSSDFIRNAAFLITRNYVPLKKYSK 686

>ZYRO0F10054g Chr6 complement(814872..816854) [1983 bp, 660 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 660

 Score =  140 bits (352), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 113/381 (29%), Positives = 189/381 (49%), Gaps = 36/381 (9%)

Query: 1   MWILRYSYESEDHGTVYVSCCLQRSRNYSIGRSSKTNALVIKNDKSISRQHISFQWVSHD 60
           MWILRY Y+ ED    +VSCCL+    Y+IGRSSK N L IKNDKSISRQH+S  W   D
Sbjct: 1   MWILRYQYDLEDGNLKHVSCCLRLGETYNIGRSSK-NLLNIKNDKSISRQHVSICWDGKD 59

Query: 61  -YVDIVNDGKLTYINDAFLKPKETTRISISASKETN-IKVGSAPVIVNLVWEDVFIDMTP 118
             + ++N GK+T +++ +LK  E+  IS   S  T  +++G+ P+ + L W D  I M P
Sbjct: 60  RQLKLINQGKMTAVSEKYLKMGES--ISFGKSMGTVLVELGTKPLKMQLQWMDS-IWMVP 116

Query: 119 ISDTG--QSLKLIGIYPAGSTHGVNIEDAMKTLCIKIKEIKWPHQLIALIRGANRLYKAD 176
                   +L+ +GI    S      E +   L +  ++  +   L  L++    L   +
Sbjct: 117 QGSRSDHSALEELGIEVLSS------ELSRANLIVIDEQQNYSRWLYGLVKRIP-LMNLE 169

Query: 177 LVDLMAQQLVDSNENISSFDEIWNRTVDSGQYKEYPNFKVDRNSFRDFTIIYFDNNDSDI 236
            +++++Q+ V  +E  + FD IW + ++ G  + Y +++V     ++   +     D D 
Sbjct: 170 FLNVVSQK-VSGHE--TEFDSIWTKIMNDGSLR-YKSWEVQAQVLQNLEFLTV-GKDEDT 224

Query: 237 SGVRSCVEFCGGTLLSFVNNESFEKYASTNETLHNVLLLRSERFQVSHPVYEILNKIDIC 296
           S     +E  GG   + ++ E   +       L NV++L+S       P  E+       
Sbjct: 225 S---LAIEAAGGKYSAVLSVEELREAVKRKGDLSNVVILKSHL----TPAEELAPLGKTF 277

Query: 297 STGSFFKAVTENNVSTLVHRELFLRRYTDITQKEMRRPKEPVEDTAVPLKKRRLNRRKVQ 356
           +     +A+ ++ V++L +          +  +  +RP+  V       KKRRLNR +V+
Sbjct: 278 TVQDVVEAILKDEVNSLKN---------GVIGEVAKRPEAEVPMEKPVTKKRRLNRPRVK 328

Query: 357 PLNPLEFFAGGDTATTTKQSS 377
           PL+ L FFAGGD+   ++  S
Sbjct: 329 PLDILSFFAGGDSMKESQGES 349

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 80/138 (57%), Gaps = 11/138 (7%)

Query: 522 PESLAPSRDTEVLRPRPAKPRNSSSLVETIQSVKDNETRRLQCTLTPVDPSELTDEAIAD 581
           P +  P R   +   R  +  + + +++ IQ  K++E +RL  T+  V   ELT++AI  
Sbjct: 435 PNNARPHRKPTLSDYRKGESPSQNDMIQMIQDTKNHEVKRLNSTIIQVGDEELTEDAINQ 494

Query: 582 FSNMAIVEPTVNIVRKK---PAMVTESSIRSDRPNFKKFMKVWPK-------ARKG-NDS 630
             N+ +V+   N++R++   P + + +   ++R NFK F+KVWPK       +R+G +D+
Sbjct: 495 LGNLVLVDRNDNLMRRRDRSPTVDSHNPNWNNRKNFKNFVKVWPKYGGQDSTSREGSSDT 554

Query: 631 LRNNAYLITRDYVPMKAY 648
           +RN A+L+TR YVP + Y
Sbjct: 555 IRNRAFLLTRQYVPTRTY 572

>KLTH0F16038g Chr6 (1302028..1304406) [2379 bp, 792 aa] {ON} weakly
           similar to uniprot|P33301 Saccharomyces cerevisiae
           YDR369C XRS2 classified as an early recombination
           function required for DNA repair but dispensable for
           mitotic recombination (xrs2 is hyper-Rec during
           vegatative growth) required for double strand breaks
           meiotic recombination and spore viability DNA repair
           protein
          Length = 792

 Score =  135 bits (340), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 176/704 (25%), Positives = 287/704 (40%), Gaps = 117/704 (16%)

Query: 1   MWILRYSYESEDHGTVYVSCCLQRSRNYSIGRSSKTNALVIKNDKSISRQHISFQWVSHD 60
           MWILRY Y  E    + VSCCL++   Y +GRS K+  L IK DKSISR+H+  +   + 
Sbjct: 1   MWILRYQYIDETGSEIRVSCCLKKGTQYVVGRSVKS-PLQIKGDKSISRKHVQLEVRQNS 59

Query: 61  YVDIVNDGKLTYINDAFLKPKETTRISISASKETNIKVGSAPVIVNLVWEDVFIDMTPIS 120
            ++++N GKLT I    +K  +   +   A +   +++G+ PV   + +E     +    
Sbjct: 60  KLEVLNAGKLTKIGGDNVKMDQM--LEFGADQSVALEMGAGPVKGTVTYEPAIWKIPHDL 117

Query: 121 DTGQSLK-LIGIYPAGSTHGVNIEDAMKTLCIKIKEIKWPHQ--LIALIRGANRLYKADL 177
              +SLK  + +Y    T+ +      KT    IKE +  H   L AL++    + +  +
Sbjct: 118 AITESLKNHLSLYDIQVTNSL----TSKTSVQIIKEHQKSHGNCLFALVKKIPIMCEGFI 173

Query: 178 VDLMAQQLVDSNENISSFDEIWNR-TVDSGQYKEYPNFKVDRNSFRDFTIIYFDNNDSDI 236
            D ++Q   D+  +   FD  W + T+ +  + E    +    +F+    +    N    
Sbjct: 174 GDFVSQ-FADTQID---FDAKWEQITLKNAPFLE---LQTKDAAFKGLNFVV--TNQKTF 224

Query: 237 SGVRSCVEFCGGTLLSFVNNESFEKYASTNETLHNVLLL----------RSERFQVSHPV 286
           +  +S ++   G L    +  +   +        NV++L           SE+    H  
Sbjct: 225 AIYKSIIDAGSGNLWLCGDVSNLGTFIEKQIKSENVVILIHLIEEAPALASEQNNSMHIQ 284

Query: 287 YEILNKIDICSTGSFFKAVTENNVSTLVHRELFLRRYTDITQKEMRRPKEP--------- 337
              L K    S G  FK    N++   V +   L     + Q++                
Sbjct: 285 EAKLLKNKARSLG--FKTRDVNDIVDAVLKNDILSLLDRVPQEKALEENSAGGSIAGSQV 342

Query: 338 ----VEDTAVPLKKRRLNRRKVQPLNPLEFFAGGDT--------ATTTKQSS---DDGLA 382
               V D      KR+   R++QPLN L FF GG +        +T  K+ +    +GL 
Sbjct: 343 LADIVADAPNLRNKRKRANRQIQPLNSLAFFGGGSSLSQKLEQVSTPAKEQNLELQEGLG 402

Query: 383 ATKAVDETEVSDKMHGSGDVLSNSTNNNQDTVATQGKISPILEMNALSAEVPKGDESSHV 442
                +   +S K     + L ++ NN+  T +     +PI + +      P    ++H 
Sbjct: 403 VHTNPEVHPLSKKPREEKNTLHSAGNNSTTTFSE----TPIHQEDVQIGSEPLNHSAAHS 458

