Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0C048805.438ON1041045582e-75
CAGL0A02882g5.438ON1041034601e-60
TDEL0D026305.438ON1021044513e-59
NCAS0F034105.438ON1061034436e-58
Kwal_55.214145.438ON1191034194e-54
SAKL0G02618g5.438ON1041043923e-50
ZYRO0F10120g5.438ON1051023923e-50
Kpol_1016.35.438ON971033862e-49
NDAI0B057005.438ON1041043811e-48
ACL169W5.438ON1031043473e-43
Ecym_45095.438ON1031063463e-43
KLTH0F15972g5.438ON1031033464e-43
Kpol_1016.3asingletonON971033291e-40
KLLA0E02267g5.438ON1031043263e-40
TPHA0C00950singletonON991042622e-30
TBLA0C05870singletonON1001041971e-20
KAFR0D02490singletonON107951945e-20
KAFR0D02500singletonON112901746e-17
KAFR0D02400singletonON114901693e-16
Kwal_14.18516.104ON53543680.53
Suva_4.997.322ON120174642.0
CAGL0I03718g7.322ON120174642.0
KNAG0B027207.322ON120474642.0
TPHA0C007608.332ON77050632.2
NDAI0A020907.322ON120067632.3
KNAG0J00120singletonON67472632.5
KNAG0H00110singletonON68972632.5
Suva_15.1716.29ON156131623.0
YOR162C (YRR1)6.60ON81049623.3
YDL145C (COP1)7.322ON120174623.4
Kwal_26.91118.750ON31147604.7
Kpol_2001.657.322ON120667605.6
Skud_9.1797.153ON99253605.9
SAKL0F10648g7.322ON120367598.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0C04880
         (104 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0C04880 Chr3 complement(944928..945242) [315 bp, 104 aa] {ON...   219   2e-75
CAGL0A02882g Chr1 (302262..302576) [315 bp, 104 aa] {ON} highly ...   181   1e-60
TDEL0D02630 Chr4 complement(502356..502664) [309 bp, 102 aa] {ON...   178   3e-59
NCAS0F03410 Chr6 (687900..688220) [321 bp, 106 aa] {ON} Anc_5.438     175   6e-58
Kwal_55.21414 s55 complement(825799..826158) [360 bp, 119 aa] {O...   166   4e-54
SAKL0G02618g Chr7 (217435..217749) [315 bp, 104 aa] {ON} conserv...   155   3e-50
ZYRO0F10120g Chr6 (820318..820635) [318 bp, 105 aa] {ON} conserv...   155   3e-50
Kpol_1016.3 s1016 complement(6319..6612) [294 bp, 97 aa] {ON} co...   153   2e-49
NDAI0B05700 Chr2 (1388730..1389044) [315 bp, 104 aa] {ON} Anc_5....   151   1e-48
ACL169W Chr3 (61958..62269) [312 bp, 103 aa] {ON} NOHBY311; No h...   138   3e-43
Ecym_4509 Chr4 (1018498..1018809) [312 bp, 103 aa] {ON} similar ...   137   3e-43
KLTH0F15972g Chr6 complement(1297711..1298022) [312 bp, 103 aa] ...   137   4e-43
Kpol_1016.3a s1016 complement(7088..7381) [294 bp, 97 aa] {ON} c...   131   1e-40
KLLA0E02267g Chr5 (212406..212717) [312 bp, 103 aa] {ON} conserv...   130   3e-40
TPHA0C00950 Chr3 (203282..203581) [300 bp, 99 aa] {ON}                105   2e-30
TBLA0C05870 Chr3 complement(1422912..1423214) [303 bp, 100 aa] {...    80   1e-20
KAFR0D02490 Chr4 complement(498165..498488) [324 bp, 107 aa] {ON}      79   5e-20
KAFR0D02500 Chr4 complement(498712..499050) [339 bp, 112 aa] {ON}      72   6e-17
KAFR0D02400 Chr4 (483506..483850) [345 bp, 114 aa] {ON}                70   3e-16
Kwal_14.1851 s14 complement(494548..496155) [1608 bp, 535 aa] {O...    31   0.53 
Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON...    29   2.0  
CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa] ...    29   2.0  
KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {...    29   2.0  
TPHA0C00760 Chr3 complement(147219..149531) [2313 bp, 770 aa] {O...    29   2.2  
NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {...    29   2.3  
KNAG0J00120 Chr10 complement(4248..6272) [2025 bp, 674 aa] {ON} ...    29   2.5  
KNAG0H00110 Chr8 complement(10805..12874) [2070 bp, 689 aa] {ON}...    29   2.5  
Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL00...    28   3.0  
YOR162C Chr15 complement(639560..641992) [2433 bp, 810 aa] {ON} ...    28   3.3  
YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON} ...    28   3.4  
Kwal_26.9111 s26 (1080235..1081170) [936 bp, 311 aa] {ON} YOR288...    28   4.7  
Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON} (178...    28   5.6  
Skud_9.179 Chr9 complement(328238..331216) [2979 bp, 992 aa] {ON...    28   5.9  
SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highl...    27   8.6  

