Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0C048905.437ON40540522060.0
KAFR0E038205.437ON3964066952e-87
ZYRO0F10098g5.437ON3733776081e-74
Smik_4.6365.437ON4463845913e-71
Suva_2.5425.437ON4423895791e-69
NCAS0F034005.437ON4153975735e-69
NDAI0B056905.437ON4233845642e-67
TDEL0B021805.437ON4183845553e-66
Skud_4.6395.437ON4424035495e-65
YDR370C5.437ON4423925495e-65
Kpol_1016.45.437ON4133895326e-63
SAKL0G02596g5.437ON4004094853e-56
CAGL0A02860g5.437ON4023634332e-48
KLTH0F15994g5.437ON3903944102e-45
TPHA0J026005.437ON4413894063e-44
TBLA0A028005.437ON4533793792e-40
Kwal_55.214155.437ON3893883613e-38
AER404C5.437ON3863563402e-35
KLLA0E02245g5.437ON4032742437e-22
NCAS0B016408.679ON24068790.22
TPHA0G036503.570ON377100760.77
KLLA0E12893g3.570ON38445731.6
TDEL0A053608.592ON40349722.0
NDAI0G053401.247ON718117703.9
KAFR0A038908.684ON32059694.9
Smik_7.153.570ON38762678.1
NCAS0E002403.570ON380158678.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0C04890
         (405 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0C04890 Chr3 (945616..946833) [1218 bp, 405 aa] {ON} Anc_5.4...   854   0.0  
KAFR0E03820 Chr5 (758469..759659) [1191 bp, 396 aa] {ON} Anc_5.4...   272   2e-87
ZYRO0F10098g Chr6 complement(818672..819793) [1122 bp, 373 aa] {...   238   1e-74
Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {...   232   3e-71
Suva_2.542 Chr2 complement(968396..969724) [1329 bp, 442 aa] {ON...   227   1e-69
NCAS0F03400 Chr6 complement(686480..687727) [1248 bp, 415 aa] {O...   225   5e-69
NDAI0B05690 Chr2 (1387153..1388424) [1272 bp, 423 aa] {ON} Anc_5...   221   2e-67
TDEL0B02180 Chr2 (388145..389401) [1257 bp, 418 aa] {ON} Anc_5.4...   218   3e-66
Skud_4.639 Chr4 complement(1140646..1141974) [1329 bp, 442 aa] {...   216   5e-65
YDR370C Chr4 complement(1217782..1219110) [1329 bp, 442 aa] {ON}...   216   5e-65
Kpol_1016.4 s1016 (8493..9362,9366..9737) [1242 bp, 413 aa] {ON}...   209   6e-63
SAKL0G02596g Chr7 complement(214675..215877) [1203 bp, 400 aa] {...   191   3e-56
CAGL0A02860g Chr1 complement(300736..301944) [1209 bp, 402 aa] {...   171   2e-48
KLTH0F15994g Chr6 (1298649..1299821) [1173 bp, 390 aa] {ON} weak...   162   2e-45
TPHA0J02600 Chr10 complement(577310..578635) [1326 bp, 441 aa] {...   160   3e-44
TBLA0A02800 Chr1 (675150..676511) [1362 bp, 453 aa] {ON} Anc_5.4...   150   2e-40
Kwal_55.21415 s55 (826461..827630) [1170 bp, 389 aa] {ON} YDR370...   143   3e-38
AER404C Chr5 complement(1412412..1413572) [1161 bp, 386 aa] {ON}...   135   2e-35
KLLA0E02245g Chr5 complement(210001..211212) [1212 bp, 403 aa] {...    98   7e-22
NCAS0B01640 Chr2 (268028..268750) [723 bp, 240 aa] {ON} Anc_8.679      35   0.22 
TPHA0G03650 Chr7 (776977..778110) [1134 bp, 377 aa] {ON} Anc_3.5...    34   0.77 
KLLA0E12893g Chr5 complement(1140409..1141563) [1155 bp, 384 aa]...    33   1.6  
TDEL0A05360 Chr1 complement(943869..945080) [1212 bp, 403 aa] {O...    32   2.0  
NDAI0G05340 Chr7 (1301733..1303889) [2157 bp, 718 aa] {ON} Anc_1...    32   3.9  
KAFR0A03890 Chr1 complement(792251..793213) [963 bp, 320 aa] {ON...    31   4.9  
Smik_7.15 Chr7 complement(32394..33557) [1164 bp, 387 aa] {ON} Y...    30   8.1  
NCAS0E00240 Chr5 complement(34922..36064) [1143 bp, 380 aa] {ON}...    30   8.5  

>KNAG0C04890 Chr3 (945616..946833) [1218 bp, 405 aa] {ON} Anc_5.437
           YDR370C
          Length = 405

 Score =  854 bits (2206), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/405 (100%), Positives = 405/405 (100%)

Query: 1   MGTMTTAIETDDLLNSFHRLSINDQKRVRFKEFHHHDPGKYVSKPAHIFQKSKEVACYTG 60
           MGTMTTAIETDDLLNSFHRLSINDQKRVRFKEFHHHDPGKYVSKPAHIFQKSKEVACYTG
Sbjct: 1   MGTMTTAIETDDLLNSFHRLSINDQKRVRFKEFHHHDPGKYVSKPAHIFQKSKEVACYTG 60

Query: 61  GKLYINDGNTTNLTILPLLKEDIAALAQSKNTQKSGSFKSKYLGLSLYAGFEDYVFTMSP 120
           GKLYINDGNTTNLTILPLLKEDIAALAQSKNTQKSGSFKSKYLGLSLYAGFEDYVFTMSP
Sbjct: 61  GKLYINDGNTTNLTILPLLKEDIAALAQSKNTQKSGSFKSKYLGLSLYAGFEDYVFTMSP 120

Query: 121 DMLDSAKPCLDYINEWNRGSKGEKKFGESYRHIIVGPRHHLVELTMALFANDSDYKLVCT 180
           DMLDSAKPCLDYINEWNRGSKGEKKFGESYRHIIVGPRHHLVELTMALFANDSDYKLVCT
Sbjct: 121 DMLDSAKPCLDYINEWNRGSKGEKKFGESYRHIIVGPRHHLVELTMALFANDSDYKLVCT 180

Query: 181 VLRGKFIVLSQFDDGSQRNRNEGITLSDRRTRMLCYSGFVICKIWSLNRGIIPSQFFYYG 240
           VLRGKFIVLSQFDDGSQRNRNEGITLSDRRTRMLCYSGFVICKIWSLNRGIIPSQFFYYG
Sbjct: 181 VLRGKFIVLSQFDDGSQRNRNEGITLSDRRTRMLCYSGFVICKIWSLNRGIIPSQFFYYG 240

Query: 241 TPIRRGHLATFTCEMDAYNQIENHYTELKCYGPLNMKSSYHKSKLLRTWVQTEVSPDTDV 300
           TPIRRGHLATFTCEMDAYNQIENHYTELKCYGPLNMKSSYHKSKLLRTWVQTEVSPDTDV
Sbjct: 241 TPIRRGHLATFTCEMDAYNQIENHYTELKCYGPLNMKSSYHKSKLLRTWVQTEVSPDTDV 300

Query: 301 VIGCRNAYDGTLQDITQLSRESLYRKFNNKHQPRAHTNFNYNAQVAVEWSQYAMKAIIRL 360
           VIGCRNAYDGTLQDITQLSRESLYRKFNNKHQPRAHTNFNYNAQVAVEWSQYAMKAIIRL
Sbjct: 301 VIGCRNAYDGTLQDITQLSRESLYRKFNNKHQPRAHTNFNYNAQVAVEWSQYAMKAIIRL 360

Query: 361 IEGNLNQKSVLEPQAFVVTVYRGHDIGIRKLKGVPKYAEIPKEFI 405
           IEGNLNQKSVLEPQAFVVTVYRGHDIGIRKLKGVPKYAEIPKEFI
Sbjct: 361 IEGNLNQKSVLEPQAFVVTVYRGHDIGIRKLKGVPKYAEIPKEFI 405

>KAFR0E03820 Chr5 (758469..759659) [1191 bp, 396 aa] {ON} Anc_5.437
           YDR370C
          Length = 396

 Score =  272 bits (695), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 152/406 (37%), Positives = 225/406 (55%), Gaps = 17/406 (4%)

Query: 6   TAIETDDLLNSFHRLSINDQKRVR------FKEFHHHDPGKYVSKPAHIFQKSKEVACYT 59
            A   +  + +FH LS+   K  +      FK F H     + + PA+ FQ S+EVA Y 
Sbjct: 2   AAASLNATIENFHGLSLGSGKTQKTPIVSPFKRFQHRSIAYFPNHPANFFQISREVATYH 61