Query: 443 VEPDRTYEKDDCLPDNLEVNGMMKEPEPVIEKTRQSSINESLRTPKXXXXXXXXXXXXXX 502
           V                    + KE E      R  ++  S +  +              
Sbjct: 459 V--------------------ISKEDESTHTDERNKTLVNSAKDARTVTFPSIHK----- 493

Query: 503 XXXXPTHLKASREASKIVGPESLAPSRDTEVL---RPRPAKPRNSSSLVETIQSVKDNET 559
                  LK+SR  S     E      DTEV    RPR        SL++  Q  K +E 
Sbjct: 494 -----NELKSSRTLSNEAKVEGNISHADTEVQAIKRPR--------SLIQAFQEAKQHEV 540

Query: 560 RRLQCTLTPVDPSELTDEAIADFSNMAIVEPTVNIVRKKPAMVTESSIR--------SDR 611
            RL+  +  V   ELT+EAI    N+A VE  V+++R +P+ V E+S +        + R
Sbjct: 541 HRLKKNMADVGSEELTEEAINKLDNLASVE-KVDLMR-RPSEVPENSNQRILTNPQWARR 598

Query: 612 PNFKKFMKVWPKARKGN------DSLRNNAYLITRDYVPMKAYN 649
            NFKKF+K+WP     +      D++RN AYLITRDYV +  Y+
Sbjct: 599 KNFKKFVKLWPSHSSRSSPDNITDAVRNKAYLITRDYVSLCPYD 642

>SAKL0G02552g Chr7 complement(209978..212482) [2505 bp, 834 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 834

 Score =  124 bits (311), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 112/453 (24%), Positives = 210/453 (46%), Gaps = 83/453 (18%)

Query: 1   MWILRYSYESEDHGTVYVSCCLQRSRNYSIGRSSKTNALVIKNDKSISRQHISFQWVSHD 60
           MWILRY Y++ED     +SCCL++   Y IGRS+K+  L IKNDKSISR+HI  +    +
Sbjct: 1   MWILRYRYDTEDGNWCSISCCLKQGLIYDIGRSTKS-PLHIKNDKSISRKHIQLKVNKEN 59

Query: 61  YVDIVNDGKLTYINDAFLKPKETTRISISASKETNIKVGSAPVIVNLVWEDVFIDMTPIS 120
            ++++N GKLT +N   L   ++  ++     +  +++G  P+I  + W+D       + 
Sbjct: 60  ELNLLNTGKLTTLNAEVLMVDQS--LNFHPKGQLRLELGIKPIIATIEWQD------QVW 111

Query: 121 DTGQSLKLIGIYPAG--STHGVNIEDAMKT----LCIKIKEIKWPHQLIALIRGANRLYK 174
                L    ++     +++G+++   M T      IK  +  + + L +L++G + + +
Sbjct: 112 KVSHDLLYNSMFKRQEFNSYGISVTTTMSTRTNLQIIKQNQDTYSNCLFSLVKGIDIVRE 171

Query: 175 ADLVDLMAQQLVDSNENISSFDEIWNRTVDSGQYKEYPNFKVDRNSFRDFTIIYFDNNDS 234
           + L D  +   +      + +D IW   +   ++  +PNF    + F++ +II    +  
Sbjct: 172 SFLSDFQSHLYMTP----TDYDGIWKNLLQ--KHMVFPNFTTCVSIFQNISIIVASKSIY 225

Query: 235 DISGVRSCVEFCGGTLLSFVNNESFEKYASTNETLHNVLLLRSERFQVSHPVYEILNKID 294
           ++   +  +E  GG LL   N E FE++        +V++L+      ++   +  + ID
Sbjct: 226 NL--FKYTIEVAGGELLYCENMEKFEQFIQEAAHSKDVIILK--HITEANLTNDKNSNID 281

Query: 295 ICSTG---SFFKAVTE------NNVSTLVH-------RELFLRRYTDI---TQKEMRRPK 335
           +          KA  E      ++V+ LV        R+L  +  T I   ++K++  PK
Sbjct: 282 MSEDARKLEELKAAAESLGYKLHDVNDLVDAVLKRDPRQLLEKIPTKISFRSEKDLEEPK 341

Query: 336 EP-------------VEDTA---------------------VPLKKRRLNRRKVQPLNPL 361
            P             V +TA                     +P+K++R NR KV+PL+ L
Sbjct: 342 LPLKIDEFITPVPDKVSETAPFKGQLENSTARNDFEIMEQKIPVKRKRTNRSKVRPLDSL 401

Query: 362 EFFAGGDTATTTKQSSDDGLAATKAVDETEVSD 394
           +FFAGG+      Q+ ++G+   +    T V++
Sbjct: 402 DFFAGGNI-----QAKNEGIQKNQEFGMTRVTE 429

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/127 (38%), Positives = 79/127 (62%), Gaps = 12/127 (9%)

Query: 543 NSSSLVETIQSVKDNETRRLQCTLTPVDPSELTDEAIADFSNMAIVEPTVNIVRKKP--- 599
           +S++LVE IQ  K  E  RL+ TL  +D +ELT+ AI   SN+AIVE   +++RK     
Sbjct: 571 HSTALVEAIQDTKSREVSRLKNTLIQIDKNELTENAINSLSNLAIVEKK-DLIRKNSERG 629

Query: 600 -AMVTESSIRSDRPNFKKFMKVWPKARK-------GNDSLRNNAYLITRDYVPMKAYNRN 651
             + +++ +   R NFKKF+KV P+  +       G + ++N+A+LITR+YVP+K ++ N
Sbjct: 630 HCISSDTCLWEGRKNFKKFIKVQPRRSQRETFDSDGKNIVKNSAFLITREYVPLKKFDPN 689

Query: 652 EPKVFDE 658
           E +  D+
Sbjct: 690 EKEQIDD 696

>Suva_2.541 Chr2 complement(965557..968166) [2610 bp, 869 aa] {ON}
           YDR369C (REAL)
          Length = 869

 Score =  123 bits (309), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 125/401 (31%), Positives = 198/401 (49%), Gaps = 54/401 (13%)

Query: 1   MWILRYSYESEDHGTVYVSCCLQRSRNYSIGRSSKTNALVIKNDKSISRQHISFQWVSHD 60
           MW++RY    ED     +SCCLQ S++YSIGRSSK N LVIKNDKSISRQH++F+W  +D
Sbjct: 1   MWVIRYQNILEDGSINSISCCLQASKSYSIGRSSK-NELVIKNDKSISRQHVTFKWEIND 59

Query: 61  YVD-------IVNDGKLTYINDAFLKPKETTRISIS-ASKETNIKVGSAPVIVNLVWEDV 112
            ++       +VN GKLT IN  F+K  ET+ IS++  S  T I++G+ P+ +   W D 
Sbjct: 60  SLNPKGNKLSLVNQGKLTSINKKFMKVGETSTISVTKVSNHTEIELGTTPIRIKFEWIDE 119

Query: 113 FIDMTPISDTGQSLKLIGIYPAGSTHGVNIEDAMKTLCIKIKEIKWP-------HQLIAL 165
             ++   S+  Q   ++  +  G     +I+D   ++ I      +P        +L AL
Sbjct: 120 IWNIP--SNLAQFQTILSQF--GIATKTSIDDDSASILIS----DFPSNNDDGMRELYAL 171

Query: 166 IRGANRLYKADLVDLMAQQLVDSNENISSFDEIWNRTVDSGQYKEYPNFKVDRNSFRDFT 225
           +          LVDL    L  S  N+  FDE WN  V+   +K +           D +
Sbjct: 172 VHTIPLKKSQLLVDLCNSLLSSSVMNLK-FDETWNNMVNKPLFKVFD---------YDPS 221