>KNAG0C04880 Chr3 complement(944928..945242) [315 bp, 104 aa] {ON}
           Anc_5.438
          Length = 104

 Score =  219 bits (558), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 104/104 (100%), Positives = 104/104 (100%)

Query: 1   MVEWCAVVYDKPGSDRSQFRPEHLANIPKLVQQGKLVCAGAIYNEPTTPGGDRTFAGSHL 60
           MVEWCAVVYDKPGSDRSQFRPEHLANIPKLVQQGKLVCAGAIYNEPTTPGGDRTFAGSHL
Sbjct: 1   MVEWCAVVYDKPGSDRSQFRPEHLANIPKLVQQGKLVCAGAIYNEPTTPGGDRTFAGSHL 60

Query: 61  QIVADTKEEALEVIHGDVFAKEGIWDLSNIILYQFGCAVREPKK 104
           QIVADTKEEALEVIHGDVFAKEGIWDLSNIILYQFGCAVREPKK
Sbjct: 61  QIVADTKEEALEVIHGDVFAKEGIWDLSNIILYQFGCAVREPKK 104

>CAGL0A02882g Chr1 (302262..302576) [315 bp, 104 aa] {ON} highly
           similar to KLLA0E02266g Kluyveromyces lactis
          Length = 104

 Score =  181 bits (460), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 83/103 (80%), Positives = 91/103 (88%)

Query: 1   MVEWCAVVYDKPGSDRSQFRPEHLANIPKLVQQGKLVCAGAIYNEPTTPGGDRTFAGSHL 60
           MVEWC +VYDKPGSDRS  RP+HLA IP LV+ GKLVCAGAIYNEP   GG+RTFAGSHL
Sbjct: 1   MVEWCVIVYDKPGSDRSTCRPQHLAGIPPLVEAGKLVCAGAIYNEPAQAGGERTFAGSHL 60

Query: 61  QIVADTKEEALEVIHGDVFAKEGIWDLSNIILYQFGCAVREPK 103
           QIVADTKEEALE++H DVFAK GIWDL NII+YQFGCAVR+PK
Sbjct: 61  QIVADTKEEALELVHNDVFAKNGIWDLENIIIYQFGCAVRQPK 103

>TDEL0D02630 Chr4 complement(502356..502664) [309 bp, 102 aa] {ON}
           Anc_5.438
          Length = 102

 Score =  178 bits (451), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 84/104 (80%), Positives = 92/104 (88%), Gaps = 2/104 (1%)

Query: 1   MVEWCAVVYDKPGSDRSQFRPEHLANIPKLVQQGKLVCAGAIYNEPTTPGGDRTFAGSHL 60
           MVEW  +VYDK   DRS FRP HLA IP LV+QGKLVCAGAIYNEPTTPGG+RTFAGSHL
Sbjct: 1   MVEWVVIVYDK--GDRSAFRPAHLAGIPPLVEQGKLVCAGAIYNEPTTPGGERTFAGSHL 58

Query: 61  QIVADTKEEALEVIHGDVFAKEGIWDLSNIILYQFGCAVREPKK 104
           QIVADTKEEALEV+ GD+FAKEG+WDL NII+YQFGCAVR+ KK
Sbjct: 59  QIVADTKEEALEVVKGDIFAKEGVWDLDNIIIYQFGCAVRKEKK 102

>NCAS0F03410 Chr6 (687900..688220) [321 bp, 106 aa] {ON} Anc_5.438
          Length = 106

 Score =  175 bits (443), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 79/103 (76%), Positives = 89/103 (86%)

Query: 1   MVEWCAVVYDKPGSDRSQFRPEHLANIPKLVQQGKLVCAGAIYNEPTTPGGDRTFAGSHL 60
           MVEWC +VYDKPGSDRS FRP+HLA IP LV+QGKLVCAGAIYNEP + G   TFAGSHL
Sbjct: 1   MVEWCVIVYDKPGSDRSAFRPQHLAAIPALVEQGKLVCAGAIYNEPKSEGEAPTFAGSHL 60

