Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0C048705.441ON45845824950.0
TBLA0A027905.441ON54752111661e-155
ZYRO0F10186g5.441ON51949611581e-154
TDEL0D026005.441ON52351011561e-154
SAKL0G02684g5.441ON53945811141e-148
KAFR0E038105.441ON49043310961e-146
CAGL0A02904g5.441ON50149310831e-143
NDAI0B057105.441ON56355610891e-143
Kpol_1062.255.441ON53351410771e-142
KLLA0E02333g5.441ON48047210661e-141
TPHA0E017205.441ON53747010641e-140
NCAS0F034205.441ON52552110571e-139
Smik_4.6375.441ON5114489961e-130
Suva_2.5435.441ON5114589951e-130
YDR371W (CTS2)5.441ON5114589941e-130
ACL166W5.441ON4904859801e-128
Ecym_45125.441ON5274899711e-126
Skud_4.6405.441ON5114489501e-123
KLTH0F15906g5.441ON5154489331e-121
Kwal_55.214025.441ON5164468561e-109
KLLA0F00374g7.9ON795147751.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0C04870
         (458 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0C04870 Chr3 complement(943386..944762) [1377 bp, 458 aa] {O...   965   0.0  
TBLA0A02790 Chr1 complement(672252..673895) [1644 bp, 547 aa] {O...   453   e-155
ZYRO0F10186g Chr6 (823029..824588) [1560 bp, 519 aa] {ON} simila...   450   e-154
TDEL0D02600 Chr4 complement(498470..500041) [1572 bp, 523 aa] {O...   449   e-154
SAKL0G02684g Chr7 (220460..222079) [1620 bp, 539 aa] {ON} simila...   433   e-148
KAFR0E03810 Chr5 complement(756701..758173) [1473 bp, 490 aa] {O...   426   e-146
CAGL0A02904g Chr1 (302938..304443) [1506 bp, 501 aa] {ON} simila...   421   e-143
NDAI0B05710 Chr2 (1389267..1390958) [1692 bp, 563 aa] {ON} Anc_5...   424   e-143
Kpol_1062.25 s1062 complement(56775..58376) [1602 bp, 533 aa] {O...   419   e-142
KLLA0E02333g Chr5 (215594..217036) [1443 bp, 480 aa] {ON} simila...   415   e-141
TPHA0E01720 Chr5 complement(348101..349714) [1614 bp, 537 aa] {O...   414   e-140
NCAS0F03420 Chr6 (689091..690668) [1578 bp, 525 aa] {ON} Anc_5.4...   411   e-139
Smik_4.637 Chr4 (1139498..1141033) [1536 bp, 511 aa] {ON} YDR371...   388   e-130
Suva_2.543 Chr2 (970024..971559) [1536 bp, 511 aa] {ON} YDR371W ...   387   e-130
YDR371W Chr4 (1219413..1220948) [1536 bp, 511 aa] {ON}  CTS2Puta...   387   e-130
ACL166W Chr3 (64828..66300) [1473 bp, 490 aa] {ON} Syntenic homo...   382   e-128
Ecym_4512 Chr4 (1022092..1023675) [1584 bp, 527 aa] {ON} similar...   378   e-126
Skud_4.640 Chr4 (1142282..1143817) [1536 bp, 511 aa] {ON} YDR371...   370   e-123
KLTH0F15906g Chr6 complement(1293832..1295379) [1548 bp, 515 aa]...   363   e-121
Kwal_55.21402 s55 complement(821930..823480) [1551 bp, 516 aa] {...   334   e-109
KLLA0F00374g Chr6 complement(20124..22511) [2388 bp, 795 aa] {ON...    33   1.1  

>KNAG0C04870 Chr3 complement(943386..944762) [1377 bp, 458 aa] {ON}
           Anc_5.441 YDR371W
          Length = 458

 Score =  965 bits (2495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/458 (100%), Positives = 458/458 (100%)

Query: 1   MKRRQKITIAAVSLVSVTVILTMCFTQLLHKKTEHHHQPPAQCPQNVNQKYVSGVYYSDW 60
           MKRRQKITIAAVSLVSVTVILTMCFTQLLHKKTEHHHQPPAQCPQNVNQKYVSGVYYSDW
Sbjct: 1   MKRRQKITIAAVSLVSVTVILTMCFTQLLHKKTEHHHQPPAQCPQNVNQKYVSGVYYSDW 60

Query: 61  SPYEPRMHFPKNIDTSKITHIYYSFFLVDADSSALKLGDSWSDIEMPMGKNTVLKGCIGA 120
           SPYEPRMHFPKNIDTSKITHIYYSFFLVDADSSALKLGDSWSDIEMPMGKNTVLKGCIGA
Sbjct: 61  SPYEPRMHFPKNIDTSKITHIYYSFFLVDADSSALKLGDSWSDIEMPMGKNTVLKGCIGA 120

Query: 121 LNSLRDEKPGFKNIMAVGGWSNKDAFPLALRKKHGVEKLAQSCVETMFQYGFDGIDLDWE 180
           LNSLRDEKPGFKNIMAVGGWSNKDAFPLALRKKHGVEKLAQSCVETMFQYGFDGIDLDWE
Sbjct: 121 LNSLRDEKPGFKNIMAVGGWSNKDAFPLALRKKHGVEKLAQSCVETMFQYGFDGIDLDWE 180

Query: 181 YPKDDGKEPRIYLELMRKIRQHMNELEIAIWGDKKRRFHLSVATPAFYDKLETFPIKEMD 240
           YPKDDGKEPRIYLELMRKIRQHMNELEIAIWGDKKRRFHLSVATPAFYDKLETFPIKEMD
Sbjct: 181 YPKDDGKEPRIYLELMRKIRQHMNELEIAIWGDKKRRFHLSVATPAFYDKLETFPIKEMD 240

Query: 241 QYIDYWNMMTYDYYGEWSSGTGFHSNLYDGTNKFSEHSLCADGAIRYMTNKIGINSRKVV 300
           QYIDYWNMMTYDYYGEWSSGTGFHSNLYDGTNKFSEHSLCADGAIRYMTNKIGINSRKVV
Sbjct: 241 QYIDYWNMMTYDYYGEWSSGTGFHSNLYDGTNKFSEHSLCADGAIRYMTNKIGINSRKVV 300

Query: 301 LGMALYGRGFTNVKEGDPKKTSGLINRKFKGVGGESEGEPGMWLYNQLPIRGTQEVFDEQ 360
           LGMALYGRGFTNVKEGDPKKTSGLINRKFKGVGGESEGEPGMWLYNQLPIRGTQEVFDEQ
Sbjct: 301 LGMALYGRGFTNVKEGDPKKTSGLINRKFKGVGGESEGEPGMWLYNQLPIRGTQEVFDEQ 360

Query: 361 YGSAYCFDPKTKTLVGYDNVDSTRQKAQYVRFHNLAGGFWWESCGNKWDNVQQSLVHVFN 420
           YGSAYCFDPKTKTLVGYDNVDSTRQKAQYVRFHNLAGGFWWESCGNKWDNVQQSLVHVFN
Sbjct: 361 YGSAYCFDPKTKTLVGYDNVDSTRQKAQYVRFHNLAGGFWWESCGNKWDNVQQSLVHVFN 420

Query: 421 EDIERLDRNETNLYQDPKLREHYLQIFAKSGFLAATFK 458
           EDIERLDRNETNLYQDPKLREHYLQIFAKSGFLAATFK
Sbjct: 421 EDIERLDRNETNLYQDPKLREHYLQIFAKSGFLAATFK 458

>TBLA0A02790 Chr1 complement(672252..673895) [1644 bp, 547 aa] {ON}
           Anc_5.441 YDR371W
          Length = 547

 Score =  453 bits (1166), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 236/521 (45%), Positives = 324/521 (62%), Gaps = 78/521 (14%)

Query: 12  VSLVSVTVILTMCF-TQLLHKKTE----HHHQPPAQCP------------QNVN------ 48
           ++ +++T+I  MCF  +L +KK E    +  QPP +              +N N      
Sbjct: 15  LTFIAITLITEMCFYDKLFNKKKEQQVLNQLQPPTKIEPLNNVDNEIKDNKNTNLTVANP 74

Query: 49  QKYVSGVYYSDWSPYEPRMHFPKNIDTSKITHIYYSFFLVDADSSALKLGDSWSDIEM-- 106
           Q Y SGVYYS+WSPY PR HFP +ID S+I+H+YYSFFLV+ D+  ++LGD WSDIEM  
Sbjct: 75  QGYTSGVYYSNWSPYSPRKHFPHDIDFSRISHVYYSFFLVNGDNGKVELGDKWSDIEMDL 134

Query: 107 --------------------PMGKNTVL----KGCIGALNSLRDEK----------PGFK 132
                               P  ++T+     KGCIG    LR+ K            FK
Sbjct: 135 YKPLSIKLGKLKNKVDVYEEPQTQSTIKTNLPKGCIGEFFYLRNSKLLPTINTENSKNFK 194

Query: 133 NIMAVGGWSNKDAFPLALRKKHGVEKLAQSCVETMFQYGFDGIDLDWEYPKDDGKEPRIY 192
            IM +GGWSN+D+FP   +    +     S +E MF+YGFDGIDLDWE+PK++ +EP +Y
Sbjct: 195 MIMTIGGWSNRDSFPKMAKSPQKIHNFVTSAIEMMFEYGFDGIDLDWEFPKNNTQEPAVY 254

Query: 193 LELMRKIRQHMNELEIAIWG------DKKRRFHLSVATPAFYDKLETFPIKEMDQYIDYW 246
           L++M+++RQ MNELE  I+       ++++ F LSVA+PAF +KL   PIKEM++ +DYW
Sbjct: 255 LKIMQQLRQGMNELEEEIYKNSAVPVEERKHFQLSVASPAFEEKLSVLPIKEMNKVLDYW 314