Query: 226 IIY--FDNNDSDISGVRSCVEFCGGTLLSFVNNESFEKYASTNETLHNVLLLR-SERFQV 282
           +++  F   D+ I+      E     +L  +N   F  +   N+   +V LL+ SE++ +
Sbjct: 222 VLFSKFMRLDNVITLTTIGNESGLPNILRRLNVRLFH-FDCLNDLYKHVDLLKPSEKYLI 280

Query: 283 SHPVYEILNKIDICSTGSFFKAVTENNVSTLVHR-------------ELFLRRYTDITQK 329
                +  N   +C+  +   ++ ++ + ++++              E     +T I+ K
Sbjct: 281 LTFTNKRENGQKLCTLQNLITSIIDDTLPSVINTKAVPFEVQENNTPEKVFEGHTAIS-K 339

Query: 330 EMRRPKEPVEDTAVPLKKRRLNRRKVQPLNPLEFFAGGDTA 370
            +  P+   E T   LKKRRLNRR+VQPL+ L FFAGG +A
Sbjct: 340 TVHTPE--TEATPAVLKKRRLNRRRVQPLDSLNFFAGGLSA 378

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 63/215 (29%), Positives = 99/215 (46%), Gaps = 58/215 (26%)

Query: 546 SLVETIQSVKDNETRRLQCTLTPVDPSELTDEAIADFSNMAIVEPTVNIVRKKPAMVTES 605
           S VE IQ  K+ E +R++ T+  ++  EL++EAI   +N+AIVEP+  ++R  P  V  +
Sbjct: 575 SFVEAIQQTKNREVKRVKSTIVELEDDELSEEAINQLNNLAIVEPSNELLRD-PRSVGSN 633

Query: 606 SIRSD---------------RPNFKKFMKVWPKAR------KGN----DSLRNNAYLITR 640
             RS                R NFK F KVWP ++      KGN    D +R+ A+LITR
Sbjct: 634 RTRSSARRSEKGAIRQEWPKRKNFKTFAKVWPNSKTPKEGDKGNNQNSDFIRSAAFLITR 693

Query: 641 DYVPMKAY------------NRNEPKVFDEFENVTKAGILPDIIEPPIQPSQSLNHDT-- 686
           +YVP+K Y            N ++     E EN+     +PD  +  +   +S   D+  
Sbjct: 694 NYVPLKKYSKKDRASNWDKENNDDVLALTEMENLESDTHIPDNTDASVIQERSYAQDSVM 753

Query: 687 ----PPLLDDKAVS--------------ENELFVA 703
                  + +++ S              +N+LFVA
Sbjct: 754 KENNSDDMKERSFSFSRRSDTASTYQPVKNKLFVA 788

>Skud_4.638 Chr4 complement(1137885..1140416) [2532 bp, 843 aa] {ON}
           YDR369C (REAL)
          Length = 843

 Score =  117 bits (292), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 119/395 (30%), Positives = 191/395 (48%), Gaps = 27/395 (6%)

Query: 1   MWILRYSYESEDHGTVYVSCCLQRSRNYSIGRSSKTNALVIKNDKSISRQHISFQW---- 56
           MW++RY    ED    ++SCCLQ S++YSIGRSSK N+L+IKNDKSISRQHI+F+W    
Sbjct: 1   MWVIRYQNTVEDGHISHISCCLQASKSYSIGRSSK-NSLIIKNDKSISRQHITFKWEING 59

Query: 57  ---VSHDYVDIVNDGKLTYINDAFLKPKETTRI-SISASKETNIKVGSAPVIVNLVW-ED 111
              +   ++ ++N GKLT IN  FLK  E   I +   S  T I++G++P  + + W  +
Sbjct: 60  GLNLKASHLSLINQGKLTSINKKFLKVGEKFIIYAPEVSNLTTIELGTSPFHIEVAWVSE 119

Query: 112 VFIDMTPISDTGQSLKLIGIYPAGSTHGVNIEDAMKTLCIK---IKEIKWPHQLIALIRG 168
           ++   + +++   +L   GI    S     I+D    L I      +     +L AL+  
Sbjct: 120 IWNIPSHLTEFRTTLSQFGISTESS-----IDDGPINLMISDFPSSDDNGMRELYALVNA 174

Query: 169 ANRLYKADLVDLMAQQLVDSNENISSFDEIWNRTVDSGQYKEYPNF--KVDRNSFRDFTI 226
                   LVD+    L  S  N+  FDE+W   ++S ++  + NF   V  + F     
Sbjct: 175 IPLKKLRLLVDVCKTLLPASVRNL-KFDEMWKDVLNSPEFNVF-NFDASVLSSKFMKLNR 232

Query: 227 IYFDNNDSDISGVRSCVEFCGGTLLSFVNNESFEKYASTNETLHNVLLLRSERFQVSHPV 286
           I      S+   + + +      LL+F N +S  ++    +     L+L S     +  +
Sbjct: 233 IIVLTTTSNERRLSATLRGLNVKLLNFDNMKSLYEHVDGLKPSIKYLILTSTNKTENGQI 292

Query: 287 YEILNKIDICSTGSFFKAVTEN-NVSTLVHRELFLR--RYTDITQKEMRRPKEPVEDTAV 343
              +N +          A+T   +V   +  + F R       + K +  P+  +E    
Sbjct: 293 QCTINGLITSVIEDALPAITNTKSVPCEIQNKKFERVSEVQSTSSKTLHTPE--IEVGPA 350

Query: 344 PLKKRRLNRRKVQPLNPLEFFAGGDTATTTKQSSD 378
            LKKRRLNRR+VQPL+ L FFAGG ++ ++ +  D
Sbjct: 351 ILKKRRLNRRRVQPLDSLSFFAGGLSSKSSSEHQD 385

 Score = 87.4 bits (215), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 74/254 (29%), Positives = 119/254 (46%), Gaps = 59/254 (23%)

Query: 532 EVLRPRPAKPRNSSSLVETIQSVKDNETRRLQCTLTPVDPSELTDEAIADFSNMAIVEPT 591
           E+L+ R  K     S VE IQ  K+ E  R + T+  ++  EL++E I    N+AIVEP 
Sbjct: 538 ELLQKR--KSNTPLSFVEAIQETKNREVERFKSTIVQLEDDELSEEGINQLKNLAIVEPN 595

Query: 592 VNIVRKKPAMVTESSIRS---------------DRPNFKKFMKVWPKARKGN-------- 628
            +++R KP ++  +S+R+               +R NFK F+KVWPK +  N        
Sbjct: 596 EDLLR-KPQILGTNSVRTRAQKNESGIMRQEWHERKNFKTFIKVWPKFKMQNEGNKGDTQ 654

Query: 629 --DSLRNNAYLITRDYVPMKAYNRNEPKV------------FDEFEN-VTKAGILPD--- 670
             D +R+ A+LITR+YVP++ Y++N                  E EN V+  G+  +   
Sbjct: 655 NSDFIRSAAFLITRNYVPLRKYSKNNKATECNGKENEDMLGLIEMENLVSNTGVSGNTSS 714

Query: 671 --IIEPPIQPSQSLNHDTPPLLDDKAVS-----------ENELFVAEDSDEDEI--PAEH 715
             I + P   +  +N D     + ++ S           +N+LFV ED D++ +   +E+
Sbjct: 715 AVIQQGPRTQNTFINEDISDEGNQQSFSFSRHSDIAQPAKNKLFVTEDDDKNNMVNDSEN 774