Query: 60  GGKLYINDGNTTNLTILPLLKEDIAALAQSKNTQKSGSFKSKYLGLSLYAGFEDYVFTMS 119
            G++Y  + N T+  ILPLL +DI+ +AQ  +   +  +K KY+G  LY GFE++  +MS
Sbjct: 62  DGRIY--EPNETSQDILPLLNKDISKIAQGVSAIDARKYKVKYIGSDLYQGFENFE-SMS 118

Query: 120 PDMLDSAKPCLDYINEWNRGSKGEKKFGESYRHIIVGPRHHLVELTMALFANDSDYKLVC 179
            + LDSA PC  YI +W   +    K+ E+ ++ IV  RHH+V L M++F    +  +  
Sbjct: 119 REELDSALPCFAYIKKWE--AHHHCKYTENKKYTIVSARHHIVNLIMSIFDTSKETIVNS 176

Query: 180 TVLRGKFIVLSQFDDGSQRNRNEGITLSDRRTRMLCYSGFVICKIWSLNRGIIPSQFFYY 239
           T L    +  SQ D       NEGI   ++  + +CYSGF +  +  L +      F   
Sbjct: 177 TYLGNGLLTFSQ-DTSDPMTMNEGIFTKNKNLKKICYSGFALEDL--LTKSQKEPLFSIT 233

Query: 240 GTPIRRGHLATFTCEMDAYNQIENHYTELKCYGPLNMKSSYHKSKLLRTWVQTEVSPDTD 299
              +         CEMDAYNQ+  +YTELKCY PL M S  H+ KLL+TW+QT V P +D
Sbjct: 234 ENQLDDNITLLLRCEMDAYNQLTQNYTELKCYAPLKMASPQHRKKLLKTWIQTGVLPSSD 293

Query: 300 VVIGCRNAYDGTLQDITQLSRESLYRKFNNKHQPRAHTNFNYNAQVAVEWSQYAMKAIIR 359
           ++ G R+ Y+G L DI   SR+ LYR+FNN++ P    + N+NA +AVEWS + +K I  
Sbjct: 294 LMFGIRSPYNGELLDIEWYSRDGLYRRFNNRNLPENKKSLNFNANIAVEWSHHCIKTICE 353

Query: 360 LIEGNLNQKSVLEPQAFVVTVYRGHDIGIRKLKGVPKYAEIPKEFI 405
           LI  NL   +   PQAF + V    +I IR L  +P+ A+IP++++
Sbjct: 354 LISDNLQGDA---PQAFQIKVDTFRNISIRNLSKIPQNAQIPRQYL 396

>ZYRO0F10098g Chr6 complement(818672..819793) [1122 bp, 373 aa] {ON}
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370C Hypothetical ORF
          Length = 373

 Score =  238 bits (608), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 129/377 (34%), Positives = 217/377 (57%), Gaps = 24/377 (6%)

Query: 28  VRFKEFHHHDPGKYVSKPAHIFQKSKEVACYTGGKLYINDGNTTNLTILPLLKEDIAALA 87
           V F +F H    ++ S+P ++F K KE + Y GG+L+ +  ++  L           +  
Sbjct: 16  VPFNQFQHSSAFRFPSEPRNLFTKYKEASYYYGGQLHDSISDSIGL----------KSPG 65

Query: 88  QSKNTQKSGSFKSKYLGLSLYAGFEDYVFTMSPDMLDSAKPCLDYINEWNRGSKGEKKFG 147
              +  +S S K  +LG  LY G+ED++  +SP++LDS++ C  +IN+W   +     + 
Sbjct: 66  NKLSHDRSCSNKRDFLGSDLYQGWEDFL-PLSPEILDSSRGCYQWINKWE--NDNHTSYS 122

Query: 148 ESYRHIIVGPRHHLVELTMALFANDSDYKLVCTVLRGKFIVLSQF--DDGSQRNRNEGIT 205
           +    +++ PRH+LVELTM LF   S Y ++CT L    IVLSQ   D  S ++ +   T
Sbjct: 123 QRSPFVVISPRHYLVELTMQLF-QQSKYSILCTHLGDGKIVLSQVENDKKSHQHTSRNTT 181

Query: 206 LSDRRTRMLCYSGFVICKIWSLNRGIIPSQFFYYGTPIRRGHLA-TFTCEMDAYNQIENH 264
           +    T+ + +SG+ +  + +    +    FF         +++    CE+D+YN++   
Sbjct: 182 M----TKKILHSGYALEDLLTRGPRVEDDPFFAIIEAELDANISLVLRCELDSYNELTET 237

Query: 265 YTELKCYGPLNMKSSYHKSKLLRTWVQTEVSPDTDVVIGCRNAYDGTLQDITQLSRESLY 324
           +TELKCY PLNM ++YH+ KLL+TW+Q  +SP  D++IG RN + G LQD+   + + LY
Sbjct: 238 FTELKCYAPLNMHNAYHREKLLKTWIQLAISPRCDLLIGVRNTHMGLLQDLQYFTNKELY 297

Query: 325 RKFNNKHQPRAHTNFNYNAQVAVEWSQYAMKAIIRLIEGNLNQKSVLEPQAFVVTVYRGH 384
           RK N+++ P++   FNYNA +AV+W Q+ +++I +L+  N+++ S   PQ F +T+   H
Sbjct: 298 RKINDRNLPKSPKRFNYNADLAVQWCQHCIRSICKLVGENVDRSS---PQCFKLTIDESH 354

Query: 385 DIGIRKLKGVPKYAEIP 401
            I + KLK VP + E+P
Sbjct: 355 KIQLEKLKHVPAHVELP 371

>Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {ON}
           YDR370C (REAL)
          Length = 446

 Score =  232 bits (591), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 142/384 (36%), Positives = 204/384 (53%), Gaps = 19/384 (4%)

Query: 27  RVRFKEFHHHDPGKYVSKPAH-IFQKSKEVACYTGGKLYINDGNTTNLTILPLLKEDIAA 85
           RV +  F H    K+ +KP   IF +SKEVA +T G+ Y     T    ILP LK DIA 
Sbjct: 65  RVSYTSFSHSGMHKFPAKPPRDIFHESKEVALFTNGQAY----TTVRKDILPNLKGDIAE 120

Query: 86  LAQSKNTQKSGSFKSKYLGLSLYAGFEDYVFTMSPDMLDSAKPCLDYINEWNRGSKGEK- 144
           L + ++   +   K  YLG  L+A    +V  M+   LDS  PC+ YI  W   + GE  
Sbjct: 121 LCE-RSLLDARERKLPYLGHDLFANIGQFV-PMTISELDSILPCISYIENWRLNNHGEDF 178

Query: 145 KFGESYRHIIVGPRHHLVELTMALF-ANDSDYKLVCTVLRGKFIVLSQFDDGSQRNRNEG 203
           K G  +   +V  RHH+V++TM LF   +    LV T +    I  S+      R   EG
Sbjct: 179 KIGRKF--TVVTTRHHIVDMTMHLFDRRNKKRSLVATYMGAGLISFSRNQKNDSRMSKEG 236

Query: 204 ITLSDRRTRMLCYSGFVI-------CKIWSLNRGIIPSQFFYYGTPIRRGHLATFTCEMD 256
           I  SD   + +CYSGF          K   LN   +P  F    + +         CEMD
Sbjct: 237 IYSSDPNMKKICYSGFEFENWVTEGIKAADLNGSKLPV-FSVVESKLSEEIGLLIRCEMD 295

Query: 257 AYNQIENHYTELKCYGPLNMKSSYHKSKLLRTWVQTEVSPDTDVVIGCRNAYDGTLQDIT 316
           A+N +    TELKC+ PL+M +S H+ KLL+TW+QT +SP++D++IG R+++ G L DI 
Sbjct: 296 AFNPVSGANTELKCFAPLSMHNSNHRRKLLKTWIQTGLSPNSDIMIGLRDSHSGQLLDIQ 355

Query: 317 QLSRESLYRKFNNKHQPRAHTNFNYNAQVAVEWSQYAMKAIIRLIEGNLNQKSVLEPQAF 376
             SR+SL  KFN+   P      NYNA+VAVEW  + +K+I  L+  N++  S   P++F
Sbjct: 356 WYSRDSLCMKFNHSGLPSNKRELNYNAKVAVEWCNHCIKSICELLGANISDYSCKNPESF 415

Query: 377 VVTVYRGHDIGIRKLKGVPKYAEI 400
            +++   + I I KLK +PK+ E+
Sbjct: 416 EISIDSNNTIAITKLKNIPKHVEL 439

>Suva_2.542 Chr2 complement(968396..969724) [1329 bp, 442 aa] {ON}
           YDR370C (REAL)
          Length = 442

