Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0C038107.341ON82824143e-54
Kwal_YGOB_Anc_7.3417.341ON86831542e-14
Suva_4.847.341ON81791532e-14
NCAS0A140807.341ON78761514e-14
ZYRO0F11528g7.341ON121801526e-14
Smik_4.767.341ON80791444e-13
YDL160C-A (MHF2)7.341ON80791427e-13
KLTH0H01452g7.341ON86831421e-12
Kpol_530.377.341ON88821421e-12
Skud_4.957.341ON79781392e-12
TDEL0C020607.341ON88851375e-12
CAGL0I03432g7.341ON149821354e-11
KAFR0B009007.341ON78811298e-11
NDAI0A019507.341ON122851283e-10
SAKL0F10956g7.341ON86801263e-10
TPHA0F029107.341ON108981142e-08
KLLA0C16709g7.341ON79701123e-08
ACL158W7.341ON95841123e-08
Ecym_45207.341ON91841106e-08
TBLA0E004707.341ON1161031119e-08
KLTH0E06006g4.23ON81942730.062
KAFR0E016305.245ON78141603.7
Suva_12.1291.475ON63235577.7
KAFR0J027803.547ON790865610.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0C03810
         (82 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0C03810 Chr3 complement(748315..748563) [249 bp, 82 aa] {ON}...   164   3e-54
Kwal_YGOB_Anc_7.341 s56 (1073424..1073684) [261 bp, 86 aa] {ON} ...    64   2e-14
Suva_4.84 Chr4 complement(156977..157219) [243 bp, 81 aa] {ON} Y...    64   2e-14
NCAS0A14080 Chr1 (2768035..2768271) [237 bp, 78 aa] {ON}               63   4e-14
ZYRO0F11528g Chr6 (946636..947001) [366 bp, 121 aa] {ON} some si...    63   6e-14
Smik_4.76 Chr4 complement(146162..146401) [240 bp, 80 aa] {ON} Y...    60   4e-13
YDL160C-A Chr4 complement(169366..169608) [243 bp, 80 aa] {ON}  ...    59   7e-13
KLTH0H01452g Chr8 complement(134324..134584) [261 bp, 86 aa] {ON...    59   1e-12
Kpol_530.37 s530 complement(86462..86728) [267 bp, 88 aa] {ON} c...    59   1e-12
Skud_4.95 Chr4 complement(164983..165219) [237 bp, 79 aa] {ON} Y...    58   2e-12
TDEL0C02060 Chr3 complement(356665..356931) [267 bp, 88 aa] {ON}...    57   5e-12
CAGL0I03432g Chr9 complement(292162..292611) [450 bp, 149 aa] {O...    57   4e-11
KAFR0B00900 Chr2 complement(167674..167910) [237 bp, 78 aa] {ON}...    54   8e-11
NDAI0A01950 Chr1 (434811..435179) [369 bp, 122 aa] {ON} Anc_7.34...    54   3e-10
SAKL0F10956g Chr6 complement(858747..859007) [261 bp, 86 aa] {ON...    53   3e-10
TPHA0F02910 Chr6 (644434..644760) [327 bp, 108 aa] {ON} Anc_7.34...    49   2e-08
KLLA0C16709g Chr3 (1463056..1463295) [240 bp, 79 aa] {ON} conser...    48   3e-08
ACL158W Chr3 (78852..79139) [288 bp, 95 aa] {ON} Syntenic homolo...    48   3e-08
Ecym_4520 Chr4 (1036442..1036717) [276 bp, 91 aa] {ON} similar t...    47   6e-08
TBLA0E00470 Chr5 (86619..86969) [351 bp, 116 aa] {ON} Anc_7.341 ...    47   9e-08
KLTH0E06006g Chr5 complement(542954..545413) [2460 bp, 819 aa] {...    33   0.062
KAFR0E01630 Chr5 (332560..334905) [2346 bp, 781 aa] {ON} Anc_5.2...    28   3.7  
Suva_12.129 Chr12 (195713..197611) [1899 bp, 632 aa] {ON} YJR046...    27   7.7  
KAFR0J02780 Chr10 (529100..531472) [2373 bp, 790 aa] {ON} Anc_3....    26   10.0 