Query: 716 ARYTDTLPKEAARP 729
                TL K   RP
Sbjct: 775 GCELITLKKIGLRP 788

>Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON}
           (10036..12474) [2439 nt, 813 aa]
          Length = 812

 Score =  108 bits (270), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 108/400 (27%), Positives = 171/400 (42%), Gaps = 47/400 (11%)

Query: 1   MWILRYSYESEDHGTVYVSCCLQRSRNYSIGRSSKTNALVIKNDKSISRQHISFQW-VSH 59
           MW+LRY Y  +D     +SCC++    Y +GRSSK N L ++NDKSISRQ IS QW    
Sbjct: 1   MWVLRYQYSLDDGSVEKISCCIRNEETYYLGRSSK-NQLSVRNDKSISRQQISIQWDRDK 59

Query: 60  DYVDIVNDGKLTYINDAFLKPKETTRISISASKETNIKVGSAPVIVNLVWEDVFID-MTP 118
           D + + N GK+T + + +L   ET     S +    +K+G+ P++VNL WE    + M  
Sbjct: 60  DCIMVKNLGKVTMVEERYLSDGETLSFQ-SKNDLVTMKIGTTPIVVNLSWEVKRCNYMKT 118

Query: 119 ISDTGQSLKLIGIYPAG--STHGVNIEDAMKTLCIKIKEIKWPHQLIALIRGANRLYKAD 176
             D    L+  G  P    ++H +++        I  K +K      ++I     +    
Sbjct: 119 DMDMVHLLQSYGFQPTTIENSHSLDMIIQNDVTTISDKYLK----CYSMIHDTILINSKT 174

Query: 177 LVDLMAQQLVDSNENISSFDEIWNR--TVDSGQYKEYPNFKVDRNSFRDFTIIYFDNNDS 234
           L D++   ++ + +    FD  W +  + +S       N      S +   +   D    
Sbjct: 175 LRDILTNNIIMTKK----FDSYWVKLNSHESNIQNHTINVTKLAKSLKGMHMFLLDPESY 230

Query: 235 DISGVRSCVEFCGGTLLSFVNNESFEKYASTNETLHNVLLLRSERFQVSHPVYEILNKID 294
           +       +E  G     F+N    E Y  T       LLL S + +    +        
Sbjct: 231 NCEYFEKFLEEIGCIPRKFLNINDLETYLETQFKGGEFLLLSSAKLENQSRLER------ 284

Query: 295 ICSTGSFFKAVTENNVSTLVHRELFLRRYTDITQKEMRRPKEP------VEDT--AVPL- 345
                 F     E+ +  L+  +L   +  + +++E +   EP      VE T  AVP+ 
Sbjct: 285 ------FISIPLESFLDKLLFLDLDFGQSINRSKEESKNVIEPVLKEVGVEQTTEAVPIS 338

Query: 346 ----------KKRRLNRRKVQPLNPLEFFAGGDTATTTKQ 375
                     KKRRLNR +V+PL+ L FFAGG T+    Q
Sbjct: 339 KNVEIYEPQPKKRRLNRSRVKPLDSLNFFAGGVTSIGASQ 378

 Score = 73.9 bits (180), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 45/126 (35%), Positives = 75/126 (59%), Gaps = 17/126 (13%)

Query: 542 RNSSSLVETIQSVKDNETRRLQCTLTPVDPSELTDEAIADFSNMAIVEPTVNIVR----- 596
           R S  LV  IQ +K+ ET R++ ++  +  +ELT+EAI  FS++ +V+    + +     
Sbjct: 519 RPSVDLVHAIQDIKERETLRVKTSIVEIKENELTEEAINKFSDLTVVDINTRLFKDKSLD 578

Query: 597 -KKPAMVTESSIR-SDRPNFKKFMKVWPKARK--GNDS--------LRNNAYLITRDYVP 644
             KPA   ++++  S + NFKKF+K+ PK ++  GN          +RN+A LITR++VP
Sbjct: 579 INKPANSNQNNMDWSGKKNFKKFVKMVPKYKRSQGNGQHADSCSTFIRNSAMLITRNFVP 638

Query: 645 MKAYNR 650
           MK Y++
Sbjct: 639 MKQYSK 644

>TPHA0J02590 Chr10 complement(574619..576946) [2328 bp, 775 aa] {ON}
           Anc_5.435 YDR369C
          Length = 775

 Score =  102 bits (255), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 178/707 (25%), Positives = 302/707 (42%), Gaps = 116/707 (16%)

Query: 1   MWILRYSYESEDHGTVYVSCCLQRSRNYSIGRSSKTNALVIKNDKSISRQHISFQW-VSH 59
           M ILRY     D     VSCCL     Y+IGRSSK N   IKNDKSISRQH+S  W  S 
Sbjct: 1   MIILRYKNVLADGPVNVVSCCLLCDVEYAIGRSSK-NKFAIKNDKSISRQHVSLLWKYSS 59

Query: 60  D----YVDIVNDGKLTYINDAFLKPKETTRISISASKETNIKVGSAPVIVNLVWEDVFID 115
           D     + I N GK+T I D +L   ET + ++   K+  + +G++P+ + +  ++V  +
Sbjct: 60  DDKNVIIQIKNFGKVTMIKDKYLSQDETLQFTL-IDKKLEVNIGTSPITLEIFNQEVVCN 118

Query: 116 MTPISDTGQS-LKLIGIYPAGSTHGVNI-EDAMKTL-----CIKIKEIKWPHQLIALIRG 168
              I D   S  KLI        + +NI +D   TL      I IKE  +   L+ L   
Sbjct: 119 --SIEDIQNSDSKLI-------LNNLNILQDDPLTLKREGPTIIIKENSYTDILLELFSN 169

Query: 169 ANRLYKADLVDLMAQQLVDSNENISSFDEIWNRTVDSGQYKEYPNFKVDRNSFRDFTIIY 228
              +    + +L    + ++N+  S +D+I++R  + G+               D +  Y
Sbjct: 170 VFGIPIVTIEELRG--IANANDFYSYWDKIYSRKKNKGKA-----------CMLDLSTCY 216

Query: 229 FDNN-DSDISGVRSCVEFCGGTLLSFVNNESFEKYASTNETLHNVLLLRSERFQVSHPVY 287
           + +  D  +  V+  +      +    + +   K    N +  N+    S+ F +S+ + 
Sbjct: 217 YISEVDKYVDYVKVAIRSLNAEIKILKDKDDLVKDIRKNISKGNI----SKFFVLSNDIT 272

Query: 288 ---EILNKIDICSTGSFFKAVTENNVSTLVHRELFLRRYTDITQKEMRRPKEPVEDTAVP 344
              E    I + S     +AV  NN+     +++ +  Y+    +  R  K P +D  + 
Sbjct: 273 QGEEAPFNISVTSIAKLLEAVKTNNM-----KDIVMHDYSSFKIEIPREVKSPKDDNIIE 327

Query: 345 L------KKRRLNRRKVQPLNPLEFFAGG---DTATTTKQSSDDGLAATKAVDETEVSDK 395
                  K+RR+NR KV+PL+ L FFAGG   DT +   + S+D + + +  ++   + K
Sbjct: 328 KQEPPAPKRRRMNRSKVKPLDTLSFFAGGMSHDTHSINTKPSND-VQSHQETEKDVNNSK 386

Query: 396 MHGSGDVLSNSTNNNQDTVATQGKISPILEMNA------LSAEVPKGDESSHVVEPDRTY 449
           +    DV SN      D  +T+ + S  +  NA       +AE P     +    P  + 
Sbjct: 387 IESIQDVESNQDQTKYDK-STELQKSKAVSKNADDKLQDSTAEKPINFNPT-TKTPSFSP 444