 Score =  227 bits (579), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 137/389 (35%), Positives = 215/389 (55%), Gaps = 19/389 (4%)

Query: 22  INDQKRVRFKEFHHHDPGKYVSKPA-HIFQKSKEVACYTGGKLYINDGNTTNLTILPLLK 80
           I++  RV +  F H     + +KP   IF +SKEVA +T  +LY+         ++P LK
Sbjct: 60  ISEFTRVPYSSFLHTSIRNFPTKPPPDIFYESKEVALFTDNQLYV----AARKDVIPNLK 115

Query: 81  EDIAALAQSKNTQKSGSFKSKYLGLSLYAGFEDYVFTMSPDMLDSAKPCLDYINEWNRGS 140
           EDI+ L +S    ++   K+ YLGL L+A  ++ V  M+   LD+  PC+ YI +W   +
Sbjct: 116 EDISHLYESP-LLEARKLKTLYLGLDLFANIDELV-PMTISELDTIAPCISYIEDWRLNN 173

Query: 141 KGEKKFGESYRHIIVGPRHHLVELTMALFANDSDYK-LVCTVLRGKFIVLSQFDDGSQRN 199
            G K F    +  +V  RHH+V+LTM  F   +  K ++ T +   FI LS+      + 
Sbjct: 174 SG-KPFKIGKKFTVVTTRHHIVDLTMHPFDRRNKQKSIIATYMGNGFISLSRNPKYDHKA 232

Query: 200 RNEGITLSDRRTRMLCYSGFVICKIWS---LNRGIIPSQFFYYGTPIRRGHLAT-----F 251
             EGI   D   + +C+SGF      +    N G   S+   +   I  G L+       
Sbjct: 233 SKEGIYSGDPNIKKICHSGFEFENCLTENTKNSGSSASKCPVFS--IVEGKLSEDIGLLM 290

Query: 252 TCEMDAYNQIENHYTELKCYGPLNMKSSYHKSKLLRTWVQTEVSPDTDVVIGCRNAYDGT 311
            CEMDA+N +    TELKC+GPL+M++S H+ KLL+TW+QT + P++D+++G R++Y G 
Sbjct: 291 RCEMDAFNPVSKTNTELKCFGPLSMQNSSHRKKLLKTWIQTGLLPNSDIMVGLRDSYSGQ 350

Query: 312 LQDITQLSRESLYRKFNNKHQPRAHTNFNYNAQVAVEWSQYAMKAIIRLIEGNLNQKSVL 371
           L DI   SR++L+RKFN+   P      NYNA+VAVEW ++ +K+I  L+E N+++ +  
Sbjct: 351 LLDIQWYSRDTLFRKFNHPGLPLNKKEMNYNAKVAVEWCKHCIKSICDLVEANISRYNCN 410

Query: 372 EPQAFVVTVYRGHDIGIRKLKGVPKYAEI 400
           +P+ F + +     I I KL  +P+  EI
Sbjct: 411 KPEPFEINIDANGTIIITKLSTIPRNVEI 439

>NCAS0F03400 Chr6 complement(686480..687727) [1248 bp, 415 aa] {ON}
           Anc_5.437 YDR370C
          Length = 415

 Score =  225 bits (573), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 137/397 (34%), Positives = 210/397 (52%), Gaps = 39/397 (9%)

Query: 27  RVRFKEFHHHDPGKYVSKPAHIFQKSKEVACYTGGKLYINDGNTTNLTILPLLKEDIAAL 86
           RV F EF H     + +     ++ S +VA Y   KLY      +   I+P LK DIA L
Sbjct: 25  RVPFGEFSHSSISLFPTCTQPFYESSNQVALYHNHKLY----PASQYDIIPHLKNDIAQL 80

Query: 87  AQSKNTQKSGSFKSKYLGLSLYAGFEDYVFTMSPDMLDSAKPCLDYINEWNRGSKGEKKF 146
            + K+  ++ + K  YLG  LY GFE +V  MS   LDS +PC+ +I +W R +  + K 
Sbjct: 81  PK-KSASEARTLKRSYLGSDLYDGFETFV-PMSAKDLDSLEPCMSFIKDWERKASTKYKP 138

Query: 147 GESYRHIIVGPRHHLVELTMALFANDS----------DYKL--VCTVLRGKFIVLSQFDD 194
           G  +   IV  RHH+VE+TM LF   +          DY L  V T      ++ ++   
Sbjct: 139 GRKFN--IVSTRHHIVEMTMKLFTGKTNNYNNTKKVQDYVLNVVYTGDETGRLLFTKDWS 196

Query: 195 GSQRNRNEGITLSDRRTRMLCYSGFVICKIWSLNRGIIPSQFFYYGTPIRRGHLATFT-- 252
            +  + NEGI   +   + +CYSGF +  + +       S+    G  +  G  A F   
Sbjct: 197 NTGNSMNEGIYSKNIILKRICYSGFALEDLMTET----TSELEKEGEKLTGGEKAVFAVV 252

Query: 253 -------------CEMDAYNQIENHYTELKCYGPLNMKSSYHKSKLLRTWVQTEVSPDTD 299
                        CE+DA+N  E  +TELKC+ PL M +  H+ KLL+ WVQT V PD+D
Sbjct: 253 ENKLDDDICILLRCELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSD 312

Query: 300 VVIGCRNAYDGTLQDITQLSRESLYRKFNNKHQPRAHTNFNYNAQVAVEWSQYAMKAIIR 359
           ++IG R++  G L+D+   SR+ L  K NN++ P +  ++N+NAQVA +WSQ+ +++I +
Sbjct: 313 ILIGIRDSSFGELEDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICK 372

Query: 360 LIEGNLNQKSVLEPQAFVVTVYRGHDIGIRKLKGVPK 396
           L++ NL+QK++  PQ F + +    +I I+ L  VPK
Sbjct: 373 LVDENLDQKAISNPQGFQIRIDSRRNIRIKCLSKVPK 409

>NDAI0B05690 Chr2 (1387153..1388424) [1272 bp, 423 aa] {ON}
           Anc_5.437 YDR370C
          Length = 423

 Score =  221 bits (564), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 133/384 (34%), Positives = 203/384 (52%), Gaps = 24/384 (6%)

Query: 28  VRFKEFHHHDPGKYVSKPAHIFQKSKEVACYTGGKLYINDGNTTNLTILPLLKEDIAALA 87
           + FK+F H     Y   P+  F+ SK+VA Y   +LY +D   TNL  +P L+  IA LA
Sbjct: 39  IPFKQFKHCSISTYPKTPSSFFETSKDVALYHNKQLYSSDD--TNL--IPQLEPAIAKLA 94

Query: 88  Q-SKNTQKSGSFKSKYLGLSLYAGFEDYVFTMSPDMLDSAKPCLDYINEWNRGSKGEKKF 146
             S +  ++   K  YLG  LY G+E ++  M PD LDS +PC  YI  W   +K + + 
Sbjct: 95  NPSCSLNEARDLKLPYLGSDLYDGYESFI-PMDPDELDSIEPCFKYIESWELQNKHDYQL 153

Query: 147 GESYRHIIVGPRHHLVELTMALFAND--SDYKLVCTVLRGKFIVLSQFDDGSQRNRNEGI 204
           G  +   IV  RHH+VE+TM +F      D+ L  T   G   +L  F     +  + GI
Sbjct: 154 GNKF--TIVSARHHIVEMTMCIFNKRKMDDFILNVTYKGGSNGML-LFSRDVNKKDDGGI 210

Query: 205 TLSDRRTRMLCYSGFVICKIWSLNR-------------GIIPSQFFYYGTPIRRGHLATF 251
              D   R + YSGF +  + + N+             G   + F      +        
Sbjct: 211 YSKDGVVRKISYSGFALEDLLTTNKNDHNADNSDVTLVGGDKAVFAIIENKLNDDISLLL 270

Query: 252 TCEMDAYNQIENHYTELKCYGPLNMKSSYHKSKLLRTWVQTEVSPDTDVVIGCRNAYDGT 311
            CEMD+YN +   +TE+KC+  L M +  H+ KLL+ WVQT V P++D++IG R+   G 
Sbjct: 271 RCEMDSYNPVNKCFTEMKCFARLKMNNHNHRRKLLKAWVQTGVIPNSDILIGIRDPMFGE 330

Query: 312 LQDITQLSRESLYRKFNNKHQPRAHTNFNYNAQVAVEWSQYAMKAIIRLIEGNLNQKSVL 371
           L DI   SR +LYR+ NN++ P A  + NYNA++AV+WSQ+ +K+I +L++ ++++  + 
Sbjct: 331 LNDIEWFSRMNLYRQINNRNLPEAKLDLNYNAEIAVQWSQHCIKSICKLVDESIDKTRLN 390