>KNAG0C03810 Chr3 complement(748315..748563) [249 bp, 82 aa] {ON}
          Anc_7.341 YDL160C-A
          Length = 82

 Score =  164 bits (414), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 82/82 (100%), Positives = 82/82 (100%)

Query: 1  MSAPGSIQISRETLSRILTQSFKNKSTTIDDQALTSVQKYVETYVQEIILRSLENKDLGV 60
          MSAPGSIQISRETLSRILTQSFKNKSTTIDDQALTSVQKYVETYVQEIILRSLENKDLGV
Sbjct: 1  MSAPGSIQISRETLSRILTQSFKNKSTTIDDQALTSVQKYVETYVQEIILRSLENKDLGV 60

Query: 61 NPAELTERDIERILGLLLLDMP 82
          NPAELTERDIERILGLLLLDMP
Sbjct: 61 NPAELTERDIERILGLLLLDMP 82

>Kwal_YGOB_Anc_7.341 s56 (1073424..1073684) [261 bp, 86 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 86

 Score = 63.9 bits (154), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 39/83 (46%), Positives = 55/83 (66%), Gaps = 11/83 (13%)

Query: 9  ISRETLSRIL-TQSFKNKSTTIDDQALTSVQKYVETYVQEIILRSLENKD---------L 58
          + ++T++RI  T SF+N ST I +  LT V +Y+E +V+E ILRS+ENKD         L
Sbjct: 5  VPKDTIARIFQTCSFQNDSTRITETTLTLVDEYLEIFVREAILRSIENKDQVKDEHQDQL 64

Query: 59 GVNPAELTERDIERILGLLLLDM 81
          G +   LT +D+ER+ GLLLLDM
Sbjct: 65 G-SQVVLTHKDLERVSGLLLLDM 86

>Suva_4.84 Chr4 complement(156977..157219) [243 bp, 81 aa] {ON}
          YDL160C-A (REAL)
          Length = 81

 Score = 63.5 bits (153), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 54/79 (68%), Gaps = 6/79 (7%)

Query: 9  ISRETLSRILTQSFKNKSTTIDDQALTSVQKYVETYVQEIILRSLE-NKDL-----GVNP 62
          + +E + +IL+Q+  +K+  IDD+ +  +QKY+E +++E  LRSL+ +KD      G  P
Sbjct: 3  LPKEAIIKILSQNNSDKNIKIDDKVIPMIQKYLEIFIEEAALRSLQSHKDSSGAHDGDGP 62

Query: 63 AELTERDIERILGLLLLDM 81
           EL+  D+ERI+GLLL+DM
Sbjct: 63 LELSHLDLERIVGLLLMDM 81

>NCAS0A14080 Chr1 (2768035..2768271) [237 bp, 78 aa] {ON}
          Length = 78

 Score = 62.8 bits (151), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 56/76 (73%), Gaps = 3/76 (3%)

Query: 9  ISRETLSRILT-QSFKNKSTTIDDQALTSVQKYVETYVQEIILRSLEN--KDLGVNPAEL 65
          I +ET+++IL  ++F+N  T + ++ L+ +Q+Y+E +++E + RSL+N  K+LG     +
Sbjct: 3  IPKETIAQILQLEAFENADTKMTEETLSMIQRYMELFIREAMCRSLDNKEKELGQTDIVI 62

Query: 66 TERDIERILGLLLLDM 81
           E+D+ER++GLLLLDM
Sbjct: 63 DEKDLERVVGLLLLDM 78

>ZYRO0F11528g Chr6 (946636..947001) [366 bp, 121 aa] {ON} some
           similarities with uniprot|Q3E829 Saccharomyces
           cerevisiae YDL160C-A Identified by homology to Ashbya
           gossypii
          Length = 121

 Score = 63.2 bits (152), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 54/80 (67%), Gaps = 7/80 (8%)

Query: 9   ISRETLSRILT-QSFKNKSTTIDDQALTSVQKYVETYVQEIILRSLENKDL------GVN 61
           + +ET+ RIL  Q+F+++STTI ++ +T +QKY+E +V+E + RS+ NKD       G  
Sbjct: 42  VPKETIVRILKLQAFEHESTTITEETVTMLQKYLEVFVREAVQRSVANKDSQGSHGDGDG 101