Query: 450 EKDDCLPDNLEVNGMMKEPEPVIEKTRQSSINESLRTPKXXXXXXXXXXXXXXXXXXPTH 509
             +D   +N   N      +P +EKTR +    SL T                      +
Sbjct: 445 SINDKAIENSNAN-----LDPTMEKTRVNKKPASLDT--------------------KNN 479

Query: 510 LKASREASKIVGPESLAPSRDTEVLRPR-------PAKPRNSSSLVETIQSVKDNETRRL 562
           L  ++  ++ +     A + D  V+R R            +S+ LV TIQ+VK     R+
Sbjct: 480 LLDNKLIAEQINEALSAKTNDAPVVRRRRTLLDYGNTDKSSSTDLVRTIQNVKSRGVDRV 539

Query: 563 QCTLTPVDPSELTDEAIADFSNMAIVEPTVNIVRKKP--------AMVTESSIRSDRPNF 614
              +  VD +EL +E +  F ++ +V+    +++K P        A +  +S   +R ++
Sbjct: 540 NSKIVTVDENELNEEELNKFFDVVVVDVNDKLMKKHPNAQKVIDNANIDHNSNFKNRKDY 599

Query: 615 KKFMKVWPKARKG---------NDSLRNNAYLITRDYVPMKAYNRNE 652
           K F K  PK +           +D+  N      R+ +P++ YN NE
Sbjct: 600 KLFKKSIPKWQSKLNKQHHSMTSDNGENLVVSKNRNKIPLRKYNENE 646

>CAGL0A02838g Chr1 complement(297872..300358) [2487 bp, 828 aa] {ON}
           similar to uniprot|P33301 Saccharomyces cerevisiae
           YDR369c XRS2
          Length = 828

 Score =  101 bits (252), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 77/213 (36%), Positives = 119/213 (55%), Gaps = 19/213 (8%)

Query: 1   MWILRYSYESEDHGTVYVSCCLQRSRNYSIGRSSKTNALVIKNDKSISRQHISFQW-VSH 59
           MW+LRYSY  E      VSCC++++  Y+IGRSSK N LVIKNDKSISRQH+S +W  S 
Sbjct: 1   MWVLRYSYVEETGEVKKVSCCIRQNVQYTIGRSSKNN-LVIKNDKSISRQHVSLKWSSSK 59

Query: 60  DYVDIVNDGKLTYINDAFLKPKETTRISISASKETNIK--VGSAPVIVNLVWEDVFIDM- 116
           + +++ N GKLT  ++ +L   E   I+ SA  ET I+  +G APV + L   D   D+ 
Sbjct: 60  NCIELTNTGKLTKSSEKYLGSNEL--ITYSAD-ETQIEMLLGVAPVKIILSRIDELFDIP 116

Query: 117 TPISDTGQSLKLIGIYPAGSTHGVNIEDAMKTLCIKIKEIKWPHQLIALIRGANRLYKAD 176
             +S   ++L+ +GI  +     VN      T  I + +  +  +L A     N +Y + 
Sbjct: 117 NSLSQFRETLETLGIQISVDNANVN-----STSLITVGDFGY-RELFAACNDIN-IYSSG 169

Query: 177 LVDLMAQQLVDSNENISSFDEIWNRTVDSGQYK 209
           L+  +  +LV+ ++N   FD  W R++ S  ++
Sbjct: 170 LLTEICNKLVNDHDN---FDAEW-RSMQSSYHR 198

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 92/388 (23%), Positives = 163/388 (42%), Gaps = 56/388 (14%)

Query: 328 QKEMRRPKEPVEDTAVPLKKRRLNRRKVQPLNPLEFFAGG-----DTATTTKQSSDDG-L 381
           ++ +    +P + +    KK+R+ R KV+PLN L FFAGG      T     QS  +G L
Sbjct: 327 KRSLANTSQPTDTSLESTKKKRVRRHKVEPLNSLSFFAGGISPVPGTNNEYNQSKVNGHL 386

Query: 382 AATKAVDETEVS--DKMHGSGDVLSNSTNNNQDTVATQGKISPILEMNALSAEVPKGDES 439
            +  + D    +   K+ G    +S +     +   T     P +   +++  +   D+ 
Sbjct: 387 DSEISPDSASTTREQKIPGQSHTISTT---RMEHALTDDNSEPTIVQRSIAEGISHRDQ- 442

Query: 440 SHVVEPDRTYEKDDCLPD----NLEVNGMM-------KEPEPVIEKTRQSSINESLRTPK 488
             ++  D   E    LPD    ++  N M        K    V     QS++ +S+   K
Sbjct: 443 --LIGNDEVVEDQHHLPDRKKRDIHENTMYNNSYNGNKSLYGVENSLTQSNLLQSMGYEK 500

Query: 489 XXXXXXXXXXXXXXXXXXPTHLKASREASKIVGPESLAPSRDTEVLRPRPAKPRNSSSLV 548
                               +L A R   K     SL  +     L+ R         +V
Sbjct: 501 SNNKTELSKKNAGGIMSTEKNLDAQRPNLKSQTLNSLEDNDPKRTLQKRDI------DIV 554

Query: 549 ETIQSVKDNETRRLQCTLTPVDPSELTDEAIADFSNMAIVEPTVNIVRKKPAMVTESSIR 608
           + +Q+ K++E +RL  T+  ++ SELT+EAI   +++ +VEP  +++R K  +   ++ +
Sbjct: 555 KLVQTTKESEVKRLSSTIVKIEDSELTEEAINKLNDLVLVEPVADLIRTKSDISANNTTQ 614

Query: 609 S---DRPNFKKFMKVWPKARKGNDS-------LRNNAYLITRDY-----VPMKAYN--RN 651
               +R NFKKF+K+ PK +    S       +R +  ++TR++     VP+  YN   +
Sbjct: 615 QQWKNRKNFKKFVKICPKYKSEQSSIESMSRHIRGSGEILTREFLQTKNVPVDYYNSHHD 674

Query: 652 EPKVFDEFENVTKAG--------ILPDI 671
           +    DE     +A         ILP+I
Sbjct: 675 QNDFVDEINTAPQANKSNSFVHQILPEI 702

>Kwal_55.21422 s55 (830578..832926) [2349 bp, 782 aa] {ON} YDR369C
           (XRS2) - DNA repair protein [contig 130] FULL
          Length = 782

 Score = 96.3 bits (238), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 106/401 (26%), Positives = 181/401 (45%), Gaps = 43/401 (10%)

Query: 1   MWILRYSYESEDHGTVYVSCCLQRSRNYSIGRSSKTNALVIKNDKSISRQHISFQWVSHD 60
           MWILRY Y + +   V+VSCCL++   YSIGRS+K N L IK+DKSISR H+  +     
Sbjct: 1   MWILRYQYVAGNGMDVHVSCCLKQGLQYSIGRSTK-NPLQIKSDKSISRNHVELEVDQSC 59

Query: 61  YVDIVNDGKLTYINDAFLKPKETTRISISASKETNIKVGSAPVIVNLVWEDVFIDMTPIS 120
            V +   GKLT ++   +K  +   +  +A +E   ++G++P+   +V +  F  +    
Sbjct: 60  NVVLRVVGKLTKVSGKSVKAGQ--HLQFTADEEVLFEMGASPIKATVVKQQSFWKIPHDL 117

Query: 121 DTGQSL-KLIGIYPAGSTHGVNIEDAMKTLCIKIKEIKWPHQLIALIRGANRLYKADLVD 179
              QSL + +  +    T+ ++   +++   IK     + + L +LI+    L +  + D
Sbjct: 118 SLSQSLSRHLADFDIQVTNSLSSTTSIQ--IIKDSSKSFSNCLFSLIKNIPILREHFIGD 175