Query: 61  QIVADTKEEALEVIHGDVFAKEGIWDLSNIILYQFGCAVREPK 103
           QI+ADTKEEAL ++  D+FAKEGIWD  NII+Y+FGCAVREPK
Sbjct: 61  QIIADTKEEALAIVMNDIFAKEGIWDTDNIIIYRFGCAVREPK 103

>Kwal_55.21414 s55 complement(825799..826158) [360 bp, 119 aa] {ON}
           [contig 130] FULL
          Length = 119

 Score =  166 bits (419), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 77/103 (74%), Positives = 86/103 (83%)

Query: 1   MVEWCAVVYDKPGSDRSQFRPEHLANIPKLVQQGKLVCAGAIYNEPTTPGGDRTFAGSHL 60
           MVEWC +VYDK GSDRS FRP HL  IPKLV++GKLVCAGAIY + +  G    FAGSHL
Sbjct: 16  MVEWCVIVYDKKGSDRSLFRPAHLQGIPKLVEEGKLVCAGAIYQDVSPEGKLSNFAGSHL 75

Query: 61  QIVADTKEEALEVIHGDVFAKEGIWDLSNIILYQFGCAVREPK 103
           QIVADTKEEALE++ GDVFAKEGIWDL NII+Y FGCAVR+PK
Sbjct: 76  QIVADTKEEALEIVKGDVFAKEGIWDLENIIIYPFGCAVRQPK 118

>SAKL0G02618g Chr7 (217435..217749) [315 bp, 104 aa] {ON} conserved
           hypothetical protein
          Length = 104

 Score =  155 bits (392), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 83/104 (79%)

Query: 1   MVEWCAVVYDKPGSDRSQFRPEHLANIPKLVQQGKLVCAGAIYNEPTTPGGDRTFAGSHL 60
           MVEWC VVYDKP +DRSQFRP HLA IP LV+QGKLVCAGAI+NE    G    FAGS L
Sbjct: 1   MVEWCVVVYDKPNADRSQFRPAHLAGIPPLVEQGKLVCAGAIFNEIPQEGKPLNFAGSQL 60

Query: 61  QIVADTKEEALEVIHGDVFAKEGIWDLSNIILYQFGCAVREPKK 104
            IVAD+KEEAL V+  DVFAKEGIWDL NI+++ FGCAVR+ KK
Sbjct: 61  TIVADSKEEALGVVKNDVFAKEGIWDLENILIFPFGCAVRKEKK 104

>ZYRO0F10120g Chr6 (820318..820635) [318 bp, 105 aa] {ON} conserved
           hypothetical protein
          Length = 105

 Score =  155 bits (392), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 69/102 (67%), Positives = 84/102 (82%), Gaps = 2/102 (1%)

Query: 1   MVEWCAVVYDKPGSDRSQFRPEHLANIPKLVQQGKLVCAGAIYNEPTTPGGDRTFAGSHL 60
           MVEW  + +DK  +DRS +R EHLA IP  V+ GKLVCAGAIYNEP  PG  RTFAGSHL
Sbjct: 1   MVEWVVIAFDK--ADRSAYRSEHLAGIPPQVESGKLVCAGAIYNEPKAPGEPRTFAGSHL 58

Query: 61  QIVADTKEEALEVIHGDVFAKEGIWDLSNIILYQFGCAVREP 102
           Q+VADTKEEA+E++  D+FAKEG+WDL N+I+YQFGCA+R+P
Sbjct: 59  QVVADTKEEAIEIVKSDIFAKEGVWDLDNLIVYQFGCAIRQP 100

>Kpol_1016.3 s1016 complement(6319..6612) [294 bp, 97 aa] {ON}
           complement(6319..6612) [294 nt, 98 aa]
          Length = 97

 Score =  153 bits (386), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 72/103 (69%), Positives = 85/103 (82%), Gaps = 6/103 (5%)

Query: 1   MVEWCAVVYDKPGSDRSQFRPEHLANIPKLVQQGKLVCAGAIYNEPTTPGGDRTFAGSHL 60
           MVEWC ++ DK GSDRS+ RP+HLA IP LV+QGKL CAGAIYN+      D +FAGSHL
Sbjct: 1   MVEWCVIINDKKGSDRSELRPQHLAGIPPLVEQGKLKCAGAIYND------DGSFAGSHL 54