Query: 62  PAELTERDIERILGLLLLDM 81
             +L   D+E+I G+LLLDM
Sbjct: 102 EIQLNHEDLEKITGMLLLDM 121

>Smik_4.76 Chr4 complement(146162..146401) [240 bp, 80 aa] {ON}
          YDL160C-A (REAL)
          Length = 80

 Score = 60.1 bits (144), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 54/79 (68%), Gaps = 6/79 (7%)

Query: 9  ISRETLSRILTQSFKNKSTTIDDQALTSVQKYVETYVQEIILRSLE-NKDLG-----VNP 62
          +S+E L +IL+Q+   K   I D+ +  +QKY++ +++E  LRSL+ +KD+       +P
Sbjct: 2  LSKEALVKILSQNNCGKDIEISDEVIPMIQKYLDIFIEEAALRSLQSHKDINKEHDKKDP 61

Query: 63 AELTERDIERILGLLLLDM 81
           EL+ +D+ER++G+LL+DM
Sbjct: 62 LELSHQDLERVVGVLLMDM 80

>YDL160C-A Chr4 complement(169366..169608) [243 bp, 80 aa] {ON}
          MHF2Protein of unknown function; ortholog of human
          MHF2, and component of the heterotetrameric MHF
          histone-fold complex that in humans interacts with both
          DNA and Mph1p ortholog FANCM to stabilize and remodel
          blocked replication forks and repair damaged DNA; mhf2
          srs2 double mutants are MMS hypersensitive
          Length = 80

 Score = 59.3 bits (142), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 53/79 (67%), Gaps = 6/79 (7%)

Query: 9  ISRETLSRILTQSFKNKSTTIDDQALTSVQKYVETYVQEIILRSLE-NKDLG-----VNP 62
          +S+E L +IL+Q+       I D+ +  +QKY++ ++ E +LRSL+ +KD+       +P
Sbjct: 2  LSKEALIKILSQNEGGNDMKIADEVVPMIQKYLDIFIDEAVLRSLQSHKDINGERGDKSP 61

Query: 63 AELTERDIERILGLLLLDM 81
           EL+ +D+ERI+GLLL+DM
Sbjct: 62 LELSHQDLERIVGLLLMDM 80

>KLTH0H01452g Chr8 complement(134324..134584) [261 bp, 86 aa] {ON}
          weakly similar to uniprot|Q3E829 Saccharomyces
          cerevisiae YDL160c-a
          Length = 86

 Score = 59.3 bits (142), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/83 (44%), Positives = 53/83 (63%), Gaps = 11/83 (13%)

Query: 9  ISRETLSRIL-TQSFKNKSTTIDDQALTSVQKYVETYVQEIILRSLENKD---------L 58
          I  +T++RI  T SFK+ ST I +  L+ V  Y+E +V+E +LRS+ENK+         L
Sbjct: 5  IPSDTIARIFQTCSFKDDSTRITESTLSLVDAYLEVFVREALLRSIENKEQVKSEHQDQL 64

Query: 59 GVNPAELTERDIERILGLLLLDM 81
          G +   LT +D+ER+ GLLLLDM
Sbjct: 65 G-DQVVLTHKDLERVSGLLLLDM 86

>Kpol_530.37 s530 complement(86462..86728) [267 bp, 88 aa] {ON}
          complement(86462..86728) [267 nt, 89 aa]
          Length = 88

 Score = 59.3 bits (142), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 52/82 (63%), Gaps = 10/82 (12%)

Query: 9  ISRETLSRIL-TQSFKNKSTTIDDQALTSVQKYVETYVQEIILRSLENKD--------LG 59
          I +ET++R+L T SF++ ST I +  +  +QKY+E +V+E I+RS+E K          G
Sbjct: 7  IPKETIARLLETSSFEHSSTRITEDVVEGLQKYMELFVREAIMRSIETKAKLEEENSFTG 66