Query: 180 LMAQQLVDSNENISSFDEIWNRTVDSGQYKEYPNFKVDRNSFRDFTIIYF-DNNDSDISG 238
            + Q     N+  + FD  W+R V   +  ++PN+K +    R FT I+F   N    + 
Sbjct: 176 FVTQ----INDVHADFDSRWDRMV--VENAQFPNYKCE---CRPFTTIHFLVTNRRAFAI 226

Query: 239 VRSCVEFCGGTLL---SFVNNESFEKYASTNETLHNVLLLRSERFQVSHPVYEILNKID- 294
            +  ++   GTL       N + F K+  T++ +  +LL+     + S    E  + +D 
Sbjct: 227 FKHIIDAGSGTLWLCDDISNLDHFIKHKITSDNV--ILLVHLNNGKSSISSTEQSSDLDV 284

Query: 295 ----------------ICSTGSFFKAVTENNVSTLVH----RELFLRRYTDITQKEM-RR 333
                           I        AV ++N   L+     R L  +  T    +E   +
Sbjct: 285 QEAKLLKNKAQNLGFRIHDVNDIVGAVLDHNFEKLLERVPVRNLPSKAPTGFPLEEATNK 344

Query: 334 PKEPVEDTAVPLKKRRLNRRKVQPLNPLEFFAGGDTATTTK 374
                 DT  P  KR+   R+V PL+ L FF GG  A + +
Sbjct: 345 SVIKSADTPKPSNKRKRTNRQVVPLDSLAFFGGGSAAESKQ 385

 Score = 67.4 bits (163), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 41/114 (35%), Positives = 66/114 (57%), Gaps = 12/114 (10%)

Query: 546 SLVETIQSVKDNETRRLQCTLTPVDPSELTDEAIADFSNMAIVEPTVNIVR--KKPAMVT 603
           S  + ++  K +E  RL+  +  V   ELT+EAI     +A+VE T +++R  ++ A+  
Sbjct: 522 SFAQAVKETKSHEVDRLEKDIVNVTSEELTEEAINKLDKLALVE-TKDLMRADREYAVCG 580

Query: 604 ESSIR---SDRPNFKKFMKVWPKARKGN------DSLRNNAYLITRDYVPMKAY 648
           +S      + R NFKKF+K+WP     N      ++LRN A+LITR+YVP++ Y
Sbjct: 581 QSGGSEQWAGRKNFKKFVKLWPSRSSRNSPDSATNALRNRAHLITREYVPLRPY 634

>TBLA0A02820 Chr1 (678796..681573) [2778 bp, 925 aa] {ON} Anc_5.435
           YDR369C
          Length = 925

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 69/111 (62%), Gaps = 3/111 (2%)

Query: 1   MWILRYSYESEDHGTVYVSCCLQRSRNYSIGRSSKTNALVIKNDKSISRQHISFQWVS-- 58
           MWI+ YSY+S D     VSCCL+++  YSIGRS K+  L +KNDKSISRQH++F W    
Sbjct: 1   MWIISYSYKSADDTLTNVSCCLKQNETYSIGRSKKS-PLFVKNDKSISRQHVTFHWTGNL 59

Query: 59  HDYVDIVNDGKLTYINDAFLKPKETTRISISASKETNIKVGSAPVIVNLVW 109
           ++ + ++N GKLT +N   L P ET   +        +++G+ PV+V   W
Sbjct: 60  NNQLSLLNQGKLTRVNSRILNPAETLLFNADIEHPAEVELGATPVVVCGAW 110

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 65/121 (53%), Gaps = 14/121 (11%)

Query: 545 SSLVETIQSVKDNETRRLQCTLTPVDPSELTDEAIADFSNMAIVEPTVNIVRKKPAMVTE 604
           ++ +  +Q  K+ ET RL      +   ELT+EAI  FSN+A+VE  V+IV  +     E
Sbjct: 607 NNFISALQDAKNRETDRLGSKFVKIYDEELTEEAINKFSNLAVVETNVDIVISEGKKNNE 666

Query: 605 SSIRSD-----RPNFKKFMKVWPKAR-----KGNDS----LRNNAYLITRDYVPMKAYNR 650
           S    D     R NFK F+K  PK R      G++     +RN+A+L+ R+YVPM+ +  
Sbjct: 667 SITDIDPKWKGRKNFKNFVKQLPKYRMKTMPSGDNGVASFIRNSAFLLAREYVPMQEFKM 726

Query: 651 N 651
           N
Sbjct: 727 N 727

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 24/29 (82%)

Query: 344 PLKKRRLNRRKVQPLNPLEFFAGGDTATT 372
           P+K+RRLNR++VQPL+ L FF GG+T  T
Sbjct: 379 PVKRRRLNRKRVQPLDSLHFFVGGNTNPT 407

>KLLA0E02201g Chr5 complement(205466..207973) [2508 bp, 835 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 835

 Score = 87.4 bits (215), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 99/392 (25%), Positives = 169/392 (43%), Gaps = 48/392 (12%)

Query: 1   MWILRYSYESEDHGTVYVSCCLQRSRNYSIGRSSKTNALVIKNDKSISRQHISFQWVSHD 60
           MWI+ + ++ E   +  V   LQ    YSIGRS+K     I+ DKSISR H+  ++   D
Sbjct: 1   MWIVSFIFDDEAEKSHKVCKALQYGVEYSIGRSAKC-TFRIQTDKSISRVHLLIKFDGSD 59

Query: 61  YVDIVNDGKLTYINDAFLKPKETTRISISASKETNIKVGSAPVIVNLVWEDVFIDMTPIS 120
            + I N GKLT  N+  +   ET    +  ++ T I +G  P+ VN+ +   F +   I 
Sbjct: 60  LI-ITNKGKLTKFNEEIIPLDETI---VVHNQNTVINIGGMPIDVNVRY---FYEEWKIP 112

Query: 121 DTGQSLKLIGIYPAGSTHGVNIEDAMK---TLCIKIKEIKWPHQLIALIRGANRLYKADL 177
                L+L       S  GV + ++     T  I      +   L AL++G   +   + 
Sbjct: 113 ---HRLELNETKSLVSDFGVKLSESFSKKTTTQICSDSSSYSGCLFALLKGV-PVVSIEF 168

Query: 178 VDLMAQQLVDSN--ENISSFDEIWNRTVDSGQYKEYPNFKVDRNSFRDFTIIYFDNNDSD 235
           ++ M + L   N  +  S +  + NR      +K +P+++   N   + T+I F+    D
Sbjct: 169 LNQMGKLLQQGNYLDFQSMYQGLLNR------HKLFPSYRYVPNVLSNMTLIVFEQKMYD 222

Query: 236 ISGVRSCVEFCGGTLLSFVNNESFEKYASTNETLHNVL--------------LLRSERFQ 281
              +R  +E  GG      N+   +K+ STN     VL              LL  E F 
Sbjct: 223 T--LRYTIEVGGGDAKLLANSSELDKFLSTNHEPAVVLGSSISQKMNSESTKLL--EEFD 278

Query: 282 VSHPVYEILNKIDICSTGSFFKAVTENNVSTLVHRELF-LRRYTDITQKEMRRPKEPVED 340
            S     + + + + +   F   + EN ++ L  R++  L   + + QK+++  K  V  
Sbjct: 279 KSIAETSLRHGVKLLNINQFVNILLENKINGLKKRDVVDLTSPSPVQQKKIQSAKASVNG 338

Query: 341 TAVPLKKRRLNRRKVQPLNPLEFFAGGDTATT 372
                 K+  ++  +Q L+ L FF GG+   T
Sbjct: 339 ------KKTKSKPNIQSLDSLNFFGGGNLEVT 364

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 64/122 (52%), Gaps = 13/122 (10%)