Query: 372 EPQAFVVTVYRGHDIGIRKLKGVP 395
             Q+F + +     I I+KLK VP
Sbjct: 391 TSQSFQIRINASRAIQIKKLKSVP 414

>TDEL0B02180 Chr2 (388145..389401) [1257 bp, 418 aa] {ON} Anc_5.437
           YDR370C
          Length = 418

 Score =  218 bits (555), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 142/384 (36%), Positives = 212/384 (55%), Gaps = 23/384 (5%)

Query: 28  VRFKEFHHHDPGKYVSKPAHIFQKSKEVACYTGGKLYINDGNTTNLTILPLLKEDIAALA 87
           + F +F H D   +    A  F+  +EVA Y  G L++ D +   L   P L+   A +A
Sbjct: 50  IPFSKFEHSDLDYFPDDTADFFEGCEEVATYQNGYLFMKDSSKKPL--YPCLQMFAALIA 107

Query: 88  QSKNTQKSGSFKSKYLGLSLYAGFEDYVFTMSPDMLDSAKPCLDYINEWNRGSKGEKKFG 147
           +++  +     K  Y+G  LY G E Y    S + LDS+  C +YI +W R  K  K F 
Sbjct: 108 ENRGPKN----KLPYIGCDLYQGHERYKPLPSSE-LDSSIACFEYIKKWER-RKISKSFN 161

Query: 148 ESYRHIIVGPRHHLVELTMALFANDSDYKLVCT-VLRGKFIVLSQFDDGSQRNRNEGITL 206
            S +  I+ PRHH+V+L MALF +D +  ++CT + +GK I      D S+  RN G+  
Sbjct: 162 -SGKVTIISPRHHVVDLVMALF-HDDEVSIICTNIGKGKLIFSG---DRSKEERN-GLNS 215

Query: 207 SDRRTRMLCYSGFVICK--IWSLNRGIIPSQFFYYGTPIRRGHLATFTCEMDAYNQIENH 264
            +  TR +CYSGF +      S +  + P      G    R  L    CEMDAYN I N 
Sbjct: 216 KNSMTRKICYSGFALEDKLTTSHDERMGPFYSIVEGKINERLSL-LLRCEMDAYNPIFNR 274

Query: 265 YTELKCYGPLNMKSSYHKSKLLRTWVQTEVSPDTDVVIGCRNAYDGTLQDITQLSRESLY 324
           YTELKC+  LN++ + H+ KLL+TWVQ  + PD+D++IG R+   G L+D+T  SR SLY
Sbjct: 275 YTELKCFTKLNVQDTAHRRKLLKTWVQIGLIPDSDLIIGTRDTQVGQLEDLTWYSRGSLY 334

Query: 325 RKFNNKHQPRAHTNFNYNAQVAVEWSQYAMKAIIRLIEGNLNQKSVLEP----QAFVVTV 380
           +KFNN    R +   N+NA +AVEW  + +++I  L+  N +  S  +P    ++F V V
Sbjct: 335 KKFNNPSIARNNKYLNFNANIAVEWCFHCIESICDLVMKN-SLSSPDDPYPKYESFKVIV 393

Query: 381 YRGHDIGIRKLKGVPKYAEIPKEF 404
            + H+I ++KL  VP++ +IP+ F
Sbjct: 394 DKSHNIIVKKLTKVPRHVQIPRAF 417

>Skud_4.639 Chr4 complement(1140646..1141974) [1329 bp, 442 aa] {ON}
           YDR370C (REAL)
          Length = 442

 Score =  216 bits (549), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 141/403 (34%), Positives = 207/403 (51%), Gaps = 26/403 (6%)

Query: 9   ETDDLLNSFHRLSINDQKRVRFKEFHH---HDPGKYVSKPAHIFQKSKEVACYTGGKLYI 65
           + DD  N   R      K V +  F H   HD  +    P  IFQ SKEVA +T  + Y 
Sbjct: 52  QKDDYWNRCSRF-----KCVPYTSFVHTSIHDLSR--KPPGDIFQDSKEVALFTNYQAY- 103

Query: 66  NDGNTTNLTILPLLKEDIAALAQSKNTQKSGSFKSKYLGLSLYAGFEDYVFTMSPDMLDS 125
               T    ++P L++ I  L +S +  ++   K  YLG  L+A  + +V  M+   LDS
Sbjct: 104 ---TTARKDLIPSLRDGITELYES-SLLEARRRKVPYLGHDLFANIDQFV-PMTISELDS 158

Query: 126 AKPCLDYINEWNRGSKGEKKFGESYRHIIVGPRHHLVELTMALFANDSDYK-LVCTVLRG 184
             PC+ Y+  W   + G K F    +  IV  RHH+V+LTM  F   +  K L+ T +  
Sbjct: 159 ISPCISYVENWKLSNHG-KNFKIGKKFTIVSARHHIVDLTMHRFDRRNKRKSLIVTYMGA 217

Query: 185 KFIVLSQFDDGSQRNRNEGITLSDRRTRMLCYSGFVI-------CKIWSLNRGIIPSQFF 237
             I  S+      +   EGI  SD   + +CYSGF          K   LN    P  F 
Sbjct: 218 GLISFSRNPKNDFQMSKEGIYSSDPNMKKICYSGFEFEHWVTEDIKATDLNGPKHP-IFS 276

Query: 238 YYGTPIRRGHLATFTCEMDAYNQIENHYTELKCYGPLNMKSSYHKSKLLRTWVQTEVSPD 297
              + +         CE+DA+N +    TELKC+GPL+M +S H+ KLL+TW+QT + P+
Sbjct: 277 VVESKLSEDIGLLMRCEIDAFNPVSRTNTELKCFGPLSMHNSNHRKKLLKTWIQTGLLPN 336

Query: 298 TDVVIGCRNAYDGTLQDITQLSRESLYRKFNNKHQPRAHTNFNYNAQVAVEWSQYAMKAI 357
           +D+VIG R+++ G L DI   SR+SLY+KFN+   P +    N+NA+VAVEW  + +K+I
Sbjct: 337 SDIVIGLRDSHSGQLLDIQWYSRDSLYKKFNHPGLPPSKKELNFNAKVAVEWCNHCIKSI 396

Query: 358 IRLIEGNLNQKSVLEPQAFVVTVYRGHDIGIRKLKGVPKYAEI 400
             L+E N++  +   P++F V++     I I KL  VPK  E+
Sbjct: 397 CELVEANISHYNSTRPESFEVSIDANGTIAITKLNTVPKNVEL 439

>YDR370C Chr4 complement(1217782..1219110) [1329 bp, 442 aa] {ON}
           Putative protein of unknown function
          Length = 442

 Score =  216 bits (549), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 134/392 (34%), Positives = 203/392 (51%), Gaps = 37/392 (9%)

Query: 28  VRFKEFHHHDPGKYVSKPAH-IFQKSKEVACYTGGKLYINDGNTTNLTILPLLKEDIAAL 86
           + +  F H     +++KP   IF +SKEVA +T G+ Y          ++P LKE IA L
Sbjct: 66  IPYTSFLHTGMHNFLTKPPRDIFHESKEVALFTNGRAY----TILRKDLIPNLKESIAEL 121

Query: 87  AQSKNTQKSGSFKSKYLGLSLYAGFEDYVFTMSPDMLDSAKPCLDYINEWNRGSKGEKKF 146
            +S +  ++   K  YLG  L+A  +++V  M+   LDS  PC  YI  W   + G K F
Sbjct: 122 YES-SLLEAKKRKVPYLGHDLFANIDEFV-PMTISELDSVSPCFSYIENWILDNPG-KDF 178

Query: 147 GESYRHIIVGPRHHLVELTMALF-ANDSDYKLVCTVLRGKFIVLSQFDDGSQRNRNEGIT 205
               +  +V  RHH+V+LTM LF   +    L+ T +    +   +      +   EGI 
Sbjct: 179 KIGKKFTVVTTRHHIVDLTMHLFNRRNRQTSLIVTYMGAGLLSFCRNVKKDSQMSKEGIY 238

Query: 206 LSDRRTRMLCYSGFVI-----------------CKIWSLNRGIIPSQFFYYGTPIRRGHL 248
            +D   + +CYSGF                   C I+SL    +  +    G  IR    
Sbjct: 239 SNDPNMKKICYSGFEFENWVTENSKVADLTGSKCPIFSLVESKLSEEI---GLLIR---- 291

Query: 249 ATFTCEMDAYNQIENHYTELKCYGPLNMKSSYHKSKLLRTWVQTEVSPDTDVVIGCRNAY 308
               CEMDA+N +    TELKC+ PL+M +S H+ KLL+TWVQT + P++D++IG R+++
Sbjct: 292 ----CEMDAFNPVSETNTELKCFAPLSMHNSNHRRKLLKTWVQTGLLPNSDIMIGLRDSH 347