Query: 247 NMMTYDYYGEWSSGTGFHSNLYDGTN-KFSEHSLCADGAIRYMTNKIGINSRKVVLGMAL 305
           NMMTYDY GEWS  TG+HSNLYDG+  K  E  L AD AI+YM    G+   K+VLG+A 
Sbjct: 315 NMMTYDYNGEWSEKTGYHSNLYDGSKVKHDEEVLNADSAIKYMIETQGVEPNKLVLGLAG 374

Query: 306 YGRGFTNV---------KEGDPKKTSG---LINRKFKGVGGESEGEPGMWLYNQLPIRGT 353
           YGRG+TNV         K    ++ +G    I+ ++KGVGGESEGEPGMW+YNQLPI+G+
Sbjct: 375 YGRGYTNVNVNHIQGFGKNNKERELTGDEVFIDLEYKGVGGESEGEPGMWMYNQLPIKGS 434

Query: 354 QEVFDEQYGSAYCFDPKTKTLVGYDNVDSTRQKAQYVRFHNLAGGFWWESCGNKWDNVQQ 413
            E FD ++ SAYC+D KT TLV YDNV+S   K QYV+   LAGGF WESCG+  DN ++
Sbjct: 435 IEQFDPKFVSAYCYDLKTNTLVTYDNVESMNVKGQYVKDKGLAGGFMWESCGDVHDNPKR 494

Query: 414 SLVHVFNEDIERLDRNETNLYQDPKLREHYLQIFAKSGFLA 454
           SL+  F  ++ ++ + E++++QD K  E YL+ F   G+L+
Sbjct: 495 SLITAFTNELGKIKKQESSIFQDEKTFEFYLEEFGNEGYLS 535

>ZYRO0F10186g Chr6 (823029..824588) [1560 bp, 519 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 519

 Score =  450 bits (1158), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 232/496 (46%), Positives = 309/496 (62%), Gaps = 55/496 (11%)

Query: 12  VSLVSVTVILTMCFTQLLHKKTEHH------HQPPAQCPQNV--------NQKYVSGVYY 57
           ++ +  ++++ MCF + + K +  H      H+      Q          ++ Y SG+YY
Sbjct: 15  LAFIIASIVIEMCFYRKIFKSSAEHDVLDHVHEVGDGSLQQFKDHHTVIGDEGYTSGLYY 74

Query: 58  SDWSPYEPRMHFPKNIDTSKITHIYYSFFLVDADSSALKLGDSWSDIEMPMGKNTVLK-- 115
           SDWSPY PR HFP +ID SK++HIYY+FFL+D  +  LK  D WSD +M + K   +K  
Sbjct: 75  SDWSPYPPRKHFPHDIDFSKVSHIYYAFFLIDGHTGELKSSDEWSDFQMDLYKPLAVKLN 134

Query: 116 ------------------GCIGALNSLR-------DEKPGFKNIMAVGGWSNKDAFPLAL 150
                             GC+G L  LR       D+   FK +MAVGGWSN+D +P  +
Sbjct: 135 QLQLKNDDVHASMGVLPKGCVGELFYLRHTGILDRDKGRHFKVMMAVGGWSNRDQWPKMV 194

Query: 151 RKKHGVEKLAQSCVETMFQYGFDGIDLDWEYPKDDGKEPRIYLELMRKIRQHMNELEIAI 210
           R    VE    SCVETMF+YGFDGIDLDWE+P++DG EPR+YLEL RK+R   +ELE  I
Sbjct: 195 RDPRRVENFINSCVETMFKYGFDGIDLDWEFPQNDGFEPRMYLELARKMRLKFDELEEVI 254

Query: 211 WGDKKR--RFHLSVATPAFYDKLETFPIKEMDQYIDYWNMMTYDYYGEWSSGTGFHSNLY 268
           +  +    +F LS+ATPAF DKL   PIKE+D+YID WNMMTYDY+GEWS  TG+H NLY
Sbjct: 255 FAGEPNHPKFQLSMATPAFKDKLNVLPIKELDRYIDVWNMMTYDYHGEWSPVTGYHCNLY 314

Query: 269 DGTNKF----------SEHSLCADGAIRYMTNKIGINSRKVVLGMALYGRGFTNVKEGDP 318
           DG  K            +  L A+ AI  M N+ G++SRK+ LGMA YGRGFT+VK    
Sbjct: 315 DGPVKVHSQYKHDSSSDDEGLDANSAISDMINRFGVDSRKITLGMAAYGRGFTHVKASSN 374

Query: 319 KKTSGLINRKFKGVGGESEGEPGMWLYNQLPIRGTQEVFDEQYGSAYCFDPKTKTLVGYD 378
            K    I++ F GVGG SEGEPGMWLYNQLPI+G++E +D +Y S +CFD KTKT VGYD
Sbjct: 375 DKR--FIDKSFHGVGGASEGEPGMWLYNQLPIKGSKEEYDPEYVSGFCFDHKTKTFVGYD 432

Query: 379 NVDSTRQKAQYVRFHNLAGGFWWESCGNKWDNVQQSLVHVFNEDIERLDRNETNLYQDPK 438
           NV+S + KA YV+   L GGFWWESCG+   + Q+SL++ F   I+ + +NE ++Y  P+
Sbjct: 433 NVESVKVKADYVKEMGLRGGFWWESCGDNHIDPQRSLLNAFTGRIKTIAKNENSVYHKPE 492

Query: 439 LREHYLQIFAKSGFLA 454
              +YL+ F +  FL+
Sbjct: 493 ALRYYLEKFGQDEFLS 508

>TDEL0D02600 Chr4 complement(498470..500041) [1572 bp, 523 aa] {ON}
           Anc_5.441 YDR371W
          Length = 523

 Score =  449 bits (1156), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 234/510 (45%), Positives = 318/510 (62%), Gaps = 58/510 (11%)

Query: 1   MKRRQKITIAAVSLVSV-TVILTMCF-TQLLHKKTEH----HHQPPAQCPQNVNQ----- 49
           M+RR  ++   + +V + ++ + MCF  ++ H+  +     + Q   Q  Q V       
Sbjct: 1   MQRRPWLSHTVIIIVILASIAVEMCFYKKIFHRSAQRKVVDYVQSQPQQAQLVTNPGTVE 60

Query: 50  --KYVSGVYYSDWSPYEPRMHFPKNIDTSKITHIYYSFFLVDADSSALKLGDSWSDIEMP 107
             +Y+SG+YYS+WSPY PRMHFP +ID S+++HIYY+FFLVD  + ALKLGD WSD+ M 
Sbjct: 61  PGQYLSGLYYSNWSPYSPRMHFPHDIDLSRVSHIYYAFFLVDGATGALKLGDEWSDVGMD 120

Query: 108 MGKNTVLK---------------------GCIGALNSLRDEK-------PGFKNIMAVGG 139
           + K   +K                     GC+G L  +R+           FK IM VGG
Sbjct: 121 LYKPMAIKLNKLNPEVKNDLERQRRILPNGCLGELFYMRNANLFPNRNIRDFKVIMCVGG 180

Query: 140 WSNKDAFPLALRKKHGVEKLAQSCVETMFQYGFDGIDLDWEYPKDDGKEPRIYLELMRKI 199
           WSN++ FP  +R    V+K   SC+ETMF+YGFDGIDLDWE+P+DDG EP++YL+L +++
Sbjct: 181 WSNREEFPKMVRNPKRVDKFIDSCIETMFKYGFDGIDLDWEFPEDDGFEPQMYLQLAKRL 240

Query: 200 RQHMNELEIAIWGDKKR--RFHLSVATPAFYDKLETFPIKEMDQYIDYWNMMTYDYYGEW 257
           ++ MNELE AI+G      +F LS+ATPAF +KL+  PI EMD+YID WNMMTYDY+GEW
Sbjct: 241 KERMNELEDAIFGPNMNHPKFQLSMATPAFSEKLDILPITEMDKYIDIWNMMTYDYHGEW 300

Query: 258 SSGTGFHSNLYDGTNK-FSE------------HSLCADGAIRYMTNKIGINSRKVVLGMA 304
           S  TG+H NLY+G+ K F E              L A  AI +M N  G+NS K+ LGMA
Sbjct: 301 SEKTGYHCNLYNGSTKSFDETHQKHIYSTESVEGLDAHSAIEHMLNVAGVNSHKICLGMA 360

Query: 305 LYGRGFTNVKEGDPKKTSGLINRKFKGVGGESEGEPGMWLYNQLPIRGTQEVFDEQYGSA 364
            YGRGFTNV      K    I++ F GVGG S+GEPGMWLYNQLPI+GT E+FD  Y S 
Sbjct: 361 AYGRGFTNVVAQSTDKR--FIDKPFHGVGGASDGEPGMWLYNQLPIQGTHELFDPDYVSG 418

Query: 365 YCFDPKTKTLVGYDNVDSTRQKAQYVRFHNLAGGFWWESCGNKWDNVQQSLVHVFNEDIE 424
           +C+   +KT VGYD+V+S R KAQYVR  NLAGGFWWESCG+   N  +SL++ F  +I+
Sbjct: 419 FCYSSTSKTFVGYDSVESVRFKAQYVREKNLAGGFWWESCGDDHANQSRSLLNAFTNEIK 478

Query: 425 RLDRNETNLYQDPKLREHYLQIFAKSGFLA 454
            + + +  +Y+   +  +Y+  F    FL+
Sbjct: 479 FVSKFDDLMYRQTPVLRYYVNKFGNDAFLS 508

>SAKL0G02684g Chr7 (220460..222079) [1620 bp, 539 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 539

 Score =  433 bits (1114), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 216/458 (47%), Positives = 297/458 (64%), Gaps = 48/458 (10%)

Query: 46  NVNQKYVSGVYYSDWSPYEPRMHFPKNIDTSKITHIYYSFFLVDADSSALKLGDSWSDIE 105
           N +Q Y+SGVYY++WSPY PR HFP +++  +IT+++YSFF+VD  S  +K  D WSD +
Sbjct: 84  NDSQSYISGVYYTNWSPYAPRNHFPHDMNFHRITNVFYSFFVVDPKSGTVKSSDEWSDFQ 143