Query: 60 VNPAELTERDIERILGLLLLDM 81
          V   ELT  D+E I GLLLLDM
Sbjct: 67 VR-VELTHTDLEEIAGLLLLDM 87

>Skud_4.95 Chr4 complement(164983..165219) [237 bp, 79 aa] {ON}
          YDL160C-A (REAL)
          Length = 79

 Score = 58.2 bits (139), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 51/78 (65%), Gaps = 5/78 (6%)

Query: 9  ISRETLSRILTQSFKNKSTTIDDQALTSVQKYVETYVQEIILRSLEN-KDLGV----NPA 63
          +S++ L +IL+Q+   K   IDD+ L  +Q Y++ +++E  LRSL++ KD        P 
Sbjct: 2  LSKDALIKILSQNNFRKDIKIDDKVLPMIQNYLDIFIEEAALRSLQSQKDASGGHRDGPL 61

Query: 64 ELTERDIERILGLLLLDM 81
          EL+  D+ERI+GLLL+DM
Sbjct: 62 ELSHLDLERIVGLLLMDM 79

>TDEL0C02060 Chr3 complement(356665..356931) [267 bp, 88 aa] {ON}
          Anc_7.341 YDL160C-A
          Length = 88

 Score = 57.4 bits (137), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 50/85 (58%), Gaps = 11/85 (12%)

Query: 8  QISRETLSRIL-TQSFKNKSTTIDDQALTSVQKYVETYVQEIILRSLENKD--------- 57
          +I +ET++R     +F+N+ST I D+ +  +QKY+E +V+E +LRS  NK+         
Sbjct: 4  KIPKETIARTFQVGAFENESTNITDETVGMMQKYMEVFVREAVLRSSANKEQIKVEHSGA 63

Query: 58 -LGVNPAELTERDIERILGLLLLDM 81
              N   LT  D+E I GLLLLDM
Sbjct: 64 QRNSNEIVLTHEDLENITGLLLLDM 88

>CAGL0I03432g Chr9 complement(292162..292611) [450 bp, 149 aa] {ON}
           some similarities with KLLA0C16709g Kluyveromyces lactis
           and DEHA0G05016g Debaryomyces hansenii and CA5994|IPF677
           Candida albicans
          Length = 149

 Score = 56.6 bits (135), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 53/82 (64%), Gaps = 7/82 (8%)

Query: 7   IQISRETLSRIL-TQSFKNKSTTIDDQALTSVQKYVETYVQEIILRSLENKDL---GV-- 60
           + + ++T++R+L   +FK+K T I+   + ++Q+Y++ + +E +LRS+E+ D    G+  
Sbjct: 68  MDVPQDTIARVLQVAAFKDKKTRIESDVVDALQRYIDVFAREAVLRSIEHHDASQEGLEQ 127

Query: 61  -NPAELTERDIERILGLLLLDM 81
               E+T  D+E I GLLLLDM
Sbjct: 128 EQDKEITHTDLENIAGLLLLDM 149

>KAFR0B00900 Chr2 complement(167674..167910) [237 bp, 78 aa] {ON}
          Anc_7.341 YDL160C-A
          Length = 78

 Score = 54.3 bits (129), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 52/81 (64%), Gaps = 9/81 (11%)

Query: 7  IQISRETLSRILTQSFK--NKSTTIDDQALTSVQKYVETYVQEIILRSLENKDLGVNPAE 64
          + I +ET+SRIL        ++ +I+ + + SV KY +  ++E++LRSLENK+   N AE
Sbjct: 1  MSIPKETISRILLNKLNENGENFSINTETVESVTKYTDVLIEEMVLRSLENKE---NIAE 57

Query: 65 LTER----DIERILGLLLLDM 81
           T      D+E+I+GLLLLDM
Sbjct: 58 ATPTLDVDDLEKIIGLLLLDM 78

>NDAI0A01950 Chr1 (434811..435179) [369 bp, 122 aa] {ON} Anc_7.341
           YDL160C-A
          Length = 122

 Score = 53.9 bits (128), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 52/85 (61%), Gaps = 15/85 (17%)

Query: 12  ETLSRIL-TQSFKNKSTTIDDQALTSVQKYVETYVQEIILRSLENK-------------- 56
           ET+ +IL ++SF+NK TTI  + +  +Q+Y++ +++E ++RS ENK              
Sbjct: 38  ETIEKILRSESFQNKDTTITKETILMIQRYMDLFIKEAVIRSYENKVATQVEDFDDEEDA 97