Query: 61  QIVADTKEEALEVIHGDVFAKEGIWDLSNIILYQFGCAVREPK 103
           QIVADTKE+ALEV+ GDVFA  GIWDL +II+Y+FGCAVR+PK
Sbjct: 55  QIVADTKEQALEVVKGDVFATGGIWDLDSIIIYKFGCAVRQPK 97

>NDAI0B05700 Chr2 (1388730..1389044) [315 bp, 104 aa] {ON} Anc_5.438
          Length = 104

 Score =  151 bits (381), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 82/104 (78%)

Query: 1   MVEWCAVVYDKPGSDRSQFRPEHLANIPKLVQQGKLVCAGAIYNEPTTPGGDRTFAGSHL 60
           MVEWC ++ DK GSDRS F  +H A IP LV+QGK+VC GAIYNEPT  GG+ T AGSHL
Sbjct: 1   MVEWCVIINDKKGSDRSAFNSQHFAGIPALVEQGKVVCGGAIYNEPTEEGGNPTVAGSHL 60

Query: 61  QIVADTKEEALEVIHGDVFAKEGIWDLSNIILYQFGCAVREPKK 104
           Q+VADTKEE +E++  D+FAKEGIWD+ N I+Y+F  A+R PKK
Sbjct: 61  QVVADTKEEVMELVKKDIFAKEGIWDVDNAIIYRFDAALRLPKK 104

>ACL169W Chr3 (61958..62269) [312 bp, 103 aa] {ON} NOHBY311; No
           homolog in Saccharomyces cerevisiae
          Length = 103

 Score =  138 bits (347), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 79/104 (75%), Gaps = 1/104 (0%)

Query: 1   MVEWCAVVYDKPGSDRSQFRPEHLANIPKLVQQGKLVCAGAIYNEPTTPGGDRTFAGSHL 60
           MVEWCA++YDKPG DRS  R EHLA IPKLV+QGKLV AGAIY E    G    FAGS L
Sbjct: 1   MVEWCAIIYDKPGVDRSVHRQEHLAEIPKLVEQGKLVQAGAIYKE-VVDGRPSQFAGSQL 59

Query: 61  QIVADTKEEALEVIHGDVFAKEGIWDLSNIILYQFGCAVREPKK 104
            +VAD++EEAL +I  D FAK G+WD+ N++LY FGCAVR+ K+
Sbjct: 60  TLVADSREEALAIIRDDPFAKHGVWDVENVVLYPFGCAVRKEKQ 103

>Ecym_4509 Chr4 (1018498..1018809) [312 bp, 103 aa] {ON} similar to
           Ashbya gossypii ACL169W
          Length = 103

 Score =  137 bits (346), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 83/106 (78%), Gaps = 5/106 (4%)

Query: 1   MVEWCAVVYDKPGSDRSQFRPEHLANIPKLVQQGKLVCAGAIYNEPT--TPGGDRTFAGS 58
           MVEWC  VYDKPGSDRS +R  HL  IP+LVQ+GK+V AGAIY +     PGG   FAGS
Sbjct: 1   MVEWCVTVYDKPGSDRSPYRSMHLERIPELVQEGKIVVAGAIYKDLVDGKPGG---FAGS 57

Query: 59  HLQIVADTKEEALEVIHGDVFAKEGIWDLSNIILYQFGCAVREPKK 104
           HL +VADT+EE +E++ GD++AKEG+WD+ NI+++ FGCAVR+ K+
Sbjct: 58  HLILVADTREEVVELLKGDIYAKEGVWDMDNILIFPFGCAVRKEKQ 103

>KLTH0F15972g Chr6 complement(1297711..1298022) [312 bp, 103 aa]
           {ON} conserved hypothetical protein
          Length = 103

 Score =  137 bits (346), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 78/103 (75%)

Query: 1   MVEWCAVVYDKPGSDRSQFRPEHLANIPKLVQQGKLVCAGAIYNEPTTPGGDRTFAGSHL 60
           MVEWC +V+DK GSDRS  RP HL  + +  ++G LVCAGAIY+E    G    FAGSHL
Sbjct: 1   MVEWCVIVFDKKGSDRSACRPAHLEGVAQQYEKGTLVCAGAIYHEVGPDGKPTNFAGSHL 60

Query: 61  QIVADTKEEALEVIHGDVFAKEGIWDLSNIILYQFGCAVREPK 103
           QI A+TKE+AL+V+  D+FAKEGIWDL NII+Y FGCAVR+ K
Sbjct: 61  QISANTKEDALQVVKNDIFAKEGIWDLENIIIYPFGCAVRQGK 103

>Kpol_1016.3a s1016 complement(7088..7381) [294 bp, 97 aa] {ON}
           complement(7088..7381) [294 nt, 98 aa]
          Length = 97