Query: 309 DGTLQDITQLSRESLYRKFNNKHQPRAHTNFNYNAQVAVEWSQYAMKAIIRLIEGNLNQK 368
            G L DI   SR+ L +KFN+   P      NYNAQ+AVEW  Y ++AI +L+E N++  
Sbjct: 348 SGQLLDIQWYSRDLLCKKFNHPGLPTNKKELNYNAQIAVEWCHYCIEAICKLVEANISDY 407

Query: 369 SVLEPQAFVVTVYRGHDIGIRKLKGVPKYAEI 400
           S  +P++F + +   + I I KLK  P+  E+
Sbjct: 408 SSTKPESFEIGIDTNNAIVITKLKTTPRNVEL 439

>Kpol_1016.4 s1016 (8493..9362,9366..9737) [1242 bp, 413 aa] {ON}
           (8493..9362,9366..9737) [1242 nt, 414 aa]
          Length = 413

 Score =  209 bits (532), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 135/389 (34%), Positives = 213/389 (54%), Gaps = 27/389 (6%)

Query: 28  VRFKEFHHHDPGKYVSKPAHIFQKSKEVACYTGGKLYINDGNTTNLTILPLLKEDIAALA 87
           + F  F H +   +  K   +F +SK VA +   +L+IN  +      LPLLK+DIA ++
Sbjct: 41  IPFHRFVHSNARSFPQKTKDLFLESKTVAFFQKDQLFINVEDAA----LPLLKKDIANIS 96

Query: 88  QSKNTQKSGSFKSKYLGLSLYAGFEDYVFTMSPDMLDSAKPCLDYINEWNRGSKGEKKFG 147
             K+   S  +K  YLG  LYA  + Y   +  D+LDS KPC D+I  W    +GE  +G
Sbjct: 97  -GKSVLNSKKYKLPYLGSDLYASTDKYG-PLPEDVLDSPKPCFDFIRHWENEHRGEH-YG 153

Query: 148 ESYRHIIVGPRHHLVELTMALFANDSDYK--LVCTVLRGKFIVLSQFDDGSQRNRNE--G 203
               + I+ PRHH+ E+ M+LF ++ +    L+CT L+   I+LS+ DD S  + +   G
Sbjct: 154 AHADYTILSPRHHITEIVMSLFEDEKNCSVYLLCTYLKNGIILLSK-DDASSSSNSNTTG 212

Query: 204 ITLSDRRTRMLCYSGF-----VICKIWSLNRGIIPSQFFYYGTPIRRGHLATFTCEMDAY 258
           +  S+  TR +CYSGF     V+  I    R I    F    + +          E+D Y
Sbjct: 213 LNSSNPMTRKICYSGFAFEDLVLEDIAENARPI----FSVVESKLTESINLLLRNELDGY 268

Query: 259 NQIENHYTELKCYGPLNMKSSYHKSKLLRTWVQTEVSPDTDVVIGCRNAYDGTLQDITQL 318
           N + N +TELKC+ PL  K  +   ++L+TWVQT + P++D+VIG R+   G L+D+   
Sbjct: 269 NNVTNMFTELKCFAPL--KCMFSAKEVLKTWVQTGLIPESDIVIGIRDTQSGLLEDLVWY 326

Query: 319 SRESLYRKFNNKHQPRAHTNFNYNAQVAVEWSQYAMKAIIRLIEGNLNQKSVLEPQAFVV 378
           +R+ L R FNN   P A ++FN+NA +AVEW ++ M++I+ L+  ++   +   P +F +
Sbjct: 327 NRKDLCRTFNNPSLPPAPSHFNFNANIAVEWLKFTMESIVSLVSSSIADSN--HPCSFKL 384

Query: 379 TVYRGHDIGIRKLKGVPKYA--EIPKEFI 405
            +     I I+KL  +P+    +IPKEF+
Sbjct: 385 KIDNHKTISIQKLSRIPQTVQRQIPKEFV 413

>SAKL0G02596g Chr7 complement(214675..215877) [1203 bp, 400 aa] {ON}
           weakly similar to uniprot|Q06349 Saccharomyces
           cerevisiae YDR370C Hypothetical ORF
          Length = 400

 Score =  191 bits (485), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 129/409 (31%), Positives = 207/409 (50%), Gaps = 27/409 (6%)

Query: 7   AIETDDLLNSFHRLSIN--DQKRVRFKEFHHHDPGKYVSKPAHIFQKSKEVACYT----G 60
            I TD+L     +LS+    Q     K F H +   + S P   FQ+S+E+  +T     
Sbjct: 2   TIPTDELTADISKLSLQHGSQNTANCKGFVHSNVSHFPSVPCKFFQESREIGTFTRMVSS 61

Query: 61  GKLYINDGNTTNLTILPLLKEDIAALAQSKNTQKSGSFKSKYLGLSLYAGFEDYVFTMSP 120
           GK   +D     L + PL K+DI     +   + +   K++YLG  L  GFEDY+  +S 
Sbjct: 62  GKYLFDD----KLGLRPL-KDDICEYIHNP-AKNASKIKTQYLGYDLLNGFEDYI-PLSE 114

Query: 121 DMLDSAKPCLDYINEWNRGSKGEKKFGESYRHIIVGPRHHLVELTMALFANDSDYKLVCT 180
           D L++    L++I  W    K  KK+G   +  IV  RHHL++L M  F+ + +  L+ T
Sbjct: 115 DELNNMDGILNFIGNWEE--KNGKKYGSENKFTIVSNRHHLIDLIMCPFSLE-EANLIVT 171

Query: 181 VLRGKFIVLSQFDDGSQRNRNEGITLSDRRTRMLCYSGFVICKIWSLNRGIIPSQF--FY 238
            L G  I+ S   D S+   + GI   D R R LCY+GF +  + +  +   P     FY
Sbjct: 172 HLDGLLIISS---DKSKPKVDSGIRSKDTRVRKLCYTGFELENLVTKGKVDSPGMHTCFY 228

Query: 239 --YGTPIRRGHLATFTCEMDAYNQIENHYTELKCYGPLNMKSSYHKSKLLRTWVQTEVSP 296
                 +  G       EMD+YN   ++Y ELKC     +K+S H+ KLLR W+QT + P
Sbjct: 229 SIVENKLTEGVSLLLQAEMDSYNPKTDNYVELKCSVNFQLKNSNHRRKLLRMWIQTGLVP 288

Query: 297 DTDVVIGCRNAYDGTLQDITQLSRESLYRKFNNKHQPRAHTNFNYNAQVAVEWSQYAMKA 356
            TD+++G R+ Y   L  +   +R+ +Y+KF+ ++       +N+N+ VAV+WS + +  
Sbjct: 289 RTDLLVGFRDPYYNQLDALKPYTRDEIYKKFSTRNLNENRKYYNFNSTVAVQWSHHVIAK 348

Query: 357 IIRLIEGNLNQKSVLEPQAFVVTVYRGHDIGIRKLKGVPKYAEIPKEFI 405
           I  L++ NL  + +   Q+F +T+ R   + + KL   P    IP++F+
Sbjct: 349 ITELVDKNLTDEPL---QSFKLTLTRDLQLSLTKLANTPA-GLIPEKFL 393

>CAGL0A02860g Chr1 complement(300736..301944) [1209 bp, 402 aa] {ON}
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370c
          Length = 402

 Score =  171 bits (433), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 112/363 (30%), Positives = 179/363 (49%), Gaps = 20/363 (5%)

Query: 29  RFKEFHHHDPGKYVSKPAHIFQKSKEVACYTGGKLYINDGNTTNLTILPLLKEDIAALAQ 88
           R K  HH +  ++       +  +K +  +   KLY        + + P LK+ IA +A+
Sbjct: 50  RLKTSHHKNMPQF-------YDSAKTLGIFHDHKLY----EMNRMDLFPQLKDPIAHIAK 98

Query: 89  SKNTQKSGSFKSKYLGLSLYAGFEDYVFTMSPDMLDSAKPCLDYINEWNRGSKGEKKFGE 148
           S   +K+   +  +LG+SLY   + Y   M+   LD+ + C  Y++++   S G+K +GE
Sbjct: 99  STPAEKTQLVRP-FLGISLYENHDKYS-PMTAKELDTTEACSTYLDQY-ENSHGQK-YGE 154