Query: 57  DLGVNPAELTERDIERILGLLLLDM 81
           D      ELT  D+ERI+GLLL+++
Sbjct: 98  DEEDKTIELTHLDLERIVGLLLMEL 122

>SAKL0F10956g Chr6 complement(858747..859007) [261 bp, 86 aa] {ON}
          similar to uniprot|Q3E829 Saccharomyces cerevisiae
          YDL160C-A Putative protein of unknown function
          Length = 86

 Score = 53.1 bits (126), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 47/80 (58%), Gaps = 10/80 (12%)

Query: 11 RETLSRIL-TQSFKNKSTTIDDQALTSVQKYVETYVQEIILRSLENKDLGVNPAE----- 64
          ++T++RI  T SF   ST I +  +    KY+E +V+E +LRSLENK+  V P       
Sbjct: 8  KDTIARIFQTCSFTQDSTRITEDTVALTNKYIELFVREAVLRSLENKE-KVKPETESLDN 66

Query: 65 ---LTERDIERILGLLLLDM 81
             L+  D+E I GLLLLDM
Sbjct: 67 GTVLSHEDLEEISGLLLLDM 86

>TPHA0F02910 Chr6 (644434..644760) [327 bp, 108 aa] {ON} Anc_7.341
           YDL160C-A
          Length = 108

 Score = 48.5 bits (114), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 51/98 (52%), Gaps = 25/98 (25%)

Query: 9   ISRETLSRILTQSFKNKSTTIDDQALTSVQKYVETYVQEIILRSLENKD--------LGV 60
           I ++T++RIL      + T I  +++  +QKY+E +V+E +LRS+EN++        L  
Sbjct: 10  IPKDTIARILQLESFGEETRISAESVGILQKYMELFVREAVLRSIENREQKQSNIEALKK 69

Query: 61  NPA-----------------ELTERDIERILGLLLLDM 81
            PA                 ELT  D+E I GLLLLDM
Sbjct: 70  APAKANPDQLQTFQHSFNGIELTHEDLEEISGLLLLDM 107

>KLLA0C16709g Chr3 (1463056..1463295) [240 bp, 79 aa] {ON}
          conserved hypothetical protein
          Length = 79

 Score = 47.8 bits (112), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 46/70 (65%), Gaps = 1/70 (1%)

Query: 13 TLSRIL-TQSFKNKSTTIDDQALTSVQKYVETYVQEIILRSLENKDLGVNPAELTERDIE 71
          T++RIL T+ F++ +T I ++ +  ++ Y+E +V+E +LRSLENK   +    +   D+E
Sbjct: 9  TIARILQTEGFQDSNTRITEECMQLLEPYIELFVREGVLRSLENKADMLADKTVDFVDLE 68

Query: 72 RILGLLLLDM 81
           + GLLL+D 
Sbjct: 69 AVAGLLLMDF 78

>ACL158W Chr3 (78852..79139) [288 bp, 95 aa] {ON} Syntenic homolog
          of Saccharomyces cerevisiae YDL161CX; YDL161CX was
          overlooked in Saccharomyces cerevisiae
          Length = 95

 Score = 47.8 bits (112), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 48/84 (57%), Gaps = 12/84 (14%)

Query: 9  ISRETLSRIL-TQSFKNKSTTIDDQALTSVQKYVETYVQEIILRSLENKD---------- 57
          I  +T++R+  T SF   ST I + A+T V++Y++ +++E +LRSLENK+          
Sbjct: 13 IPTDTIARLFHTCSFTQDSTKITEDAVTLVERYMKLFIREAVLRSLENKEKVKQETRADS 72

Query: 58 LGVNPAELTERDIERILGLLLLDM 81
              P  L   D+E I G+L+LD 
Sbjct: 73 FAEGPV-LQHTDLEEISGVLILDF 95

>Ecym_4520 Chr4 (1036442..1036717) [276 bp, 91 aa] {ON} similar to
          Ashbya gossypii ACL158W
          Length = 91