Query: 106 M-------PMGKNTVLK-----------------GCIGALNSLRDEK-----------PG 130
           M       P  K  +L                  GCIG L  L+                
Sbjct: 144 MDLYKKFYPQFKAALLSSSSSSTFQSHKKEMLPMGCIGELFYLKYSSILPSLHGDGVHRN 203

Query: 131 FKNIMAVGGWSNKDAFPLALRKKHGVEKLAQSCVETMFQYGFDGIDLDWEYPKDDGKEPR 190
           FK  M+VGGWSN+DAFP+ +R K+  +   ++CVETMFQYGFDG+D+DWE+P++DG EP+
Sbjct: 204 FKVSMSVGGWSNRDAFPIIVRDKNKFDTFIRTCVETMFQYGFDGLDIDWEFPQNDGLEPK 263

Query: 191 IYLELMRKIRQHMNELEIAIWGDK--KRRFHLSVATPAFYDKLETFPIKEMDQYIDYWNM 248
           +YL ++R++R+ +++LE  I+ D+     F L+VA PAF +KL+  P+++MD Y+D+WN+
Sbjct: 264 MYLTMIRRLREALDDLERDIFQDEHHSEHFFLTVAVPAFKEKLQVLPLRDMDAYVDFWNL 323

Query: 249 MTYDYYGEWSSGTGFHSNLYDGTN--------KFSEHSLCADGAIRYMTNKIGINSRKVV 300
           M YDY+GEWS  TG+HSNLY   +        +  E+ L AD A++Y+    GINSRKVV
Sbjct: 324 MAYDYHGEWSELTGYHSNLYSEDSNHVHRRHFRDEENQLNADSAVKYLLKNFGINSRKVV 383

Query: 301 LGMALYGRGFTNVKEGDPKKTSGLINRKFKGVGGESEGEPGMWLYNQLPIRGTQEVFDEQ 360
           LGMA YGRGFT VK      +   I + + GVGG SEGEPGMWLYNQLP+ GT E FD +
Sbjct: 384 LGMAAYGRGFTRVKT--TANSGSYIGKPYNGVGGASEGEPGMWLYNQLPLPGTLENFDPR 441

Query: 361 YGSAYCFDPKTKTLVGYDNVDSTRQKAQYVRFHNLAGGFWWESCGNKWDNVQQSLVHVFN 420
             SAY FDPK+KT VGYDNVDS R KAQYV+ HNLAGGFWWESCG+   + Q+SL++ F 
Sbjct: 442 SVSAYSFDPKSKTFVGYDNVDSMRCKAQYVKNHNLAGGFWWESCGDNHKDEQKSLLNAFT 501

Query: 421 EDIERLDRNETNLYQDPKLREHYLQIFAKSGFLAATFK 458
            D+  L + + ++Y    +  +YL+ + + GFL+  FK
Sbjct: 502 NDLGSLAKQQPSIYTSAHVIRYYLKNYPQ-GFLSRVFK 538

>KAFR0E03810 Chr5 complement(756701..758173) [1473 bp, 490 aa] {ON}
           Anc_5.441 YDR371W
          Length = 490

 Score =  426 bits (1096), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 216/433 (49%), Positives = 287/433 (66%), Gaps = 21/433 (4%)

Query: 45  QNVNQKYVSGVYYSDWSPYEPRMHFPKNIDTSKITHIYYSFFLVDADSSALKLGDSWSDI 104
           ++ N+ +  G+YYS+WS YEPR+HFP  I+   I+H+YY+FFLVD  +  L  GD W+D 
Sbjct: 52  ESRNRSFSCGLYYSNWSAYEPRLHFPHEINFDHISHVYYAFFLVDGKNGKLVSGDKWADF 111

Query: 105 EMPMGKNT-VLKGCIGALNSLRDEKPGFKNIMAVGGWSNKDAFPLALRKKHGVEKLAQSC 163
           + P+ KN  ++KG +G L  L+  K   K IM +GGWSN++A+ +       +E   +  
Sbjct: 112 QRPILKNNKLVKGNVGELFDLK-MKNRVKCIMCIGGWSNREAWHIFSTDPSKIESFTEQA 170

Query: 164 VETMFQYGFDGIDLDWEYPKDDGKEPRIYLELMRKIRQHMNELEIAIWGDKKRR---FHL 220
           V+ MF+YGFDGIDLDWEYP+DDG EP++YLE+MR+I+ HMN+LE  I+ D       F L
Sbjct: 171 VKMMFEYGFDGIDLDWEYPEDDGIEPQLYLEIMRRIKHHMNKLESEIFKDTSATTSYFEL 230

Query: 221 SVATPAFYDKLETFPIKEMDQYIDYWNMMTYDYYGEWSSGTGFHSNLYDGT--------- 271
           SVATPAF DKLE FP+KEMD  IDYWNMMTYDYYGEWS  TG+HSNLYDG+         
Sbjct: 231 SVATPAFKDKLEIFPLKEMDTVIDYWNMMTYDYYGEWSERTGYHSNLYDGSKGSTTIESV 290

Query: 272 --NKFSE-HSLCADGAIRYMTNKIGINSRKVVLGMALYGRGFTNVKEGDPK--KTSGLIN 326
             +  SE   L  D A++YM N+ GI   K++LGMA YGRGFTNV    P+  ++   I 
Sbjct: 291 LRHGMSEVEGLNGDYAVKYMINQ-GIKKDKIILGMAAYGRGFTNVDVPTPRPNESPRYIG 349

Query: 327 RKFKGVGGESEGEPGMWLYNQLPIRGTQEVFDEQYGSAYCFDPKTKTLVGYDNVDSTRQK 386
           R F GVGG SEGEPGMW Y+QLPI GT E FD +Y S YCF+P T T VGYD +DS R K
Sbjct: 350 RTFDGVGGASEGEPGMWRYDQLPIPGTVEQFDPRYVSGYCFEPTTGTFVGYDTIDSVRVK 409

Query: 387 AQYVRFHNLAGGFWWESCGNKWDNVQQSLVHVFNEDIERLD-RNETNLYQDPKLREHYLQ 445
            QY++  ++ GGFWWESCG+   N ++SLV+ + +++ R + +   ++Y++     HY Q
Sbjct: 410 TQYIKMKDIGGGFWWESCGDTHKNPERSLVNAYVKELGRDNIKKPESIYKNLHCVSHYKQ 469

Query: 446 IFAKSGFLAATFK 458
            F   GFL+   K
Sbjct: 470 SFHGKGFLSKYLK 482

>CAGL0A02904g Chr1 (302938..304443) [1506 bp, 501 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371w
          Length = 501

 Score =  421 bits (1083), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 213/493 (43%), Positives = 295/493 (59%), Gaps = 41/493 (8%)

Query: 4   RQKITIAAVSLVSVTVILTMCFTQLLHKKTEHHHQPPAQCPQN---VNQKYVSGVYYSDW 60
           R+++    V L++  ++      ++  K          + P++    N  Y++G+YYS+W
Sbjct: 6   RKRLGTFIVILITSLILQMSLHYKIFQKLKRRSQSDDYRMPESDVLSNTSYIAGLYYSNW 65

Query: 61  SPYEPRMHFPKNIDTSKITHIYYSFFLVDADSSALKLGDSWSDIEMPMGKNT-------- 112
           SPYEPR+HFP +ID  K++HIYY+F L+D ++  L   D WSD ++ + K          
Sbjct: 66  SPYEPRLHFPHDIDFEKVSHIYYAFLLIDPETGNLTSSDEWSDTQLNLAKQCREYMFKRF 125

Query: 113 ------------VLKGCIGALNSLR-----DEKPGFKNIMAVGGWSNKDAFPLALRKKHG 155
                          GCIG LN LR      +K   K IM+VGGWSN+++FP+ +R +  
Sbjct: 126 TGDELKAVTNIRAPPGCIGELNYLRYIYSKIKKRNVKLIMSVGGWSNRESFPIMVRDELK 185

Query: 156 VEKLAQSCVETMFQYGFDGIDLDWEYPKDDGKEPRIYLELMRKIRQHMNELEIAIWGDKK 215
            +    SC+ETM  YGFDGIDLDWE+P+DD  EP  YL + R+++  + +LE  I GD  
Sbjct: 186 FKNFINSCIETMVYYGFDGIDLDWEFPEDDSYEPDAYLRMARELKLQLQKLEANILGDHS 245

Query: 216 RR-FHLSVATPAFYDKLETFPIKEMDQYIDYWNMMTYDYYGEWSSGTGFHSNLYDGTNKF 274
            + F LS+ATPAF DKL   PI ++D+YID WN+MTYDYYGEWS  TG H+NLY+   K 
Sbjct: 246 NKTFQLSMATPAFKDKLSILPIHKLDKYIDLWNLMTYDYYGEWSERTGLHANLYNEKGKL 305

Query: 275 -------SEHSLCADGAIRYMTNKIGINSRKVVLGMALYGRGFTNV--KEGDPKKTSGLI 325
                   +  L  D AI YM N+  I+ RKV+LGMA YGRGFTNV  K  +P    GL 
Sbjct: 306 LHLHRHDEDAGLSGDAAINYMVNRCKIDPRKVILGMAAYGRGFTNVDMKSTNPHNPYGL- 364

Query: 326 NRKFKGVGGESEGEPGMWLYNQLPIRGTQEVFDEQYGSAYCFDPKTKTLVGYDNVDSTRQ 385
             KF GVGG SEGEPGMWLYNQLPI G+ E +D ++  AYC+D +T TLVGYDN  S  +
Sbjct: 365 --KFSGVGGASEGEPGMWLYNQLPIPGSNEKYDYRHVGAYCYDDRTHTLVGYDNPTSVIE 422

Query: 386 KAQYVRFHNLAGGFWWESCGNKWDNVQQSLVHVFNEDIERLDRNETNLYQDPKLREHYLQ 445
           KA Y+  ++L G FWWESCG+   N ++SL++ +   I  +  N+  +Y   KL ++YL+
Sbjct: 423 KANYIMSNSLGGAFWWESCGDTHKNPKRSLLNTYIRVIRNVKNNKETIYSTTKLHDYYLE 482

Query: 446 IFAKSGFLAATFK 458
            +  +GFL    K
Sbjct: 483 NYDTNGFLTGFIK 495