Query: 149 SYRHIIVGPRHHLVELTMALFAND-SDYKLVCTVLRGKFIVLSQFDDGSQRNRNEGITLS 207
               +IV  RHH+++L +  F+   ++  L+C    G  + +SQ D     N   G+   
Sbjct: 155 DRDFVIVTARHHMIDLAILPFSRQFTNVNLLCAYTPGNLLEISQ-DPADNTNDKVGVNTD 213

Query: 208 DRRTRMLCYSGFVICKIW--SLNRGIIPSQFFYYGTPIRRGHLATFTCEMDAYNQIENHY 265
           +   + +C+SGF +  I   S N       F      I    L    CE+DAYN I +HY
Sbjct: 214 NPILKKICFSGFALEDILTESANDEERNPTFLIVENEIANTRLL-MRCEIDAYNPITSHY 272

Query: 266 TELKCYGPLNMKSSYHKSKLLRTWVQTEVSPDTDVVIGCRNAYDGTLQDITQLSRESLYR 325
           TELKCY   N  +  H+ KLL++W+QT V P TD+VIG R+   G LQD+   +R  LY 
Sbjct: 273 TELKCYAKYNFGNPNHRRKLLKSWIQTGVIPTTDIVIGVRDTESGCLQDVRCYNRNLLYN 332

Query: 326 KFNNKHQPRAHTNFNYNAQVAVEWSQYAMKAIIRLIEGNLNQKSVLEPQAFVVTVYRGHD 385
           K  +K  PR  +  NY+  ++V W +  +  +   I   L++    EPQ F + V    +
Sbjct: 333 KLISKSLPRCDSELNYDPAISVVWYRSLINTLTTTIASLLDKFGRDEPQLFSIKVDNNCN 392

Query: 386 IGI 388
           I I
Sbjct: 393 IRI 395

>KLTH0F15994g Chr6 (1298649..1299821) [1173 bp, 390 aa] {ON} weakly
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370C Hypothetical ORF
          Length = 390

 Score =  162 bits (410), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 113/394 (28%), Positives = 195/394 (49%), Gaps = 24/394 (6%)

Query: 17  FHRLSIND---QKRVRFKEFHHHDPGKYVSKPAHIFQKSKEVACYTGGKLYINDGNTTNL 73
           F +LS+ D   +  V  + F       + ++P H F + KE+   T    +  D +   L
Sbjct: 5   FEKLSLEDLPDEACVSCRGFERASISHFPAEPLHFFDEVKEIGTMT----HWIDSDKFEL 60

Query: 74  ---TILPLLKEDIAALAQSKNTQKSGSFKSKYLGLSLYAGFEDYVFTMSPDMLDSAKPCL 130
                 P LK+D+     +K   K+ S    Y+G  L   ++D+   ++P+ L+      
Sbjct: 61  GRKQSAPHLKKDLGLFTITKKLAKTNS----YVGHDLLEHYDDFQ-PLTPNQLEDMSGVF 115

Query: 131 DYINEWNRGSKGEKKFGESYRHIIVGPRHHLVELTMALFANDSDYKLVCTVLRGKFIVLS 190
           +++N+W  G  G K +       IV  RH+L++L MA F+ D D       + G    L 
Sbjct: 116 EFLNKW-EGDHG-KPYSSGSDFTIVCSRHNLIDLIMAPFS-DEDVHFNVKYING---YLH 169

Query: 191 QFDDGSQRNRNEGITLSDRRTRMLCYSGFVICKIWSLNRGIIPSQFFY--YGTPIRRGHL 248
            F D   + +++GI  S+   R +CY+GF +  + +  +   P   FY      I +   
Sbjct: 170 IFPDKQFQKKDDGIYSSESNIRRICYTGFELEDLVTETQPGAPKSAFYSLVQGKISKNIK 229

Query: 249 ATFTCEMDAYNQIENHYTELKCYGPLNMKSSYHKSKLLRTWVQTEVSPDTDVVIGCRNAY 308
             F  EMD +N  +  YTE+KC   L +KS++H+ KLLR WVQT + P TD++IG R+ Y
Sbjct: 230 LLFKAEMDCFNPAKRSYTEIKCTTGLKVKSAFHRRKLLRMWVQTSLVPSTDLLIGLRDPY 289

Query: 309 DGTLQDITQLSRESLYRKFNNKHQPRAHTNFNYNAQVAVEWSQYAMKAIIRLIEGNLNQK 368
              L      +R+ LY+KFNN++       +NYNA ++V+W ++ +K + + I   + +K
Sbjct: 290 YHQLSSFECYTRQELYQKFNNRNLSLLKKKYNYNANISVQWFRHLVKRLCQTITPYV-EK 348

Query: 369 SVLEPQAFVVTVYRGHDIGIRKLKGVPKYAEIPK 402
           +  E  +F +T+ +  ++ +RK++      E PK
Sbjct: 349 TPTEAVSFKLTLTKQLELRLRKIETPSTAKESPK 382

>TPHA0J02600 Chr10 complement(577310..578635) [1326 bp, 441 aa] {ON}
           Anc_5.437 YDR370C
          Length = 441

 Score =  160 bits (406), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 116/389 (29%), Positives = 199/389 (51%), Gaps = 19/389 (4%)

Query: 27  RVRFKEFHHHDPGKYVSKPAHIFQKSKEVACYTG---GKLYINDGNTTNLTILPLLKEDI 83
           R+ FK F + +     S+P +IFQ++K VA Y      K+  N+    N +  P L +DI
Sbjct: 62  RIPFKHFSYSNAHIGKSQP-NIFQEAKGVALYYDKRITKITNNEAELINESNPPFLTKDI 120

Query: 84  AALAQSKNTQKSGSFKSKYLGLSLYAGFEDYVFTMSPDMLDSAKPCLDYINEWNRGSKGE 143
           + L++  +   S  FK  Y+G +LY   E +   M   +LDS  PC +Y+    + S+ +
Sbjct: 121 SNLSEI-SLLDSKKFKLPYMGYNLYDEIEKFG-PMDSTLLDSTVPCFEYLRTL-KISEED 177

Query: 144 KKFGESYRHIIVGPRHHLVELTMALF-ANDSDY---KLVCTVLRGKFIVLSQFDDGSQRN 199
           K +   Y    + PRHHL EL M ++ + +S+      + T ++   IV+S+ D   + N
Sbjct: 178 KLYNTPY--TFMTPRHHLTELMMTVYESRESELTGKSWLFTRIKDDLIVISE-DLAKENN 234

Query: 200 RN-EGITLSDRRTRMLCYSGFVICKIWSLNRGIIPSQFFYYGTPIRRGHLATFT--CEMD 256
            + +   L +  ++ +  SGF   ++   N       +FY     R    +TF    EMD
Sbjct: 235 PSPQNHKLQNSFSKKVINSGFTFEELVIENFQECHKPYFYISEN-RLTPKSTFIIRSEMD 293

Query: 257 AYNQIENHYTELKCYGPLNMKSSYHKSKLLRTWVQTEVSPDTDVVIGCRNAYDGTLQDIT 316
           +YN     +TELKC+  L++  + H+ KLL+TW QT +SP+ D+VIG R+   G L+D+ 
Sbjct: 294 SYNNKTETFTELKCFNKLHLGVAQHRKKLLKTWFQTGLSPNCDIVIGIRDTSSGILEDLL 353

Query: 317 QLSRESLYRKFNNKHQPRAHTNFNYNAQVAVEWSQYAMKAIIRLIEGNLNQKSVLEPQAF 376
             SRE++Y+K  +   P+   +F++   + ++W  + + AI      + +  +   P  +
Sbjct: 354 WYSRENMYQKLQDPSLPKFKNSFDFKPHIGIQWLNHCIHAIESAFTKDTSD-TASNPMTY 412

Query: 377 VVTVYRGHDIGIRKLKGVPKYAEIPKEFI 405
            V + +   I I+KL  VPK  EIP +F+
Sbjct: 413 KVIIDKHKSIIIKKLSIVPKNVEIPTDFL 441

>TBLA0A02800 Chr1 (675150..676511) [1362 bp, 453 aa] {ON} Anc_5.437
           YDR370C
          Length = 453

 Score =  150 bits (379), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 114/379 (30%), Positives = 172/379 (45%), Gaps = 25/379 (6%)

Query: 46  AHIFQKSKEVACYTGGKLYINDGNTTNLTI-LPLLKEDIAALAQSKNTQKSGSFKSKYLG 104
           + +++ SKEVA Y  G L IN   T   T  +P LK+DI  +A  K+   S  +K+KY+G
Sbjct: 57  SDLYRTSKEVATYHLGNLNINTDPTIEHTKGVPCLKDDICQIA-GKSLLDSKKYKAKYIG 115