Query: 542 RNSSSLVETIQSVKDNETRRLQCTLTPVDPSELTDEAIADFSNMAIVEPTVNIVRKKPAM 601
           R+S++++  I   K  E +RLQ  +  VD SELT+ A+ DF + A     +N ++ KP +
Sbjct: 589 RSSTNIITAIAETKQKEVKRLQEGIIEVDQSELTESALIDFKDAA----KINTIQIKPRV 644

Query: 602 VTESSIRS------DRPNFKKFMKVWPK-ARKGNDSL--RNNAYLITRDYVPMKAYNRNE 652
           +    I +       R NFKKF K WP   R+  + L   N +  I R+Y+ M+ Y+  +
Sbjct: 645 LASIPISNGNTKWLGRKNFKKFKKNWPSYLRRTTEGLCSDNTSNQIGREYITMRKYDSRK 704

Query: 653 PK 654
            K
Sbjct: 705 AK 706

>AER402C Chr5 complement(1407938..1410547) [2610 bp, 869 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR369C
           (XRS2)
          Length = 869

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/118 (34%), Positives = 69/118 (58%), Gaps = 7/118 (5%)

Query: 535 RPRPAKPRNSSSLVETIQSVKDNETRRLQCTLTPVDPSELTDEAIADFSNMAIVEPTVNI 594
           R  PA P  +  +V+ I+ +K+ E  R++ T+  + P ELT++AI    ++AIV+P V++
Sbjct: 589 RQAPAVPEQN--IVDAIKQIKEREVNRIRTTIVELGPEELTEDAIRQLKSLAIVQP-VDM 645

Query: 595 VRKKPAM--VTESSIRSDRPNFKKFMKVWPKA--RKGNDSLRNNAYLITRDYVPMKAY 648
           +R++  +  V  S +   R N+K F KVWPK   RK +   RN   +  R Y+P++ Y
Sbjct: 646 LRQQHTVDTVGSSPLTFARKNYKNFKKVWPKYMNRKNSPETRNATAISNRKYLPLELY 703

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 100/460 (21%), Positives = 182/460 (39%), Gaps = 81/460 (17%)

Query: 1   MWILRYSYE-SEDHGTVY-VSCCLQRSRNYSIGRSSKTNALVIKNDKSISRQHISFQWVS 58
           MW+ + +Y+ S   G +  +SC L   R + +GR+SK+  LVI+ +K +SR H+  + + 
Sbjct: 1   MWVFKCNYQKSGQLGALQNISCALCPEREFIVGRASKS-TLVIE-EKGVSRTHLRLEVID 58

Query: 59  HDYVDIVNDGKLTYINDAFLKPKETTRISISASKETNIKVGSAPVIVNLVWE--DVFIDM 116
            D+V+I+  G    +               S S    ++VGS  V   L W   +  +  
Sbjct: 59  -DHVNILLLGSQLKVGGEDASKGSVLPFGPSQSP-VILEVGSHSVQCILEWAQWEFKVPN 116

Query: 117 TPISDTGQSLKLIGIYPAGSTHGVNIEDAMKTLCIKIKEIKWPHQ--------LIALIRG 168
           T + +    L++I         G+ I             I  PH+        L AL++G
Sbjct: 117 TLLQEDPALLEVI--------KGLGIRVVTSFSKATTHHIIRPHEDDQDYEKYLFALVKG 168

Query: 169 ANRLYKADLVDLMAQQLVDSNENISSFDEIWNRTVDSGQYKEYPNFKVDRNSFRDFT--- 225
              L+    ++ + Q      + ++ FD    R++    Y           +FR FT   
Sbjct: 169 IPILH----LEFLKQFTALLRQPVTDFDPQL-RSIQEQHY-----------AFRGFTKKA 212

Query: 226 -----IIYFDNNDSDISGVRSCVEFCGGTLLSFVNNESFEKYASTNETLHNVLLLR---- 276
                + +  N   D   ++  +E  GGT + F ++ +          ++  L L+    
Sbjct: 213 ADLNGLHFIVNRKHDFEMLKYTLEIGGGT-VHFCHDINDLSACLKTIPINGALALKYDHG 271

Query: 277 --SERFQVSHPVY-EILNK--IDICSTGSFFKAVTENNVSTLV-HRELFLRRYTDITQKE 330
             +E  +V    Y E+L+   I + +     KA+  + ++ L+  R   + +  +     
Sbjct: 272 ISAEVKKVDDTRYCEVLHSHGIQLFTVHELTKAILYDKLAQLLSKRPPTMMKLVEPVPST 331

Query: 331 MRRPKEPVEDTAVPLK-------------KRRLNRRKVQPLNPLEFFAGGDTATTTKQSS 377
           + + +E  +++  P+              K R   +K QPL+ L FFAGG     ++Q+S
Sbjct: 332 ISQTQEMKQESLSPISLGNTTIKDLPRKDKTRKRLKKPQPLDSLSFFAGG----LSRQNS 387

Query: 378 DDGLAATKAVDETEVSDKMHGSGDVLSNSTNNNQDTVATQ 417
             G  A     E+     M    D    S N+ Q   ATQ
Sbjct: 388 SIGGTADLVKQES-----MSLGADTHYGSPNDVQSLPATQ 422

>Ecym_4761 Chr4 (1479649..1482045) [2397 bp, 798 aa] {ON} similar to
           Ashbya gossypii AER402C
          Length = 798

 Score = 67.4 bits (163), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 45/120 (37%), Positives = 70/120 (58%), Gaps = 11/120 (9%)

Query: 542 RNSSSLVETIQSVKDNETRRLQCTLTPVDPSELTDEAIADFSNMAIVEPTVNIVRKKPA- 600
           ++ SS+V  I+ +K+ E  R++ T+  + P ELT+EAI   S +A+VE +V+++RK  + 
Sbjct: 521 QSHSSIVNAIKEIKEREVSRIKTTIVEIGPDELTEEAICKLSTLAVVE-SVDMLRKTQSR 579

Query: 601 -MVTESSIRSD-RPNFKKFMKVWPKARKG---NDSLRNNAYLITRDYVPMKAY---NRNE 652
            M TE++ R   R NFK+F+KVWP         D +    Y   R  VP+K Y   N+NE
Sbjct: 580 HMKTETNKRHHVRRNFKRFVKVWPAYLNKAICQDPMGAQRYS-NRQCVPLKVYEPMNKNE 638

 Score = 44.7 bits (104), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 86/424 (20%), Positives = 168/424 (39%), Gaps = 81/424 (19%)

Query: 1   MWILRYSYESE-DHGTV-YVSCCLQRSRNYSIGRSSKTNALVIKNDKSISRQHISFQWVS 58
           MWI +  Y+++ D  T+  +S  ++  +NY +GR+SK+ +LVI +++ +SR H+  +  +
Sbjct: 1   MWIFKCQYQNQKDPDTLNAISSVIKPDKNYIVGRASKS-SLVI-DERGVSRTHLQLK-AN 57

Query: 59  HDYVDIVNDGKLTYINDAFLKPKETTRISISASKETNIKVGSAPVIVNLVW--------E 110
            + ++I   G    I    ++   +       S    ++VGS  +   L+W         
Sbjct: 58  RNIIEITLLGAQLKIGHKTIEKGISCEFHPKQSP-LRLEVGSHSIECKLLWTQWEFKVPS 116

Query: 111 DVFIDMTPISDTGQSLKLIGIYPAGSTHGVNIEDAMKTLCIKIKEIKWPHQLIALIRGAN 170
           D+ I+   ++     L +  ++       ++ E + + +  +  +  +   L AL++G  
Sbjct: 117 DLEINYIALTKMFVQLGIKIVF------SLSKETSHQIVRSRQGQKDYDKYLFALVKGLP 170