 Score =  131 bits (329), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 76/103 (73%), Gaps = 6/103 (5%)

Query: 1   MVEWCAVVYDKPGSDRSQFRPEHLANIPKLVQQGKLVCAGAIYNEPTTPGGDRTFAGSHL 60
           M EWC ++ DK GS+RS+   +H A I  LV+QG L C GAIYN+      D + AGSHL
Sbjct: 1   MSEWCIIINDKKGSNRSELLSQHFAGISPLVEQGILTCGGAIYND------DGSVAGSHL 54

Query: 61  QIVADTKEEALEVIHGDVFAKEGIWDLSNIILYQFGCAVREPK 103
           QIVADTKE+ALEV+ GDVFA  GIWDL +I++Y+F CAVR+PK
Sbjct: 55  QIVADTKEQALEVVKGDVFATGGIWDLDSIVIYKFACAVRQPK 97

>KLLA0E02267g Chr5 (212406..212717) [312 bp, 103 aa] {ON} conserved
           hypothetical protein
          Length = 103

 Score =  130 bits (326), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 62/104 (59%), Positives = 77/104 (74%), Gaps = 1/104 (0%)

Query: 1   MVEWCAVVYDKPGSDRSQFRPEHLANIPKLVQQGKLVCAGAIYNEPTTPGGDRTFAGSHL 60
           MVEW  +VYDKPGSDRS  RP+HLA IP LV+ GK+V AGAIY +    G    FAGSHL
Sbjct: 1   MVEWVVIVYDKPGSDRSACRPQHLAGIPPLVEAGKIVHAGAIYKD-VVDGKPANFAGSHL 59

Query: 61  QIVADTKEEALEVIHGDVFAKEGIWDLSNIILYQFGCAVREPKK 104
            IVAD+K+E +E++  DVFAK  IWD+ N ++Y FGCAVR+ K+
Sbjct: 60  TIVADSKDEVVELLKNDVFAKNDIWDVDNALIYPFGCAVRKEKQ 103

>TPHA0C00950 Chr3 (203282..203581) [300 bp, 99 aa] {ON} 
          Length = 99

 Score =  105 bits (262), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 70/104 (67%), Gaps = 8/104 (7%)

Query: 1   MVEWCAVVYDKPGSD--RSQFRPEHLANIPKLVQQGKLVCAGAIYNEPTTPGGDRTFAGS 58
           M E+  V+ D  G++  R Q  PEH  NIP LV  G +VC GA++NE  +P       GS
Sbjct: 1   MSEYVVVIKDHAGAEKLREQHGPEHFGNIPPLVDAGIVVCGGAMFNEEGSP------VGS 54

Query: 59  HLQIVADTKEEALEVIHGDVFAKEGIWDLSNIILYQFGCAVREP 102
           H+QIVAD++E+ LE++  DVFA+E +WDL + I+Y+F CAVR+P
Sbjct: 55  HIQIVADSREQVLEMLKKDVFARENVWDLESAIIYKFDCAVRKP 98

>TBLA0C05870 Chr3 complement(1422912..1423214) [303 bp, 100 aa] {ON}
           
          Length = 100

 Score = 80.5 bits (197), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 60/104 (57%), Gaps = 6/104 (5%)

Query: 1   MVEWCAVVYDKPGSDRSQFRPEHLANIPKLVQQGKLVCAGAIYNEPTTPGGDRTFAGSHL 60
           M EW   + D P SDR+    EH+  +P L+  G L C GA+ ++      +    GSH 
Sbjct: 1   MTEWYVTIKDIPNSDRTPVLKEHMDRLPILINAGVLSCGGALLDD------NGNMIGSHF 54

Query: 61  QIVADTKEEALEVIHGDVFAKEGIWDLSNIILYQFGCAVREPKK 104
           ++  +TKEEA+++I+ D F K G+WD+++I + +F C  RE  K
Sbjct: 55  ELKVETKEEAMKLINEDPFVKGGVWDMNSIQIRKFYCVHREEYK 98

>KAFR0D02490 Chr4 complement(498165..498488) [324 bp, 107 aa] {ON}
          
          Length = 107

 Score = 79.3 bits (194), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 59/95 (62%), Gaps = 6/95 (6%)

Query: 1  MVEWCAVVYDKPGSDRSQFRPEHLANIPKLVQQGKLVCAGAIYNEPTTPGGDRTFAGSHL 60
          M EW   V DKP +DR+ +   HLA +P L ++  LV AGA+       G +    GS  
Sbjct: 1  MPEWIVNVQDKPEADRAPYNDRHLAALPGLFEKKVLVSAGALI------GDNGKEVGSSF 54