Query: 105 LSLYAGFEDYVFTMSPDMLDSAKPCLDYINEWNRGSKGEKK-FGESYRHIIVGPRHHLVE 163
             L+  +E Y   M  + L     C  YI  +++    EKK +G     +I+  RHH+ +
Sbjct: 116 ADLFKDYEKY-HAMEKEPLHDPISCFKYIQYYDKKHANEKKKYGMDKEFVIITSRHHIND 174

Query: 164 LTMALFA--NDSDYKLVCTVLRGKFIVLSQ--------------FDDGSQRNRNEGITLS 207
           L +A F   +D +  ++ T L    I+LSQ              F +  ++  N G    
Sbjct: 175 LVLAPFKKISDPEVSVLLTYLGDNRILLSQDYAHEPPDWRENKQFYNSMRKIVNSGFAFE 234

Query: 208 DRRTRMLCYSGFV--ICKIWSLNRGIIPSQFFYYGTPIRRGHLATFTCEMDAYNQIENHY 265
           D   +    S     + +    +  I  + F      I          EMD YN + N Y
Sbjct: 235 DLVIKDYTSSKLTPSLEEQQKKDPSITNNYFSVVENDISPKLTILLRSEMDGYNPLTNSY 294

Query: 266 TELKCYGPLNMKSSYHKSKLLRTWVQTEVSPDTDVVIGCRNAYDGTLQDITQLSRESLYR 325
           TELKC+  LNM S +H+ KLL+TWVQ    P++D+++G R+   G L DIT  SR+ L  
Sbjct: 295 TELKCFTRLNMGSPFHRQKLLKTWVQIGQLPNSDLLVGSRDTQTGLLNDITWFSRDDLVT 354

Query: 326 KFNNKHQPRAHTNFNYNAQVAVEWSQYAMKAIIRLIEGNLNQKSVLE---PQAFVVTVYR 382
           K ++ + PR   + N     A  W  + + AI  L    L +        P  F + V +
Sbjct: 355 KCDSYYSPRLRFHQNTTPTNASAWYYHVLSAITSLTRDYLKKTPKAPSSVPVPFRLIVEK 414

Query: 383 GHDIGIRKLKGVPKYAEIP 401
              I +  LK VP    IP
Sbjct: 415 NRTITLLPLKKVPASVPIP 433

>Kwal_55.21415 s55 (826461..827630) [1170 bp, 389 aa] {ON} YDR370C -
           Hypothetical ORF [contig 130] FULL
          Length = 389

 Score =  143 bits (361), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 107/388 (27%), Positives = 186/388 (47%), Gaps = 18/388 (4%)

Query: 13  LLNSFHRLSINDQKR---VRFKEFHHHDPGKYVSKPAHIFQKSKEVACYTGGKLYINDGN 69
           +L +   LS+ D+        K F H    ++       F + +EVA  T   L  ++  
Sbjct: 1   MLPNLQDLSLQDRTEEVHANCKNFQHAQINQFPKNVLPFFDEVQEVATITH-LLDTDEFL 59

Query: 70  TTNLTILPLLKEDIAALAQSKNTQKSGSFKSKYLGLSLYAGFEDYVFTMSPDMLDSAKPC 129
             +   +P L +D+    +S      G    KY+G  L   F++YV  ++P  L+     
Sbjct: 60  LDDKLGMPELVQDLCEFTESGKLANKG----KYIGHDLLDHFDEYV-PITPKQLEDMAGV 114

Query: 130 LDYINEWNRGSKGEKKFGESYRHIIVGPRHHLVELTMALFANDSDYKLVCTVLRGKFIVL 189
             ++  W +     + F ++    IV  RH+L++L M  F+ D D  L      G ++ L
Sbjct: 115 QAFLERWKQLHG--RSFCDNADFTIVCSRHNLIDLIMMPFS-DEDVHLKIQFSNG-YLNL 170

Query: 190 SQFDDGSQRNRNEGITLSDRRTRMLCYSGFVICK-IWSLNRGIIPSQFF-YYGTPIRRGH 247
           S   D   +  ++GI   D + + +CY+GF +   I + ++  + S F+      +  G 
Sbjct: 171 SP--DAQYQKTDQGIHSGDTKIKKICYTGFELENLITATSKPDVRSSFYSLVEGKLGDGI 228

Query: 248 LATFTCEMDAYNQIENHYTELKCYGPLNMKSSYHKSKLLRTWVQTEVSPDTDVVIGCRNA 307
                 EMD +N     YTE+KC   L +KS+YH+ KLLR WVQT + P T++++G R+ 
Sbjct: 229 KLLLKAEMDCFNSSTRSYTEIKCSSGLKVKSTYHRRKLLRMWVQTSLVPSTNLLVGIRDP 288

Query: 308 YDGTLQDITQLSRESLYRKFNNKHQPRAHTNFNYNAQVAVEWSQYAMKAIIRLIEGNLNQ 367
           Y   L      +R  LYRKFNN+       N+NYNA ++V+W ++ ++ + ++I+  + +
Sbjct: 289 YYHQLTSFECYTRSQLYRKFNNQRLTVMRKNYNYNATISVQWFRHVIQQLCQMIKPFI-E 347

Query: 368 KSVLEPQAFVVTVYRGHDIGIRKLKGVP 395
           K   E   F +T+ +   I +RK+   P
Sbjct: 348 KGSKEEVNFRLTLRKNLTIKLRKMPETP 375

>AER404C Chr5 complement(1412412..1413572) [1161 bp, 386 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR370C
          Length = 386

 Score =  135 bits (340), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 99/356 (27%), Positives = 169/356 (47%), Gaps = 23/356 (6%)

Query: 48  IFQKSKEVA-CYTGGKLYINDGNTTNLTILPLLKEDIAALAQSKNTQKSGSFKSKYLGLS 106
           IF +S+EV   +  G +Y  D        LPLL ++I        + +S S    Y+G  
Sbjct: 46  IFSESREVGTAFRQGLVYDLDDKKN----LPLLNDEICEYI----SHRSKSKLIGYVGSD 97

Query: 107 LYAGFEDYVFTMSPDMLDSAKPCLDYINEWNRGSKGEKKFGESYRHIIVGPRHHLVELTM 166
           L    E +   ++ + L      L +I +W   +  E  +    +  IV PRHH++++ M
Sbjct: 98  LSVESETF-HPVTSEELHCLHGLLKFIAKWE--ADNEVNYASRSKFTIVSPRHHILDILM 154

Query: 167 ALFANDSDYKLVCTVLRGKFIVLSQFDDGSQRNRNEGITLSDRRTRMLCYSGFVICKIWS 226
             F N+   +LV T  RG F++       +   R  GI      TR +CY+GF + ++ +
Sbjct: 155 IPFGNER-CRLVFTAHRGLFVITL-----APSQRPTGINSPSSATRKICYTGFELERLLT 208

Query: 227 LNRGIIPSQFF-YYGTPIRRGHLATFTCEMDAYNQIENHYTELKCYGPLNMKSSYHKSKL 285
              G     F+ +    +         CEMDAYN     YTE+K     N+++  H SKL
Sbjct: 209 ATSGTERGSFYSFIEAKLEPDITILLQCEMDAYNPKRQKYTEIKSSVDFNVRNVRHLSKL 268

Query: 286 LRTWVQTEVSPDTDVVIGCRNAYDGTLQDITQLSRESLYRKFNNKHQPRAHTN-FNYNAQ 344
           L+ W QT + P TD+++G R+     L+ +   S + +  K   + + R+H + FN+N +
Sbjct: 269 LKIWAQTALLPSTDILVGFRDPSTHVLKTVVPYSVDQIAEKLYIRDRTRSHPSYFNFNPE 328

Query: 345 VAVEWSQYAMKAIIRLIEGNLNQKSVLEPQAFVVTVYRGHDIGIRKLKGVPKYAEI 400
           VA +W+ YA++ I   +   ++  S   PQ+F+V + +   + IR    V  Y+E+
Sbjct: 329 VAKDWTHYAIREICERLSSLVDATSS-SPQSFLVEIDKNLQMKIR--PTVVDYSEL 381

>KLLA0E02245g Chr5 complement(210001..211212) [1212 bp, 403 aa] {ON}
           weakly similar to uniprot|Q06349 Saccharomyces
           cerevisiae YDR370C Hypothetical ORF
          Length = 403

 Score = 98.2 bits (243), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 77/274 (28%), Positives = 128/274 (46%), Gaps = 25/274 (9%)

Query: 94  KSGSFKSKYLGLSLYAGFEDYVFTMSPDMLDSAKPCLDYINEWNRGSKGEKKFGESYRHI 153
           ++ + K  ++G+ L  G++DYV  +  ++L+S     +    + +    EK         
Sbjct: 106 ENKAVKDSFIGIDLTKGYDDYV-PLDRNVLNSLVILKEAYQRYEKTLNPEKT-------T 157