>NDAI0B05710 Chr2 (1389267..1390958) [1692 bp, 563 aa] {ON}
           Anc_5.441 YDR371W
          Length = 563

 Score =  424 bits (1089), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 239/556 (42%), Positives = 324/556 (58%), Gaps = 104/556 (18%)

Query: 3   RRQKITIAAVSLVSVTV-ILTMCFTQLL-------------------------------- 29
           RR  + I  + L+++   IL MC T+L                                 
Sbjct: 4   RRTILRIRFLILLAIICFILQMCLTKLFFNSNKEKIVTDHYKNNNNNNNNNNNNNNNDDG 63

Query: 30  HKKTEHH-HQPPAQ-----CPQ--NVNQKYVSGVYYSDWSPYEPRMHFPKNIDTSKITHI 81
           +KK +HH H  P +      P+    N  +VSGVYYS WSPY+PR HFP +ID +KITH+
Sbjct: 64  NKKGQHHSHLFPQENDIVNYPKLGKTNNTFVSGVYYSSWSPYKPRYHFPHDIDLTKITHV 123

Query: 82  YYSFFLVDADSSALKLGDSWSDIEMPMGKNTVLK-------------------------- 115
           YYSFFLV+  +  +   D WSD++M + K   LK                          
Sbjct: 124 YYSFFLVNGATGDVTCSDEWSDLKMDLYKPLSLKLNTLHQNDKVLHDKNKTRLNETIEKM 183

Query: 116 ------GCIGALNSLRDEKPGFKNIMAVGGWSNKDAFPLALRKKHGVEKLAQSCVETMFQ 169
                 GC+G L  L+  +  FK IM++GGWSN++ FP  +R  + + +  +S VE MF+
Sbjct: 184 KKQLPLGCVGELFYLKKFQ-NFKLIMSIGGWSNREHFPSMVRDDNKLNQFIESSVEQMFK 242

Query: 170 YGFDGIDLDWEYPKDDGKEPRIYLELMRKIRQHMNELEIAIWGDKK------------RR 217
           YGFDGIDLDWE+P+DDG EP  YLE+++++R+ M++LE  I+   K             +
Sbjct: 243 YGFDGIDLDWEFPEDDGFEPGKYLEIVQRLRKRMDKLEHDIFQKSKISPHDYDHDYHHPK 302

Query: 218 FHLSVATPAFYDKLETFPIKEMDQYIDYWNMMTYDYYGEWSSGTGFHSNLYDGTNKFS-- 275
           F LSVATPAF +KL   PIKEM++YIDYWNMMTYDYYG+WS  TG+H NLY+G N  +  
Sbjct: 303 FELSVATPAFIEKLNILPIKEMNKYIDYWNMMTYDYYGDWSEETGYHCNLYEGGNNGTIN 362

Query: 276 -----EHS-----LCADGAIRYMTNKIGINSRKVVLGMALYGRGFTNVKEGDPKKTSGLI 325
                EH+     L A+ AI YM     ++SRK+VLG+A YGRGFT VK    K     I
Sbjct: 363 AQYKHEHTSSNKGLNANDAINYMLYNNNVSSRKLVLGLAAYGRGFTKVKVN--KNDELFI 420

Query: 326 NRKFKGVGGESEGEPGMWLYNQLPIRGTQEVFDEQYGSAYCFDPKTKTLVGYDNVDSTRQ 385
           N+KF GVGG S GEPGMWLYNQLPI+ ++E+FD  Y SA+C+DPKTKT VGYDNVD+ + 
Sbjct: 421 NKKFDGVGGASAGEPGMWLYNQLPIKNSKEMFDPNYVSAFCYDPKTKTFVGYDNVDTMKV 480

Query: 386 KAQYVRFHNLAGGFWWESCGNKWDNVQQSLVHVFNEDIE--RLDRNETN--LYQDPKLRE 441
           KA+YV+  +LAGGFWWESCG+   + ++SL++ F   +E   L + E +  +Y+ P   +
Sbjct: 481 KAKYVQDRHLAGGFWWESCGDDHKHPERSLLNAFTNQLEVKHLMKYEDSHLIYEQPDTIK 540

Query: 442 HYLQIFAKSGFLAATF 457
           +YL  F   GFL+  F
Sbjct: 541 YYLNYFGNDGFLSPFF 556

>Kpol_1062.25 s1062 complement(56775..58376) [1602 bp, 533 aa] {ON}
           complement(56775..58376) [1602 nt, 534 aa]
          Length = 533

 Score =  419 bits (1077), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 218/514 (42%), Positives = 303/514 (58%), Gaps = 72/514 (14%)

Query: 12  VSLVSVTVILTMCFTQLLHKKTEHHHQPPAQC---------------PQNVNQKYVSGVY 56
           V+L  + VI+++     L++K   H                      P N +  Y  GVY
Sbjct: 10  VALALLFVIISIMVESFLYQKFLKHGSKEESIEDSINESQIVYGKSFPNNPDSGYDVGVY 69

Query: 57  YSDWSPYEPRMHFPKNIDTSKITHIYYSFFLVDADSSALKLGDSWSDIEM---------- 106
           YS+WSPY PR+H P ++D S++TH+YY+FF+VD+ + AL   D+WSD EM          
Sbjct: 70  YSNWSPYTPRLHLPHDMDFSRLTHVYYAFFVVDSKTGALTTSDNWSDFEMDCYKPLAMKL 129

Query: 107 ----------PMGKNTVLKGCIGALNSLR-------DEKPGFKNIMAVGGWSNKDAFPLA 149
                     P  KN +  GCIG L  LR       +    FK IM+VGGWSN++AFP  
Sbjct: 130 KKLQLDHFFNPKFKNGLPMGCIGELFYLRHSQLFDSNNSRKFKLIMSVGGWSNREAFPRM 189

Query: 150 LRKKHGVEKLAQSCVETMFQYGFDGIDLDWEYPKDDGKEPRIYLELMRKIRQHMNELEIA 209
           +R    ++    SC+E MF YGFDGI+LDWE+PKDD  EP++YLEL++K++   NELE  
Sbjct: 190 IRDSKKLDAFVNSCIENMFNYGFDGIELDWEFPKDDKLEPKMYLELVKKLKWKQNELEQK 249

Query: 210 IWGD-------KKRRFHLSVATPAFYDKLETFPIKEMDQYIDYWNMMTYDYYGEWSSGTG 262
           I+ +       K+ +FHLS+A PAF +KL+   ++EMD Y+D WNMMTYDY+GEWS  TG
Sbjct: 250 IFNNSGNGNHSKRPKFHLSIAAPAFKEKLDILLMREMDHYVDVWNMMTYDYHGEWSEKTG 309

Query: 263 FHSNLYD---------------------GTNKFSEHSLCADGAIRYMTNKIGINSRKVVL 301
           +HSNLY                        ++  E +L  D AI Y+  K  IN +K+ L
Sbjct: 310 YHSNLYSPQETRNEDDDDDDRDEDNEDDDDDEDDESNLNGDYAINYVIKKYHINPKKINL 369

Query: 302 GMALYGRGFTNVKEGDPKKTSGLINRKFKGVGGESEGEPGMWLYNQLPIRGTQEVFDEQY 361
           GMA YGRGFT V      + +  IN+ ++GVGG SEGEPGMWLYNQLPI+ + E FD  Y
Sbjct: 370 GMAAYGRGFTKVNAS--SQDTRFINKPYRGVGGASEGEPGMWLYNQLPIKNSLEEFDPDY 427

Query: 362 GSAYCFDPKTKTLVGYDNVDSTRQKAQYVRFHNLAGGFWWESCGNKWDNVQQSLVHVFNE 421
            SA+C+D K+KT VGYDN DS + KAQYV+ HNL GGFWWESCG+   N ++SL++ F +
Sbjct: 428 VSAFCYDKKSKTFVGYDNRDSMKVKAQYVKEHNLKGGFWWESCGDDHKNPEKSLLNAFTD 487

Query: 422 DIERLDRNETNLYQDPKLREHYLQIFAKSGFLAA 455
           +I  +      ++ + ++ ++YL+    +GFL+ 
Sbjct: 488 EIGSVTEKNETMFTNIEVLKYYLKTKGDTGFLST 521

>KLLA0E02333g Chr5 (215594..217036) [1443 bp, 480 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 480

 Score =  415 bits (1066), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 211/472 (44%), Positives = 302/472 (63%), Gaps = 29/472 (6%)

Query: 7   ITIAAVSLVSVTVILTMCFTQLLHKKTEHHHQPPAQ------CPQNVNQKYVSGVYYSDW 60
           I I  ++ +    I+   F   + K      +PP +       P      +    YYS+W
Sbjct: 16  IIIIVLAFIVEMCIVPWLFLDKIKKGGSAGRRPPTEIDPDTRVPSEGPDGFSVATYYSNW 75

Query: 61  SPYEPRMHFPKNIDTSKITHIYYSFFLVDADSSALKLGDSWSDIEMPMGKNTVLKGCIGA 120
           SPY  R H P +I TS++TH+YY+FF+VDA S A+K  DSWSD E+P+  +  +KGCI  
Sbjct: 76  SPYNARNHKPADIPTSQLTHVYYAFFVVDAKSGAVKSSDSWSDFELPL--SVGVKGCIKE 133

Query: 121 LNSLRDE-KPGFKNIMAVGGWSNKDAFPLALRKKHGVEKLAQSCVETMFQYGFDGIDLDW 179
           L  ++ E K  FK I+ +GGWSN++A+    + +  V+K  ++ V+ MF+YGFDGIDLDW
Sbjct: 134 LQKIKLESKHEFKTILCLGGWSNREAYKKIAKSEKKVKKFIETAVDCMFRYGFDGIDLDW 193

Query: 180 EYPKDDGKEPRIYLELMRKIRQHMNELEIAIWGDKKRR-----FHLSVATPAFYDKLETF 234
           E+P++D  EP +YLE+MR IR+ M++LE  I+G          F LSVATPAF +KL   
Sbjct: 194 EFPEEDSNEPIVYLEMMRGIREGMDQLERQIFGSPAEEKDHPHFQLSVATPAFAEKLNIL 253