Query: 61 QIVADTKEEALEVIHGDVFAKEGIWDLSNIILYQF 95
          Q+VA++KE+A+ VI  D+FAKEG+++L + + Y+F
Sbjct: 55 QVVAESKEDAINVIKNDIFAKEGVYNLDSFVCYRF 89

>KAFR0D02500 Chr4 complement(498712..499050) [339 bp, 112 aa] {ON}
          
          Length = 112

 Score = 71.6 bits (174), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 54/90 (60%), Gaps = 6/90 (6%)

Query: 1  MVEWCAVVYDKPGSDRSQFRPEHLANIPKLVQQGKLVCAGAIYNEPTTPGGDRTFAGSHL 60
          M EW   + D  G+DR+ + PEH+ N+  L  +  LV AGA+    TTP G  T  G  L
Sbjct: 1  MPEWLVKIEDIEGADRTPYYPEHMQNLKNLFDEKILVGAGAL----TTPEGKET--GGIL 54

Query: 61 QIVADTKEEALEVIHGDVFAKEGIWDLSNI 90
           I A TKEEA+EV+  DVFA++GI+ +  I
Sbjct: 55 IIAAKTKEEAIEVVKRDVFARKGIFKMDTI 84

>KAFR0D02400 Chr4 (483506..483850) [345 bp, 114 aa] {ON} 
          Length = 114

 Score = 69.7 bits (169), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 54/90 (60%), Gaps = 6/90 (6%)

Query: 1  MVEWCAVVYDKPGSDRSQFRPEHLANIPKLVQQGKLVCAGAIYNEPTTPGGDRTFAGSHL 60
          M EW   V D    DR+ + PEH+ ++P LV  G +V AGA+    TTP G     G   
Sbjct: 1  MPEWLVKVKDNKDVDRAPYYPEHMRDLPSLVDGGIIVVAGAL----TTPEGKEI--GGMF 54

Query: 61 QIVADTKEEALEVIHGDVFAKEGIWDLSNI 90
           + A TKEEA+E++  DVFA++GI+++ ++
Sbjct: 55 IVTAKTKEEAIEIVKRDVFARKGIFNMDSV 84

>Kwal_14.1851 s14 complement(494548..496155) [1608 bp, 535 aa] {ON}
           YBR212W (NGR1) - negative growth regulatory protein
           [contig 235] FULL
          Length = 535

 Score = 30.8 bits (68), Expect = 0.53,   Method: Composition-based stats.
 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 1/43 (2%)

Query: 20  RPEHLANIPKLVQQGKLVCAGAIYNEPTTPGGDRT-FAGSHLQ 61
           R   + ++P  +    L  A  ++N+P  PG   + FA SHLQ
Sbjct: 474 RHSAMQDMPSCLPAANLNRAATVWNQPAAPGSTNSMFASSHLQ 516

>Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON}
           YDL145C (REAL)
          Length = 1201

 Score = 29.3 bits (64), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 30/74 (40%), Gaps = 4/74 (5%)

Query: 31  VQQGKLVCAGAIYNEP----TTPGGDRTFAGSHLQIVADTKEEALEVIHGDVFAKEGIWD 86
           VQQGK +   A+ N      +  G        H   +A  K E +  +H  +  K   WD
Sbjct: 481 VQQGKKIAQLAVKNVKYVSWSLDGQYVALMSKHTITLATKKLELINSMHETIRIKSAAWD 540

Query: 87  LSNIILYQFGCAVR 100
            S +++Y     +R
Sbjct: 541 ESGVLIYSTLNHIR 554

>CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa]
           {ON} highly similar to uniprot|P53622 Saccharomyces
           cerevisiae YDL145c RET1 Coatomer alpha subunit
          Length = 1201

 Score = 29.3 bits (64), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 30/74 (40%), Gaps = 4/74 (5%)

Query: 31  VQQGKLVCAGAIYNEP----TTPGGDRTFAGSHLQIVADTKEEALEVIHGDVFAKEGIWD 86
           VQQGK V    + N      +  G        H   + + + E +  +H  +  K   WD
Sbjct: 481 VQQGKKVAQMHVKNVKYVSWSQDGQYLAMMSKHTITIVNKRLELINSMHETIRIKSAAWD 540