Query: 171 RLYKADLVDLMAQQLVDSNENISSFDEIWNRTVDSGQYKEYPNFKVDRNSFRDFTIIYFD 230
            +    L  + +    D+ +  S   E+        ++  +P F    N  +    I  +
Sbjct: 171 LVEVGFLKGISSLLNSDTLKFESKVKEL------EREFSIFPEFNPIPNPLKGLYFIVPE 224

Query: 231 NNDSDISGVRSCVEFCGGTLLSFVNNESFEKYAST----------------------NET 268
            ++ DI  ++  +E  GGT+ + +  E F K  ST                        T
Sbjct: 225 KDEFDI--LKYTIEVGGGTVYNCITFEDFVKVTSTIPSSKVILIKCSNNISPAIDTQKPT 282

Query: 269 LHNVLLLRSERFQVSHPVYEILNKIDICSTGSFFKAVTENNV-STLVHRELFLRRYTDI- 326
            HN+LL ++                    T     AV  NN   TL+   +  +R     
Sbjct: 283 DHNILLEKAHSIGFKQH-----------DTRELTIAVLNNNFEETLIDSSISDKRLISCN 331

Query: 327 TQKEMRRPKEPVEDT----------------AVPLKKRRLNRRKVQPLNPLEFFAGGDTA 370
           +  +++     +ED                   P KKRR+N   V+PL+ L FFAGG   
Sbjct: 332 SNDKLKTTSTSLEDGLKVNVSATSGLNLNTEGPPAKKRRIN--SVKPLDSLSFFAGGSIE 389

Query: 371 TTTK 374
            +T+
Sbjct: 390 RSTR 393

>KLTH0A05918g Chr1 complement(487673..490363) [2691 bp, 896 aa] {ON}
           similar to uniprot|P20095 Saccharomyces cerevisiae
           YNR011C PRP2 RNA-dependent ATPase in the DEAH-box family
           required for activation of the spliceosome before the
           first transesterification step in RNA splicing
          Length = 896

 Score = 38.9 bits (89), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 30/50 (60%), Gaps = 4/50 (8%)

Query: 689 LLDDKAVSENELFVAEDSDEDEIPAEHARYTDTLPKEAARPRRRLLTTEE 738
           + DD+A+ E      EDS+ED +P EH+ Y + L  E  R  +RLLT +E
Sbjct: 197 VFDDEAMIE----FTEDSNEDVLPEEHSEYDNKLLTELERENKRLLTIQE 242

>Suva_7.579 Chr7 complement(1012777..1013718) [942 bp, 313 aa] {ON}
           YGR282C (REAL)
          Length = 313

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 33/68 (48%), Gaps = 7/68 (10%)

Query: 128 LIGIYPAGSTHGVNIEDAMKTLCIKIKEIKWPHQLIALIRGANRLYKADLVDLMAQQLVD 187
            +G++P   TH    + A++T   KIKE      +   + G+  LY+ DL    A +L D
Sbjct: 86  FVGVWPTDDTHYAAEKVALQTYLPKIKE----STVAGFLVGSEALYRGDLT---ASELSD 138

Query: 188 SNENISSF 195
              +I SF
Sbjct: 139 KINDIRSF 146

>KAFR0E03950 Chr5 (781992..784232) [2241 bp, 746 aa] {ON} Anc_5.422
           YDR362C
          Length = 746

 Score = 32.3 bits (72), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 65/148 (43%), Gaps = 13/148 (8%)

Query: 114 IDMTPISDTGQSLKLIGIYPAGSTHGVNIEDAMKTLCIKIKEIKWPHQLIALIRGANRLY 173
           +D    SD G SL+ +      ++H +N  +   T     +     H LI        LY
Sbjct: 596 LDSFVFSDQGNSLRCVVPRALFASHQINSRETTVTSAGASR----LHPLILSSASDGTLY 651

Query: 174 KADLVDLMAQQLVDSNENISSFDEI-----WNRTVDSGQYKEYPNFKVDRNSFRDFTIIY 228
               VD +A++L+   +N+S+  +      W+    +G+Y+   N++V +++  D + I 
Sbjct: 652 ----VDNIARRLLTGVKNVSNTHKSLKLWRWDYDRSTGKYRLDHNYEVFKSTSNDVSKIK 707

Query: 229 FDNNDSDISGVRSCVEFCGGTLLSFVNN 256
            D    +IS V+      GG   +F NN
Sbjct: 708 IDAPGINISCVKWNESSKGGNFYAFANN 735

>KAFR0A00270 Chr1 (51990..53333) [1344 bp, 447 aa] {ON} Anc_2.643
           YHR005C
          Length = 447

 Score = 32.0 bits (71), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 36/83 (43%), Gaps = 7/83 (8%)

Query: 315 HRELFLRRYT-------DITQKEMRRPKEPVEDTAVPLKKRRLNRRKVQPLNPLEFFAGG 367
           H++LF  + T       D+  K M    E + D  +   +R   +R+VQ     + F   
Sbjct: 111 HKDLFEMKRTLLKAKPLDLIDKHMAGGSEFLNDYVLKYSERYETKRRVQSTGKAKAFDDN 170

Query: 368 DTATTTKQSSDDGLAATKAVDET 390
           DT   +    DD  A +K +DET
Sbjct: 171 DTKKQSDAKDDDPEATSKDMDET 193

>SAKL0G10054g Chr7 (853800..855542) [1743 bp, 580 aa] {ON} similar
           to uniprot|Q05567 Saccharomyces cerevisiae YDR294C DPL1
           Dihydrosphingosine phosphate lyase regulates
           intracellular levels of sphingolipid long-chain base
           phosphates (LCBPs) degrades phosphorylated long chain
           bases prefers C16 dihydrosphingosine-l-phosphate as a
           substrate
          Length = 580

 Score = 31.6 bits (70), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 50/111 (45%), Gaps = 5/111 (4%)

Query: 225 TIIYFDNNDSDISGVRSCVEFCGGTLLSFVNNESFEKYASTNETLHNVL-LLRSERFQVS 283
           T+ + D     +SG      + GG  L  + + +FEKY  +N+   +V   +R    +V 
Sbjct: 153 TLTHSDWEGGKVSGAV----YHGGEELIKLQSLAFEKYCVSNQLHPDVFPGVRKMESEVV 208

Query: 284 HPVYEILNKIDICSTGSFFKAVTENNVSTLVHRELFLRRYTDITQKEMRRP 334
             V  + N  +  S G+     TE+ +   +  +++  RY  IT+ EM  P
Sbjct: 209 SMVLNLFNAPEDTSCGTTTSGGTESLLLACLSAKMYALRYKGITEPEMIVP 259

>Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR105C
          Length = 480

 Score = 31.6 bits (70), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 43/92 (46%), Gaps = 13/92 (14%)

Query: 611 RPNFKKFMKVWPKARKGNDSLRNNAYLITRDYVPMKAYNRNEPKV-FDEFENVTKAGILP 669
           RP   KF + WP ++ G     +N      DYVP+K   RN+P     E E    A  +P
Sbjct: 293 RPETAKFPEDWPISKDGVVETWHN------DYVPLK---RNKPGANSKEKEGTIDATPVP 343

Query: 670 DIIEPPIQPSQSLN-HDTPPLLDDKAVSENEL 700
           D  E  + PS+ LN      L DD   ++NE+
Sbjct: 344 D--ENSVTPSEHLNDQGKRSLEDDTPEAKNEI 373

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.130    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 84,015,766
Number of extensions: 3945547
Number of successful extensions: 11327
Number of sequences better than 10.0: 83
Number of HSP's gapped: 11749
Number of HSP's successfully gapped: 111
Length of query: 769
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 652
Effective length of database: 40,065,477
Effective search space: 26122691004
Effective search space used: 26122691004
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 70 (31.6 bits)