Query: 235 PIKEMDQYIDYWNMMTYDYYGEWSSGTGFHSNLY--------DGTNKFSEHSLCADGAIR 286
           PI EM +Y+D WNMM YD++GEWS  TG+HSNLY          +N+ S  SL +D A++
Sbjct: 254 PISEMSKYVDIWNMMCYDFHGEWSDVTGYHSNLYLQGHSHRRSLSNRISNSSLSSDTAVK 313

Query: 287 YMTNKIGINSRKVVLGMALYGRGFTNVKEGDPKKTSGLINRKFKGVGGESEGEPGMWLYN 346
            MT++  I+SR++ LGMA YGRGFTNV+  D       + +K+ GVGG SEGEPG+WLYN
Sbjct: 314 LMTDRHNISSRRIALGMAAYGRGFTNVETND----DNYLGKKYHGVGGGSEGEPGIWLYN 369

Query: 347 QLPIRGTQEVFDEQYGSAYCFDPKTKTLVGYDNVDSTRQKAQYVRFHNLAGGFWWESCGN 406
           QLPI G++E FD    SAYCFDPK++T VGYDNV S   K +Y++  NL GGFWWESCG+
Sbjct: 370 QLPIDGSKEQFDSNAVSAYCFDPKSRTFVGYDNVQSMDIKGKYIKKKNLNGGFWWESCGD 429

Query: 407 KWDNVQQSLVHVFNEDIERLDRNETNLYQDPKLREHYLQIFAKSGFLAATFK 458
             D  ++SLV+ F+++I  L     +L++  K+++ +LQ + K  ++++ F+
Sbjct: 430 SKDP-RKSLVNAFSKEI-GLSEGFVSLFKSDKVKQFHLQKYPKD-YISSLFQ 478

>TPHA0E01720 Chr5 complement(348101..349714) [1614 bp, 537 aa] {ON}
           Anc_5.441 YDR371W
          Length = 537

 Score =  414 bits (1064), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 207/470 (44%), Positives = 291/470 (61%), Gaps = 58/470 (12%)

Query: 40  PAQCPQNVNQK-------YVSGVYYSDWSPYEPRMHFPKNIDTSKITHIYYSFFLVDADS 92
           P   P+N  Q        Y  GVYYS+WSPY PR+ FP +IDTS+++H+YYSF LVD D 
Sbjct: 60  PIMKPENSEQNNGTENSLYSMGVYYSNWSPYSPRLFFPHDIDTSRVSHVYYSFLLVDGDE 119

Query: 93  SALKLGDSWSDIEMPMGKNTVLK----------------------GCIGALNSLRDEK-- 128
             +K  D+WSD ++ M K   L                       GCIG    LR+ +  
Sbjct: 120 GTIKSSDTWSDFQIDMYKPLYLSLGQVDNDFDSVPISMKKELLPMGCIGEFFYLRNTRIP 179

Query: 129 ------PGFKNIMAVGGWSNKDAFPLALRKKHGVEKLAQSCVETMFQYGFDGIDLDWEYP 182
                   FK  M+VGGWSN++AFP  +R    V+K   SC++TMF YGFDGIDLDWE+P
Sbjct: 180 IHGPKSTDFKVFMSVGGWSNREAFPKMVRDPQKVDKFINSCIDTMFMYGFDGIDLDWEFP 239

Query: 183 KDDGKEPRIYLELMRKIRQHMNELEIAIWGDKKRR------FHLSVATPAFYDKLETFPI 236
           +DDG EP +YL+++++++  M ELE  I+ D          F LS+A PAF +KL   P+
Sbjct: 240 EDDGFEPMMYLDIIKRLKMKMLELEATIYKDAISHNTSYPHFELSIAAPAFDEKLRILPV 299

Query: 237 KEMDQYIDYWNMMTYDYYGEWSSGTGFHSNLYDG----------TNKFSEHSLCADGAIR 286
           ++MD+++D WNMMTYDY GEWS  TG+HSNL+            +   S  +LC D A++
Sbjct: 300 QQMDKFVDKWNMMTYDYSGEWSDVTGYHSNLFSPPDVSGSVMKRSQSNSNETLCGDNAVK 359

Query: 287 YMTNKIGINSRKVVLGMALYGRGFTNVKEGDPKKTSG-LINRKFKGVGGESEGEPGMWLY 345
           YM + + I+SRK++LGMA YGRGF+ V +    KT+G L  +KF GV G S  EPG+WLY
Sbjct: 360 YMKDNLKISSRKIILGMAAYGRGFSGVSKS---KTNGKLTGKKFNGVSGSSPDEPGVWLY 416

Query: 346 NQLPIRGTQEVFDEQYGSAYCFDPKTKTLVGYDNVDSTRQKAQYVRFHNLAGGFWWESCG 405
           N+LPI+G++E FD++  SAYC+DPK+K  V YDN  S   K++YVR +NL GGF WE+CG
Sbjct: 417 NKLPIKGSKEEFDKESVSAYCYDPKSKIFVAYDNSQSMVIKSKYVRDNNLGGGFLWEACG 476

Query: 406 NKWDNVQQSLVHVFNEDIERLDRNETNLYQDPKLREHYLQIFAKSGFLAA 455
            K +N + SL++ F  D+  +D+ ++ ++ + K+ E+YL  + K GFL+ 
Sbjct: 477 EKLNNPKLSLINSFTFDMNNIDKQKS-MFSNRKVLEYYLMKYGKQGFLSG 525

>NCAS0F03420 Chr6 (689091..690668) [1578 bp, 525 aa] {ON} Anc_5.441
           YDR371W
          Length = 525

 Score =  411 bits (1057), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 226/521 (43%), Positives = 312/521 (59%), Gaps = 67/521 (12%)

Query: 3   RRQKI---TIAAVSLVSVTVILTMCFTQLLHKK------TEHHHQPPA------------ 41
           RR+K    T    +L  V ++L MC  +L  K+       + H +               
Sbjct: 5   RRRKFFLNTGVLFALAIVVLVLQMCLHKLYFKQKATQDLIQSHFRNGTIPNRQEIDYLMN 64

Query: 42  QCPQNVNQKYVSGVYYSDWSPYEPRMHFPKNIDTSKITHIYYSFFLVDADSSALKLGDSW 101
           Q   N  + Y+SG+YYS WSPY+PR HFP +ID ++++HIYY+FFLVD  +  L   D W
Sbjct: 65  QTNSNGEKGYLSGLYYSSWSPYKPRFHFPHDIDLTRVSHIYYAFFLVDPKTGKLNPSDEW 124

Query: 102 SDIEMPMGKNTVLK-----------------------GCIGALNSLRDEK--PG---FKN 133
           SD++M + K   +K                       GCIG L  L+     PG    K 
Sbjct: 125 SDLQMDLYKPLSVKLHNLNLADNEKPVQLRDKRKLPLGCIGELFYLKHSGIIPGGSSTKM 184

Query: 134 IMAVGGWSNKDAFPLALRKKHGVEKLAQSCVETMFQYGFDGIDLDWEYPKDDGKEPRIYL 193
           I+++GGWSN+D FP  +R     E    S VETMF+YGFDGIDLDWE+PKDDG EP  YL
Sbjct: 185 ILSIGGWSNRDRFPGLVRDTRKFENFIDSAVETMFRYGFDGIDLDWEFPKDDGLEPNKYL 244

Query: 194 ELMRKIRQHMNELEIAIWGDKKR--RFHLSVATPAFYDKLETFPIKEMDQYIDYWNMMTY 251
           E++ K+R+ M++LE+ I+G+ K   +F LSVATPAF  KL   PI +MDQY+DYWNMMTY
Sbjct: 245 EMISKLRRKMDDLELEIFGETKDHPKFQLSVATPAFIYKLSILPIIQMDQYVDYWNMMTY 304

Query: 252 DYYGEWSSGTGFHSNLYDGT-NKFS-----EHS-----LCADGAIRYMTNKIGINSRKVV 300
           DYYG WS  TG+H NL++G  ++F      EH+     L A+ AI +M     + S KVV
Sbjct: 305 DYYGSWSEATGYHCNLFNGDGSEFRAGYKHEHTAHNNGLNANEAIDFMIKSCNVPSSKVV 364

Query: 301 LGMALYGRGFTNVKEGDPKKTSGLINRKFKGVGGESEG-EPGMWLYNQLPIRGTQEVFDE 359
           LGMA YGR F +VK      T  LIN+KFKGVG    G EPGMWLYNQLP++GT E++D 
Sbjct: 365 LGMAAYGREFKHVKSRQGVDT--LINQKFKGVGKGGLGDEPGMWLYNQLPLKGTVEMYDP 422

Query: 360 QYGSAYCFDPKTKTLVGYDNVDSTRQKAQYVRFHNLAGGFWWESCGNKWDNVQQSLVHVF 419
            YG+A+C+D K++T +GYDNVDS + KAQYV+   L GGFWWESCG+   N ++SL++ F
Sbjct: 423 NYGAAFCYDKKSETFIGYDNVDSVKLKAQYVQTRELGGGFWWESCGDDHINKRRSLLYNF 482

Query: 420 NEDIERLDR--NETNLYQDPKLREHYLQIFAKSGFLAATFK 458
           + ++  + +  ++  +++  +   +YL  +   GFL+   +
Sbjct: 483 SNEVTEIRKFSDQDLIFRRKECIAYYLNRYGTDGFLSGILQ 523

>Smik_4.637 Chr4 (1139498..1141033) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  388 bits (996), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 197/448 (43%), Positives = 276/448 (61%), Gaps = 36/448 (8%)

Query: 41  AQCPQNVNQKYVSGVYYSDWSPYEPRMHFPKNIDTSKITHIYYSFFLVDADSSALKLGDS 100
            Q P    + +VSGVYYS+WSPY+PR HFP +I+ ++++H+YY+FF ++  +  ++  D+
Sbjct: 63  TQGPNVDGEGFVSGVYYSNWSPYKPRFHFPHDINLTQVSHVYYAFFRINPRTGGIESTDN 122