Query: 87  LSNIILYQFGCAVR 100
            SN+++Y     +R
Sbjct: 541 ESNVLVYTTLNHIR 554

>KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1204

 Score = 29.3 bits (64), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 29/74 (39%), Gaps = 4/74 (5%)

Query: 31  VQQGK----LVCAGAIYNEPTTPGGDRTFAGSHLQIVADTKEEALEVIHGDVFAKEGIWD 86
           VQQGK    +      Y   +  G        H   +A  + E +  +H  +  K   WD
Sbjct: 480 VQQGKKLGSISAKNVKYVSWSNDGQYVALMSKHTITIATRRLEMVNSMHETIRIKSAAWD 539

Query: 87  LSNIILYQFGCAVR 100
            SN+++Y     +R
Sbjct: 540 ESNVLIYSTLNHIR 553

>TPHA0C00760 Chr3 complement(147219..149531) [2313 bp, 770 aa] {ON}
           Anc_8.332
          Length = 770

 Score = 28.9 bits (63), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 6/50 (12%)

Query: 7   VVYDKPGSDRSQFR------PEHLANIPKLVQQGKLVCAGAIYNEPTTPG 50
           ++Y  PG D  Q +      PE  A  P  VQ+G +     +  +PTTPG
Sbjct: 238 LIYSDPGDDFYQEKDGYKAYPEGPARNPSSVQRGSVQFLSQMPGDPTTPG 287

>NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1200

 Score = 28.9 bits (63), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/67 (22%), Positives = 26/67 (38%)

Query: 34  GKLVCAGAIYNEPTTPGGDRTFAGSHLQIVADTKEEALEVIHGDVFAKEGIWDLSNIILY 93
           GK+      Y   +  G        H   +A+ K E +  +H  +  K   WD S +++Y
Sbjct: 488 GKIAAKNVKYVSWSLDGQHVALMSKHTITIANKKLELVNSMHETIRIKSAAWDESGVLIY 547

Query: 94  QFGCAVR 100
                +R
Sbjct: 548 STLNHIR 554

>KNAG0J00120 Chr10 complement(4248..6272) [2025 bp, 674 aa] {ON}
          possible pseudogene; NNN added to avoid internal stop
          codon
          Length = 674

 Score = 28.9 bits (63), Expect = 2.5,   Method: Composition-based stats.
 Identities = 20/72 (27%), Positives = 32/72 (44%), Gaps = 6/72 (8%)

Query: 27 IPKLVQQGKLVCAGAIYNEPTTPGGDRTFAGSHLQIVADTKEEALEVIHGDVFAKEGIWD 86
          +P ++ Q   V  G I  + TT  GDR F+G+    V   K   L +  G    K+ +  
Sbjct: 16 LPTVLAQA--VSNGMIVTDNTTLSGDRVFSGT----VTIEKGATLTLTDGRFMFKKDLNV 69

Query: 87 LSNIILYQFGCA 98
            N+++Y   C 
Sbjct: 70 YGNLVVYSNNCG 81

>KNAG0H00110 Chr8 complement(10805..12874) [2070 bp, 689 aa] {ON} 
          possible pseudogene; NNN added to avoid internal stop
          codon
          Length = 689

 Score = 28.9 bits (63), Expect = 2.5,   Method: Composition-based stats.
 Identities = 20/72 (27%), Positives = 32/72 (44%), Gaps = 6/72 (8%)

Query: 27 IPKLVQQGKLVCAGAIYNEPTTPGGDRTFAGSHLQIVADTKEEALEVIHGDVFAKEGIWD 86
          +P ++ Q   V  G I  + TT  GDR F+G+    V   K   L +  G    K+ +  
Sbjct: 16 LPTVLAQA--VSNGMIVTDNTTLSGDRVFSGT----VTIEKGATLTLTDGRFMFKKDLNV 69

Query: 87 LSNIILYQFGCA 98
            N+++Y   C 
Sbjct: 70 YGNLVVYSNNCG 81

>Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL004W
           (REAL)
          Length = 1561

 Score = 28.5 bits (62), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 17/31 (54%)

Query: 15  DRSQFRPEHLANIPKLVQQGKLVCAGAIYNE 45
           D+   +P HL  +P +VQQG  +    I NE
Sbjct: 586 DQQHMQPPHLMPLPSMVQQGPNMVHQGIVNE 616

>YOR162C Chr15 complement(639560..641992) [2433 bp, 810 aa] {ON}
           YRR1Zn2-Cys6 zinc-finger transcription factor that
           activates genes involved in multidrug resistance;
           paralog of Yrm1p, acting on an overlapping set of target
           genes
          Length = 810