Query: 154 IVGPRHHLVELTMALFANDSDYKLVCTVLRGKFIVLSQFDDGSQRNRNEGITLSDRRTRM 213
            V  RHH++++ M  F  D    L+ TV   K I++S   D S+   N      +   + 
Sbjct: 158 FVSLRHHIIDIIMCPFL-DEPLSLLMTVQPDKNILISV--DKSKDKPNGIHETRNSFNKK 214

Query: 214 LCYSGFVI--CKIWSLNRGIIPSQFFYYGTPIRRGHL-----ATFTCEMDAYNQIENHYT 266
           +CY+GF +    I S   G I     YY   I  G L          EMD+ N + + YT
Sbjct: 215 ICYTGFALEDLLIESPTEGHILEHELYYS--IVHGSLNDEIDLLIQAEMDSINTLTDTYT 272

Query: 267 ELKCYGPLNMKSSYHKSKLLRTWVQTEVSPDTDVVIGCRNAYDGTLQDITQLSRESLYRK 326
           E+K      + ++YH+ KLLR W+QT + P +D++IG RN+Y   L+ +     + +Y K
Sbjct: 273 EIKSSVHFKLGNTYHRRKLLRMWIQTNLLPKSDLLIGFRNSYSNELEQLKAYKIQDIYHK 332

Query: 327 FNNKH---QPRAHTNFNYNAQVAVEWSQYAMKAI 357
            NN     +P     FN N  VA +W Q+  + +
Sbjct: 333 INNSSIVGKPGKFYKFNPN--VANDWFQHIFQVL 364

>NCAS0B01640 Chr2 (268028..268750) [723 bp, 240 aa] {ON} Anc_8.679
          Length = 240

 Score = 35.0 bits (79), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 40/68 (58%), Gaps = 5/68 (7%)

Query: 257 AYNQIENHYTELKCYGP--LNMKSSYHKSKLLRTWVQT--EVSPDTDVVIGCRNAYDGTL 312
           A+N ++ H+T++    P  L MKSS   S+L+R  +Q   E+SP+  VV   ++ +   L
Sbjct: 114 AFN-VQQHFTQIIHTSPVVLFMKSSQDDSRLMRDLLQKEYEISPEIAVVDLDKHTHGAAL 172

Query: 313 QDITQLSR 320
           QD  +L++
Sbjct: 173 QDYIRLNK 180

>TPHA0G03650 Chr7 (776977..778110) [1134 bp, 377 aa] {ON} Anc_3.570
           YGL246C
          Length = 377

 Score = 33.9 bits (76), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 46/100 (46%), Gaps = 12/100 (12%)

Query: 264 HYTELKCYGPLNMKSSYHK--SKLLRTWVQTEVSPDTDVVIGCRNAYDGTLQDITQLSRE 321
           HY ELKC   +N  +   K  +KL +TW+Q  +   T +  G R+     L+ I + +  
Sbjct: 228 HYIELKCTAAINNINDTKKFENKLFKTWIQCFLIGITRITYGFRDE-QYLLKTIEEFATS 286

Query: 322 SLYRKFNNKHQPRAHTNFNYNAQVAVEW----SQYAMKAI 357
            +   F N H P   +    N   A++W    +++ MK I
Sbjct: 287 DIPLIFKN-HNPTLAS----NCVNAIKWYGVFTEWLMKMI 321

>KLLA0E12893g Chr5 complement(1140409..1141563) [1155 bp, 384 aa]
           {ON} similar to uniprot|P53063 Saccharomyces cerevisiae
           YGL246C RAI1 Nuclear protein that binds to and
           stabilizes the exoribonuclease Rat1p required for
           pre-rRNA processing
          Length = 384

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 2/45 (4%)

Query: 264 HYTELKCYGPLNMKSSYHK--SKLLRTWVQTEVSPDTDVVIGCRN 306
           HY ELKC   +N  S  HK   KL +TW+Q  +     ++ G R+
Sbjct: 234 HYAELKCTTMVNTVSDAHKFERKLFKTWLQCFLVGINRIIYGFRD 278

>TDEL0A05360 Chr1 complement(943869..945080) [1212 bp, 403 aa] {ON}
           Anc_8.592 YBR168W
          Length = 403

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 26/49 (53%), Gaps = 4/49 (8%)

Query: 89  SKNTQKSGSFKSKYLG----LSLYAGFEDYVFTMSPDMLDSAKPCLDYI 133
           S N  + GS  + +LG    LSL+  F  YV T+  D+ DS  P LD I
Sbjct: 89  SLNKLRIGSIFTLWLGIMSGLSLFYAFAYYVLTVYQDLRDSEPPTLDDI 137

>NDAI0G05340 Chr7 (1301733..1303889) [2157 bp, 718 aa] {ON}
           Anc_1.247
          Length = 718

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 47/117 (40%), Gaps = 30/117 (25%)

Query: 214 LCYSGFVI--CKIWSLNRGIIPSQFFYYGTPIRRGHLATFTCEMDAYNQIENHYTELKCY 271
           LC +G +    K+W+L++     Q         RGHLAT  C      + +N Y      
Sbjct: 411 LCTAGHMDNEIKVWNLSKKKQIGQM--------RGHLATINCM-----EFDNDY------ 451

Query: 272 GPLNMKSSYHKSKLLRTW----VQTEVSPDT--DVVIGCRNAYDGTLQDITQLSRES 322
              NM  S  K  LL+ W    +   V  D+  D    C   +D  + +IT LS  S
Sbjct: 452 ---NMLVSGGKDALLKLWDLNTIPLNVEQDSTFDATKPCIYTFDSHIDEITALSLSS 505

>KAFR0A03890 Chr1 complement(792251..793213) [963 bp, 320 aa] {ON}
           Anc_8.684 YOR246C
          Length = 320

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 26/59 (44%), Gaps = 3/59 (5%)

Query: 237 FYYGTPIRRGHLATFTCEMDAYNQIENHYTELKCYGPLNMKSSYHKSKL---LRTWVQT 292
           +++G    +G LAT  C +     IE H  +    G L  KSSY    L     TW+ T
Sbjct: 251 YFFGVSNEQGSLATLKCALSDDINIEKHNGKYFTTGGLETKSSYVAKNLDDAASTWIWT 309

>Smik_7.15 Chr7 complement(32394..33557) [1164 bp, 387 aa] {ON}
           YGL246C (REAL)
          Length = 387

 Score = 30.4 bits (67), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 31/62 (50%), Gaps = 3/62 (4%)

Query: 264 HYTELKCYGPLNMKSSYHK--SKLLRTWVQTEVSPDTDVVIGCRNAYDGTLQDITQLSRE 321
           HY ELKC   +   S  HK   KL RTW+Q  +     ++ G ++ +   L+ + + S E
Sbjct: 238 HYAELKCTKQVMNASDTHKFERKLFRTWLQCFLVGIPRIIYGFKDDH-YVLKTVEEFSTE 296

Query: 322 SL 323
            +
Sbjct: 297 EV 298

>NCAS0E00240 Chr5 complement(34922..36064) [1143 bp, 380 aa] {ON}
           Anc_3.570
          Length = 380

 Score = 30.4 bits (67), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 36/158 (22%), Positives = 66/158 (41%), Gaps = 20/158 (12%)

Query: 208 DRRTRMLCYSGFVICKIWSLNRGIIPSQFFYYGTPIRRGHLATFTCEMDAYNQIENHYTE 267
           D+R++ +C +G     +     G   S     G  I       F  + D  + ++ HY E
Sbjct: 186 DKRSKKICNNGDEYVTVVKTGVG---SAKLVLGAEID----CVFDFKEDGKDNLK-HYAE 237

Query: 268 LKCYGPLNMKSSYHK--SKLLRTWVQTEVSPDTDVVIGCRNAYDGTLQDITQLSRESLYR 325
           LKC   +   +  HK   K+ RTW+Q  +     ++ G R+  +  L+ I + S + +  
Sbjct: 238 LKCTTQVITAADAHKFERKIFRTWLQCFLVGIPRIIYGFRDE-NYVLKTIEEYSTDEIPI 296

Query: 326 KFNNKHQPRAHTNFNYNAQVAVEW----SQYAMKAIIR 359
              N      +T  N     A++W    +++ +K I R
Sbjct: 297 LLKNN-----NTKMNSMCLDAIKWYGLFTEWLLKIIPR 329

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 46,586,567
Number of extensions: 2090235
Number of successful extensions: 4831
Number of sequences better than 10.0: 31
Number of HSP's gapped: 4901
Number of HSP's successfully gapped: 32
Length of query: 405
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 293
Effective length of database: 40,638,807
Effective search space: 11907170451
Effective search space used: 11907170451
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)