Query: 101 WSDIEMPMGKNTVLK-------------------GCIGALNSLRDEKPG--FKNIMAVGG 139
           WSD+EM + K   +K                   GCIG L  L+    G  FK IM++GG
Sbjct: 123 WSDLEMNLYKPLAIKSSELIDGNSSNDIQKILPLGCIGELFYLKHSCSGKKFKVIMSIGG 182

Query: 140 WSNKDAFPLALRKKHGVEKLAQSCVETMFQYGFDGIDLDWEYPKDDGKEPRIYLELMRKI 199
           WS+ + F + ++ ++ ++    S VETMF+ GFDGIDLDWE+P+++  EP+ YL+L+R +
Sbjct: 183 WSDSENFKVIIKNENLLQAFVDSSVETMFKLGFDGIDLDWEFPENNKSEPQGYLKLVRML 242

Query: 200 RQHMNELEIAIWGDK-KRRFHLSVATPAFYDKLETFPIKEMDQYIDYWNMMTYDYYGEWS 258
           R  +N LE  I+G+  +  F LS+A PAF DKL   PI E+DQYIDYWNMMTYDYYG WS
Sbjct: 243 RSKLNSLESQIFGEGVEDHFQLSIAAPAFKDKLYYLPIPEIDQYIDYWNMMTYDYYGSWS 302

Query: 259 SGTGFHSNLYDGTNKFSEHSLCADGAIRYMTNKIGINSRKVVLGMALYGRGFTNVKEGDP 318
             TG+HSNL      FSE  L  + AI YM +K GINSRK+VLGMA YGR F     G  
Sbjct: 303 ETTGYHSNL------FSETELSGNFAIHYMIDKFGINSRKLVLGMAAYGRSFHIKGSGFQ 356

Query: 319 KKTSG--LINRKFKGVG------GESEGEPGMWLYNQLPIRGTQEVFDEQYGSAYCFDPK 370
             T    LIN+ FKGVG       +++G+ G+W Y  LP +GT E +D +Y SAYCFD K
Sbjct: 357 PFTQNTILINQSFKGVGKLTKEVNKADGKEGIWPYKNLPKKGTIERYDPKYVSAYCFDEK 416

Query: 371 TKTLVGYDNVDSTRQKAQYVRFHNLAGGFWWESCGNKWDNVQQSLVHVFNEDIERLDRNE 430
               + YDN  S + KA+YV  + L GGFWWESCG  + N  +SL+H FNE +      +
Sbjct: 417 NSIFISYDNTKSVKTKAEYVLHNKLGGGFWWESCGETYANESRSLIHAFNEGLRSNVSTK 476

Query: 431 TNLYQDPKLREHYLQIFAKSGFLAATFK 458
            +++++ ++   YL  +  +GFL    K
Sbjct: 477 PSMFENERVVNFYLNKYGNNGFLTPYLK 504

>Suva_2.543 Chr2 (970024..971559) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  387 bits (995), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 201/458 (43%), Positives = 283/458 (61%), Gaps = 43/458 (9%)

Query: 37  HQPPA----QCPQNVNQKYVSGVYYSDWSPYEPRMHFPKNIDTSKITHIYYSFFLVDADS 92
           HQ P     Q P   +  YVSGVYYS+WSPY+PR HFP +I+  +++H+YY+FF +D  +
Sbjct: 55  HQVPNMVQNQKPSGDDDGYVSGVYYSNWSPYKPRFHFPHDINLEQVSHVYYAFFRIDPKT 114

Query: 93  SALKLGDSWSDIEMPMGKNTVLK--------------------GCIGALNSLRDEKPG-- 130
             +   DSWSD+EM + K   +K                    GCIG L  L++   G  
Sbjct: 115 GCIGSTDSWSDLEMDLYKPLAIKASQLVDDNLDDNNMQSILPLGCIGELFYLKNACSGRK 174

Query: 131 FKNIMAVGGWSNKDAFPLALRKKHGVEKLAQSCVETMFQYGFDGIDLDWEYPKDDGKEPR 190
           FK+IM++GGWS+ + F   ++ +  ++    S VETMF+ GFDGID+DWE+P+++  EP+
Sbjct: 175 FKSIMSIGGWSDSENFKTIVKNEKLLQNFVDSSVETMFKLGFDGIDIDWEFPENNKVEPQ 234

Query: 191 IYLELMRKIRQHMNELEIAIWG-DKKRRFHLSVATPAFYDKLETFPIKEMDQYIDYWNMM 249
            YL+L+R +R  +N LE  I+G   K  F LS+A PAF DKL   PI E+DQYID+WNMM
Sbjct: 235 GYLKLVRMLRLKLNSLESQIFGGSTKDHFELSIAAPAFKDKLYFLPIAEIDQYIDHWNMM 294

Query: 250 TYDYYGEWSSGTGFHSNLYDGTNKFSEHSLCADGAIRYMTNKIGINSRKVVLGMALYGRG 309
           TYDYYG WS  TG+HSNL      FSE  L  + AI YM  + G+N RK+VLGMA YGR 
Sbjct: 295 TYDYYGSWSETTGYHSNL------FSETELSGNFAIHYMIGEFGVNPRKLVLGMAAYGRS 348

Query: 310 FTNVKEGDPK---KTSGLINRKFKGVG------GESEGEPGMWLYNQLPIRGTQEVFDEQ 360
           F ++K+   +   K + LIN++FKGVG       +++G+ G+W Y  LP +GT E +D +
Sbjct: 349 F-HIKDDKFRPFTKNTVLINQQFKGVGKPGKEIDKADGKEGIWPYKNLPKKGTTEQYDPK 407

Query: 361 YGSAYCFDPKTKTLVGYDNVDSTRQKAQYVRFHNLAGGFWWESCGNKWDNVQQSLVHVFN 420
           Y SAYCFD K    +GYDN +S + KA YV    L GGFWWESCG  + +  +SL++ FN
Sbjct: 408 YVSAYCFDEKNSIFIGYDNTESIKTKADYVMHTELGGGFWWESCGEDYADKSRSLINAFN 467

Query: 421 EDIERLDRNETNLYQDPKLREHYLQIFAKSGFLAATFK 458
           E +     ++ +++QD ++ ++YL  +   GFLA   K
Sbjct: 468 EALHFNVSSKPSMFQDKRVMKYYLSKYGDGGFLAPYLK 505

>YDR371W Chr4 (1219413..1220948) [1536 bp, 511 aa] {ON}
           CTS2Putative chitinase, functionally complements A.
           gossypii cts2 mutant sporulation defect
          Length = 511

 Score =  387 bits (994), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 199/458 (43%), Positives = 288/458 (62%), Gaps = 50/458 (10%)

Query: 42  QCPQNV--------NQKYVSGVYYSDWSPYEPRMHFPKNIDTSKITHIYYSFFLVDADSS 93
           + P NV        ++ ++SGVYYS+WSPY+PR HFP +I+  +++HIYY+FF +++ + 
Sbjct: 56  RVPSNVQNHGTHIRDEAFISGVYYSNWSPYKPRFHFPHDINLKQVSHIYYAFFKINSRTG 115

Query: 94  ALKLGDSWSDIEMPMGKNTVLK-------------------GCIGAL----NSLRDEKPG 130
            ++  DSWSD+EM + K+  +K                   GCIG L    N+  D+K  
Sbjct: 116 GIENTDSWSDLEMNLYKSLAIKNSELIKESSNNSVQNILPLGCIGELFYLKNTCSDKK-- 173

Query: 131 FKNIMAVGGWSNKDAFPLALRKKHGVEKLAQSCVETMFQYGFDGIDLDWEYPKDDGKEPR 190
           FK IM++GGWS+ + F + ++    ++    S VETMF+ GFDGIDLDWE+P ++  EPR
Sbjct: 174 FKVIMSIGGWSDSENFKIIIKDDKLLQNFVDSSVETMFRLGFDGIDLDWEFPGNNESEPR 233

Query: 191 IYLELMRKIRQHMNELEIAIWGDKKR-RFHLSVATPAFYDKLETFPIKEMDQYIDYWNMM 249
            YL+L+R +R  +N LE  I+G +    F LS+A PAF DKL   PI E+DQY+DYWNMM
Sbjct: 234 GYLKLVRMLRLKLNSLESQIFGKRTEDHFQLSIAAPAFKDKLFYLPITEIDQYVDYWNMM 293

Query: 250 TYDYYGEWSSGTGFHSNLYDGTNKFSEHSLCADGAIRYMTNKIGINSRKVVLGMALYGRG 309
           TYDYYG WS  TG+HSNL      FSE  L  + A+ YM ++ G+NSRK+VLGMA YGR 
Sbjct: 294 TYDYYGSWSETTGYHSNL------FSETELNGNFAMHYMIDRFGVNSRKLVLGMAAYGRS 347

Query: 310 FTNVKEG--DP-KKTSGLINRKFKGVG------GESEGEPGMWLYNQLPIRGTQEVFDEQ 360
           F ++K+   +P  + + LIN+ FKGVG       +++G+ G+W Y  LP  GT E +D +
Sbjct: 348 F-HIKDNKFEPFNQNTVLINKIFKGVGKPTKEIDKADGKEGIWPYKNLPKIGTIEQYDPK 406

Query: 361 YGSAYCFDPKTKTLVGYDNVDSTRQKAQYVRFHNLAGGFWWESCGNKWDNVQQSLVHVFN 420
           Y SAYCFD K    + YDN  S + KA+YV  +NL GGFWWESCG  + N  +SL++ FN
Sbjct: 407 YVSAYCFDEKNSIFISYDNTKSVKTKAEYVTHNNLGGGFWWESCGEAYANESRSLINAFN 466

Query: 421 EDIERLDRNETNLYQDPKLREHYLQIFAKSGFLAATFK 458
           E +     ++ +++QD +++++YL  +   GFL+   K
Sbjct: 467 EGLHFNVSSKPSIFQDVRVKKYYLNKYGDGGFLSPYLK 504

>ACL166W Chr3 (64828..66300) [1473 bp, 490 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDR371W (CTS2)
          Length = 490