 Score = 28.5 bits (62), Expect = 3.3,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 22/49 (44%), Gaps = 2/49 (4%)

Query: 54  TFAGSHLQIVADTKEEALEVIHGDVFAKEGIWDLSNIILYQFGCAVREP 102
           T  G HL I    KE   EV  G + + E +W ++  I Y   C V  P
Sbjct: 391 TTIGLHLNIRETFKEH--EVFMGSIESLENVWLMAIFIDYNISCNVGRP 437

>YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON}
           COP1Alpha subunit of COPI vesicle coatomer complex,
           which surrounds transport vesicles in the early
           secretory pathway
          Length = 1201

 Score = 28.5 bits (62), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 30/74 (40%), Gaps = 4/74 (5%)

Query: 31  VQQGKLVCAGAIYNEP----TTPGGDRTFAGSHLQIVADTKEEALEVIHGDVFAKEGIWD 86
           VQQGK V   A+ N      +  G        H   +A  K E +  +H  +  K   WD
Sbjct: 481 VQQGKKVSQLAVKNVKYVSWSLDGQYVALMSKHTITLATKKLELINSMHETIRIKSAAWD 540

Query: 87  LSNIILYQFGCAVR 100
            + +++Y     +R
Sbjct: 541 ETGVLIYSTLNHIR 554

>Kwal_26.9111 s26 (1080235..1081170) [936 bp, 311 aa] {ON} YOR288C
           (MPD1) - Disulfide isomerase related protein [contig 70]
           FULL
          Length = 311

 Score = 27.7 bits (60), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 20/47 (42%), Gaps = 4/47 (8%)

Query: 56  AGSHLQIVADTKEEALEVIHGDVFAKEGIWDLSNIILYQFGCAVREP 102
           +   + +V D KE    V  GD F K  +W L    L +FG     P
Sbjct: 238 SNESILVVFDLKEHEYHVYEGDSFEKAAVWRL----LSKFGTPTEGP 280

>Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON}
           (178299..181919) [3621 nt, 1207 aa]
          Length = 1206

 Score = 27.7 bits (60), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 16/67 (23%), Positives = 28/67 (41%), Gaps = 4/67 (5%)

Query: 31  VQQGKLVCAGAIYNEP----TTPGGDRTFAGSHLQIVADTKEEALEVIHGDVFAKEGIWD 86
           VQQGK +   ++ N      +  G        H   + + + E +   H  +  K   WD
Sbjct: 485 VQQGKQLAEMSLKNVKYVSWSQDGQYVALISKHTITITNKRLELVSTRHETIRVKSAAWD 544

Query: 87  LSNIILY 93
            SN+++Y
Sbjct: 545 ESNVLIY 551

>Skud_9.179 Chr9 complement(328238..331216) [2979 bp, 992 aa] {ON}
           YIR002C (REAL)
          Length = 992

 Score = 27.7 bits (60), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 4/53 (7%)

Query: 22  EHLANIPKLVQQGKLVCAGAIYNEPTTPGGDRTFAGSHLQIVADTKEEALEVI 74
           EH  N PK V  GKL C      +     G    + S + I  + +E ALE++
Sbjct: 417 EHYLNDPKFVGHGKLQCVKDELMDFFQKSG----SNSRVIIFTELRESALEIV 465

>SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highly
           similar to uniprot|P53622 Saccharomyces cerevisiae
           YDL145C COP1 Alpha subunit of COPI vesicle coatomer
           complex which surrounds transport vesicles in the early
           secretory pathway
          Length = 1203

 Score = 27.3 bits (59), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 29/67 (43%), Gaps = 4/67 (5%)

Query: 31  VQQGKLVCAGAIYNEPT---TPGGDR-TFAGSHLQIVADTKEEALEVIHGDVFAKEGIWD 86
           VQQGK +   A+ N      +P G        H   + + K E +  +H  +  K   WD
Sbjct: 480 VQQGKKIDEIAVNNVKYVSWSPDGQYLALLSKHTVTIVNKKLEMITSMHETIRIKSAAWD 539

Query: 87  LSNIILY 93
            + I++Y
Sbjct: 540 ETGILIY 546

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.138    0.430 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 11,327,457
Number of extensions: 408982
Number of successful extensions: 754
Number of sequences better than 10.0: 35
Number of HSP's gapped: 742
Number of HSP's successfully gapped: 35
Length of query: 104
Length of database: 53,481,399
Length adjustment: 74
Effective length of query: 30
Effective length of database: 44,996,115
Effective search space: 1349883450
Effective search space used: 1349883450
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)