 Score =  382 bits (980), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 218/485 (44%), Positives = 297/485 (61%), Gaps = 42/485 (8%)

Query: 8   TIAAVSLVSVTVILTMCFTQLLHKKTEHHHQP----------PAQCPQNVNQKYVSGVYY 57
           TI  + LV+  V+      +L+ +K     +P          P       + +Y  GVYY
Sbjct: 10  TIWILILVAAIVLEMTFLPKLIKEKLSRRIRPKPLEVHEETRPVPDAPYPDGEYTVGVYY 69

Query: 58  SDWSPYEPRMHFPKNIDTSKITHIYYSFFLVDADSSALKLGDSWSDIEMPM---GKNTVL 114
           S WSPY+PR+H+P+NID  ++TH+YY+FF+VD  +  +   D WSD +MPM   G    L
Sbjct: 70  SSWSPYKPRLHYPRNIDFQRVTHVYYAFFVVDEKTGKIGSLDKWSDTKMPMNLTGMPRGL 129

Query: 115 KGCIGALNSLRDEKPG--FKNIMAVGGWSNKDAFPLALRKKHGVEKLAQSCVETMFQYGF 172
            G IG LN L+  +PG  FK +MAVGGWSN++ F   +R +        S ++ MF+YGF
Sbjct: 130 NGAIGELNYLK-TRPGTDFKLMMAVGGWSNREPFHKIVRDEEKFNNFIDSAIDAMFEYGF 188

Query: 173 DGIDLDWEYPKDDGKEPRIYLELMRKIRQHMNELEIAIWG---DKKRRFHLSVATPAFYD 229
           DGIDLDWE+PKDDG EP++YLE+  ++R  M+ELE  IWG     + RFHLS+A PAF  
Sbjct: 189 DGIDLDWEFPKDDGYEPQMYLEMCSRLRHKMDELEDNIWGPGGTTEPRFHLSMAAPAFPQ 248

Query: 230 KLETFPIKEMDQYIDYWNMMTYDYYGEWSSGTGFHSNLYDGTNK-FSEH----------- 277
            L  FP++EM++Y+  WNMMTYDY+G WS  TG+HSNLY+ TN  +  H           
Sbjct: 249 TLGIFPVEEMNKYLSMWNMMTYDYHGAWSERTGYHSNLYNATNSPYKSHLDKRRYEDMGI 308

Query: 278 ----SLCADGAIRYMTNKIGINSRKVVLGMALYGRGFTNVKEGDPKKTSGLINRKFKGVG 333
                L A  AI  MT +  ++ RK+ LGMA YGRGFTNV+ GD ++   LI +K+ GVG
Sbjct: 309 DNFDELNAHDAILMMTEQFKVSPRKIALGMAAYGRGFTNVR-GDGEQ---LIGQKYSGVG 364

Query: 334 GESEGEPGMWLYNQLPIRGTQEVFDEQYGSAYCFDPKTKTLVGYDNVDSTRQKAQYVRFH 393
           G SEGEPGMWLYNQLP+    E FD  + SAY +DP TKTLV YDNVDS + K +YV+  
Sbjct: 365 GGSEGEPGMWLYNQLPLAHGPEKFDNVWVSAYSYDPNTKTLVVYDNVDSMKIKKEYVKDK 424

Query: 394 NLAGGFWWESCGNKWDNVQQSLVHVFNEDIERLDRNETNLYQDPKLREHYLQIFAKSGFL 453
            LAG F WESCG+ + +  ++LV  F E+++     +   Y+D KL ++YL+     GFL
Sbjct: 425 KLAGAFLWESCGDNFKDKDRNLVEAFTENMK--GARKATAYKDSKLIQYYLRT-RPEGFL 481

Query: 454 AATFK 458
              ++
Sbjct: 482 VPMYR 486

>Ecym_4512 Chr4 (1022092..1023675) [1584 bp, 527 aa] {ON} similar to
           Ashbya gossypii ACL166W
          Length = 527

 Score =  378 bits (971), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 208/489 (42%), Positives = 302/489 (61%), Gaps = 40/489 (8%)

Query: 3   RRQKITIAAVSLVSVTVILTMCFTQLLHKKTEHHHQPPAQCPQNV-------------NQ 49
           RR  IT  ++ ++ + V + +  T +     E   +P +   +               + 
Sbjct: 2   RRFSITSYSIWILVLLVAIILEMTFIPKLMIEKFKKPRSDIERTALSTITRPVDRNLQHG 61

Query: 50  KYVSGVYYSDWSPYEPRMHFPKNIDTSKITHIYYSFFLVDADSSALKLGDSWSDIEMPM- 108
           KY  GVYY+ WSPYEPR+HFP +ID  ++T++ Y+FF+VD  +  ++  DSWSD+EMP  
Sbjct: 62  KYAVGVYYTSWSPYEPRLHFPHDIDFKRVTNVNYAFFVVDPKTGKVQPTDSWSDLEMPSH 121

Query: 109 --GKNTVLKGCIGALNSLRDEK-PGFKNIMAVGGWSNKDAFPLALRKKHGVEKLAQSCVE 165
             G    + G IG LN L+ ++   F+  MAVGGWSN++AFP  +R +  ++    S ++
Sbjct: 122 APGIPQGVTGMIGELNYLKLQRNTNFRLFMAVGGWSNREAFPKIVRSEEKLKNFVNSTID 181

Query: 166 TMFQYGFDGIDLDWEYPKDDGKEPRIYLELMRKIRQHMNELEIAIWGDKKR---RFHLSV 222
            MF+YGFDGIDLDWE+PKDDG EP +YLE+  ++R  M++LE  IWG       +F LSV
Sbjct: 182 AMFEYGFDGIDLDWEFPKDDGYEPGMYLEMCSRLRSKMDKLEDEIWGANNTDYPKFELSV 241

Query: 223 ATPAFYDKLETFPIKEMDQYIDYWNMMTYDYYGEWSSGTGFHSNLYDGTNKFSE------ 276
           ATPAF   L+  PI EM++++  WNMMTYD++G WS  TG+HSNLYDG     E      
Sbjct: 242 ATPAFSQTLKILPIIEMNKFVSIWNMMTYDFHGSWSKRTGYHSNLYDGNKNNDELKKRRF 301

Query: 277 --------HSLCADGAIRYMTNKIGINSRKVVLGMALYGRGFTNVKEGDPKKTSGLINRK 328
                     L AD AI+ M     ++++KV LGM  YGRGFTNV+  D      L+N+K
Sbjct: 302 EGMVIDDNEGLNADDAIKIMVENFKVHAKKVRLGMPAYGRGFTNVQTKD---DDDLLNKK 358

Query: 329 FKGVGGESEGEPGMWLYNQLPIRGTQEVFDEQYGSAYCFDPKTKTLVGYDNVDSTRQKAQ 388
           + GVGG SEGEPG+WLYNQLP+  T E FD+++ SAYCFD   KT VGYDN+ S   K+ 
Sbjct: 359 YSGVGGGSEGEPGIWLYNQLPLANTAEKFDDRWVSAYCFDKNLKTFVGYDNIQSMEVKSD 418

Query: 389 YVRFHNLAGGFWWESCGNKWDNVQQSLVHVFNEDIERLDRNETNLYQDPKLREHYLQIFA 448
           YV+  +L+GGF+WESCG+  ++ +++LV  F++++  + R  T +++DP+   +YL+   
Sbjct: 419 YVKQKHLSGGFFWESCGDTHNDPKRNLVRAFSQELSEM-RIPT-IFKDPRAIAYYLK-HR 475

Query: 449 KSGFLAATF 457
           + GFL + F
Sbjct: 476 QKGFLYSLF 484

>Skud_4.640 Chr4 (1142282..1143817) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  370 bits (950), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 189/448 (42%), Positives = 277/448 (61%), Gaps = 38/448 (8%)

Query: 42  QCPQNVNQKYVSGVYYSDWSPYEPRMHFPKNIDTSKITHIYYSFFLVDADSSALKLGDSW 101
           Q P +  + YVSGVYYS+WSPY PR HFP +I+  +++H+YY+FF +++ +  ++  DSW
Sbjct: 64  QKPHDGGKGYVSGVYYSNWSPYTPRFHFPHDINLMQVSHVYYAFFRINSKTGGIESTDSW 123

Query: 102 SDIEMPMGKNTVLK-------------------GCIGALNSLRD--EKPGFKNIMAVGGW 140
           SD+EM + K   +K                   GC+G L  L++   +  FK IM++GGW
Sbjct: 124 SDLEMNLYKPLAIKSSQLVENNLNDSVQNILPLGCVGELFYLKNACSEKKFKVIMSIGGW 183

Query: 141 SNKDAFPLALRKKHGVEKLAQSCVETMFQYGFDGIDLDWEYPKDDGKEPRIYLELMRKIR 200
           S+ + F   +     ++    S VETMF+ GFDGID+DWE+P+++  EP+ YL+L++ +R
Sbjct: 184 SDSENFKTIVGDDKLLQNFVDSSVETMFKLGFDGIDIDWEFPENNKIEPQGYLKLVKMLR 243

Query: 201 QHMNELEIAIWGDK-KRRFHLSVATPAFYDKLETFPIKEMDQYIDYWNMMTYDYYGEWSS 259
             +N LE  I+G+  +  F +S+A PAF DKL   PI E+DQYIDYWNMMTYDYYG WS 
Sbjct: 244 LKLNNLESQIFGESIEDHFQISIAAPAFKDKLFFLPISEIDQYIDYWNMMTYDYYGSWSE 303

Query: 260 GTGFHSNLYDGTNKFSEHSLCADGAIRYMTNKIGINSRKVVLGMALYGRGFTNVKEGDPK 319
            TG+HSNL      FSE  L  + A+ YM ++  ++S K+VLGMA YGR F ++K+   +
Sbjct: 304 TTGYHSNL------FSETELSGNFAMHYMIDEFSVDSSKLVLGMAAYGRSF-HIKDSKFQ 356

Query: 320 ---KTSGLINRKFKGVG------GESEGEPGMWLYNQLPIRGTQEVFDEQYGSAYCFDPK 370
              + + LIN+ FKGVG       +++G+ G+W Y  LP +GT E +D +Y SAYCFD K
Sbjct: 357 PFTQNTVLINQHFKGVGKPGKEIDKADGKEGIWPYKSLPKKGTIEQYDPKYVSAYCFDEK 416

Query: 371 TKTLVGYDNVDSTRQKAQYVRFHNLAGGFWWESCGNKWDNVQQSLVHVFNEDIERLDRNE 430
               + YDN  S + KA+YV  + L GGFWWESCG    N  +SL++ FNE I     ++
Sbjct: 417 NSIFISYDNTKSAKTKAEYVMHNKLGGGFWWESCGEAHTNKSRSLINAFNEGIRFNVSSK 476

Query: 431 TNLYQDPKLREHYLQIFAKSGFLAATFK 458
            +++QD ++ + YL  +   GFL+   K
Sbjct: 477 PSMFQDMRVIKFYLNKYGDDGFLSPYLK 504

>KLTH0F15906g Chr6 complement(1293832..1295379) [1548 bp, 515 aa]
           {ON} similar to uniprot|Q06350 Saccharomyces cerevisiae
           YDR371W CTS2 Sporulation-specific chitinase
          Length = 515

 Score =  363 bits (933), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 191/448 (42%), Positives = 274/448 (61%), Gaps = 44/448 (9%)

Query: 51  YVSGVYYSDWSPYEPRMHFPKNIDTSKITHIYYSFFLVDADSSALKLGDSWSDIEM---- 106
           +V+G+YYS+WSPY  R HFP +ID  K+TH+YY+F +V++++   +L D WSD++M    
Sbjct: 71  FVTGMYYSNWSPYAARKHFPHDIDFRKLTHVYYAFLVVNSETGECQLSDEWSDVQMDLYK 130

Query: 107 ---------------PMG-KNTVLKGCIGALNSLRDEK-----------PGFKNIMAVGG 139
                          P G K+ +  GCIG L  L+                FK IM+VGG
Sbjct: 131 QMISSFKKLDLRAQFPTGSKDKLPLGCIGELFFLKYSNFLTRNGGSAGVNNFKTIMSVGG 190

Query: 140 WSNKDAFPLALRKKHGVEKLAQSCVETMFQYGFDGIDLDWEYPKDDGKEPRIYLELMRKI 199
           WSN++AF   +     +E    SCV  MF+YGFDGID+DWE+PK+D KEP++YL++++ +
Sbjct: 191 WSNREAFTSLVESPAKLEVFLDSCVSKMFEYGFDGIDIDWEFPKNDAKEPKVYLQMLKAL 250

Query: 200 RQHMNELEIAIWG--DKKRRFHLSVATPAFYDKLETFPIKEMDQYIDYWNMMTYDYYGEW 257
           R+ ++ LE  I+G  D K  F L+ A  A  + L+  P++E D+Y+DYWN+M YD+ G W
Sbjct: 251 RERLDTLESQIFGSKDHKHHFALTSAISADEECLKYLPLQEADRYVDYWNLMAYDFSGAW 310

Query: 258 SSGTGFHSNLYD--GTNKFSEHSL-CADGAIRYMTNKIGINSRKVVLGMALYGRGFTNVK 314
           S+ T + SNLY    TNK S +    AD A+R++T+K  + S+K+VLGM  YGRGF  V 
Sbjct: 311 SAQTAYQSNLYTPAKTNKRSTNGRGSADKAVRFLTDKSKLASKKIVLGMPAYGRGFKGV- 369

Query: 315 EGDPKKTSGLINRKFKGVGGESEGEPGMWLYNQLPIRGTQEVFDEQYGSAYCF----DPK 370
           E   K    +I + F+ V G SEGE G+ LY QLP++G  E FD    SAYC     + K
Sbjct: 370 EVSHKSIENVIGKPFQDVSGSSEGEEGISLYKQLPLKGGMEFFDHNAVSAYCVKLSHNKK 429

Query: 371 TKTLVGYDNVDSTRQKAQYVRFHNLAGGFWWESCGNKWDNVQQSLVHVFNEDIERLDRNE 430
              L+ YDNVDS  QKA YV  ++L GGFWWESCG  +    +SLV  F ++I+ L++ E
Sbjct: 430 QAELIVYDNVDSMIQKAHYVEKNHLGGGFWWESCGEDYKG--KSLVGAFTKEIKCLNKTE 487

Query: 431 TNLYQDPKLREHYLQIFAKSGFLAATFK 458
             +Y  P++ +HYL++    GFLA+TF+
Sbjct: 488 PTIYSLPEVVQHYLKLHP-GGFLASTFQ 514

>Kwal_55.21402 s55 complement(821930..823480) [1551 bp, 516 aa] {ON}
           YDR371W (CTS2) - chitinase [contig 130] FULL
          Length = 516

 Score =  334 bits (856), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 180/446 (40%), Positives = 268/446 (60%), Gaps = 45/446 (10%)

Query: 52  VSGVYYSDWSPYEPRMHFPKNIDTSKITHIYYSFFLVDADSSALKLGDSWSDIEMPM--- 108
            SG+YYS+WSPY+ R HFP +ID  ++T ++YSF +V+ ++   +L D WSD++M +   
Sbjct: 72  TSGIYYSNWSPYKARKHFPHDIDFRRLTEVFYSFLVVNGETGECQLSDEWSDVQMDLYKQ 131

Query: 109 -----------------GKNTVLKGCIGALNSLR-----------DEKPGFKNIMAVGGW 140
                             +N +  GCIG L  L+           ++   FK IM+VGGW
Sbjct: 132 MFSAFEKVDLKRQFPQSSRNDLPLGCIGELFYLKYTDFLSKMGGPEDVKNFKTIMSVGGW 191

Query: 141 SNKDAFPLALRKKHGVEKLAQSCVETMFQYGFDGIDLDWEYPKDDGKEPRIYLELMRKIR 200
           SN++AF   ++    ++    SCV+ MF+YGFDGID+DWE+PK+D  EP+ YL++MR +R
Sbjct: 192 SNREAFESLVQSPAKMKVFINSCVDQMFKYGFDGIDIDWEFPKNDSTEPKAYLDMMRSLR 251

Query: 201 QHMNELEIAIWGDKK--RRFHLSVATPAFYDKLETFPIKEMDQYIDYWNMMTYDYYGEWS 258
           + +++LE  I+G +K  + F L+ A  A    LE  P+ E+D+Y+D WN+M YD+ G WS
Sbjct: 252 KKLDDLESDIFGTEKHTQHFLLTSAISADPSCLEYLPLGEIDRYVDQWNLMAYDFSGAWS 311

Query: 259 SGTGFHSNLYDGTN--KFSEHSL--CADGAIRYMTNKIGINSRKVVLGMALYGRGFTNVK 314
             T + SNLY  ++  K SE+S    AD A+R + NK  + ++K+VLGM  YGRGF  V 
Sbjct: 312 RHTAYQSNLYSRSSLGKRSENSEGGSADTAVRLLLNKHKLPAKKIVLGMPAYGRGFKGVS 371

Query: 315 EGDPKKTS-GLINRKFKGVGGESEGEPGMWLYNQLPIRGTQEVFDEQYGSAYCF----DP 369
              P  +   +I + F+ V G SEGE G+ LYNQLP++G QE FD+   SAY      + 
Sbjct: 372 V--PHHSEHNVIGQSFQQVSGLSEGESGISLYNQLPLKGGQEWFDQDAVSAYSVKLASNK 429

Query: 370 KTKTLVGYDNVDSTRQKAQYVRFHNLAGGFWWESCGNKWDNVQQSLVHVFNEDIERLDRN 429
           +   LV YDNV S + KAQYV  +NL GGFWWESCG  + +  +SL   F ++I+ L++ 
Sbjct: 430 EMAELVVYDNVQSMKIKAQYVLKNNLGGGFWWESCGENYLDNSRSLTRAFTQEIKYLNKT 489

Query: 430 ETNLYQDPKLREHYLQIFAKSGFLAA 455
              +Y  P++ E+Y + +   GFLA+
Sbjct: 490 VPTIYALPQVGEYYHKKYP-DGFLAS 514

>KLLA0F00374g Chr6 complement(20124..22511) [2388 bp, 795 aa] {ON}
           weakly similar to uniprot|Q08886 Saccharomyces
           cerevisiae YOR371C GPB1 Proposed beta subunit of the
           heterotrimeric G protein that interacts with the
           receptor Grp1p has signaling role in response to
           nutrients involved in regulation of pseudohyphal growth
           through cAMP levels homolog of Gpb2p
          Length = 795

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 58/147 (39%), Gaps = 18/147 (12%)

Query: 205 ELEIAIWGDKKRRFHLSVATPAFYDKLETFPIKEMDQYIDYWNMMTYDYYGEWSSGTGFH 264
           ++E+ +    KR F L  A  A    +   P   +D+          DYY +W    GF 
Sbjct: 502 KVEVTVLSRGKRNF-LKFADTALVTIISRLPQNAVDE------AFLRDYYKKWPLPRGFM 554

Query: 265 SNLYDGTNKFSEHSLCADGAIRYMTN-KI--GINSRKVVLGMALYGRGFTNVKEGDPKKT 321
           ++    T+  S  S+ AD   R M N KI   IN   VV    + GR   +     PK+ 
Sbjct: 555 ASYVVDTDSLSPKSMDADLLDRLMHNFKIVDNINDEPVVNEPMIPGRTMNS--STSPKR- 611

Query: 322 SGLINRKFKGVGGESEG--EPGMWLYN 346
              +N+     GG +       MW Y+
Sbjct: 612 ---LNKSLIIHGGSANKFIHGDMWCYD 635

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.429 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,800,546
Number of extensions: 2534529
Number of successful extensions: 5357
Number of sequences better than 10.0: 23
Number of HSP's gapped: 5368
Number of HSP's successfully gapped: 24
Length of query: 458
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 345
Effective length of database: 40,524,141
Effective search space: 13980828645
Effective search space used: 13980828645
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)