 Score = 47.0 bits (110), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 46/84 (54%), Gaps = 12/84 (14%)

Query: 9  ISRETLSRILT-QSFKNKSTTIDDQALTSVQKYVETYVQEIILRSLENKD---------- 57
          +  +T++RI    SF   ST I +  +T  +KY++ +V+E +LRSLENKD          
Sbjct: 9  VPSDTIARIFQLCSFTQDSTRITEDTITLTEKYIKLFVREAVLRSLENKDKVKKEDGKGS 68

Query: 58 LGVNPAELTERDIERILGLLLLDM 81
          L   P  L   D+E I G+LLLD 
Sbjct: 69 LIEGPV-LHHTDLEEISGILLLDF 91

>TBLA0E00470 Chr5 (86619..86969) [351 bp, 116 aa] {ON} Anc_7.341
           YDL160C-A
          Length = 116

 Score = 47.4 bits (111), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 53/103 (51%), Gaps = 28/103 (27%)

Query: 7   IQISRETLSRIL-TQSFKNKSTTIDDQALTSVQKYVETYVQEIILRSLENKDLGVN---- 61
           +++   T++RIL T SF +++T I    +T +QKY+E +++E  LRSLENK+  ++    
Sbjct: 14  VKLPENTIARILQTSSFVDENTRITKNTVTKLQKYMELFIREAALRSLENKEEQISNEKS 73

Query: 62  -----PA------------------ELTERDIERILGLLLLDM 81
                P                   EL+   +E I GLLLLDM
Sbjct: 74  AVKNEPGLEDTKIFNDNNKLNDNDIELSHEALEAITGLLLLDM 116

>KLTH0E06006g Chr5 complement(542954..545413) [2460 bp, 819 aa] {ON}
           highly similar to uniprot|Q07844 Saccharomyces
           cerevisiae YLL034C RIX7 Putative ATPase of the AAA
           family required for export of pre-ribosomal large
           subunits from the nucleus distributed between the
           nucleolus nucleoplasm and nuclear periphery depending on
           growth conditions
          Length = 819

 Score = 32.7 bits (73), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 27/42 (64%)

Query: 3   APGSIQISRETLSRILTQSFKNKSTTIDDQALTSVQKYVETY 44
           AP S+++  ETL+   +Q  KN    ID   L++VQK+++++
Sbjct: 437 APTSMEVDDETLTSDGSQEPKNTVNMIDPLPLSTVQKFIQSF 478

>KAFR0E01630 Chr5 (332560..334905) [2346 bp, 781 aa] {ON} Anc_5.245
           YJL029C
          Length = 781

 Score = 27.7 bits (60), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 5/41 (12%)

Query: 7   IQISRETLSRILTQSFKNKSTTID-----DQALTSVQKYVE 42
            QI+R+ L  +L + FKNK  +ID      QA    +KY++
Sbjct: 283 FQITRKDLKLLLNKEFKNKQPSIDLFMTALQATIDFEKYID 323

>Suva_12.129 Chr12 (195713..197611) [1899 bp, 632 aa] {ON} YJR046W
           (REAL)
          Length = 632

 Score = 26.6 bits (57), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 22/35 (62%)

Query: 33  ALTSVQKYVETYVQEIILRSLENKDLGVNPAELTE 67
           +LTS Q Y ETY+  +++ SL++ +  +   E +E
Sbjct: 543 SLTSGQPYTETYLGSLVVDSLQDSNNPIGSKEASE 577

>KAFR0J02780 Chr10 (529100..531472) [2373 bp, 790 aa] {ON} Anc_3.547
           YGL229C
          Length = 790

 Score = 26.2 bits (56), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 19/86 (22%), Positives = 44/86 (51%), Gaps = 4/86 (4%)

Query: 1   MSAPGSIQISRETL--SRILTQSFKNKSTTIDDQALTSVQKYVETYVQEIILRSLENKDL 58
           +SA    ++++E L  +R+++       + +DD     + ++    + + I++S  ++ +
Sbjct: 705 LSADKWHELAQEILHNTRLMSSQILGGGSYVDDGNGNLIPQFSNLSLNQGIVQSNSDESI 764

Query: 59  G--VNPAELTERDIERILGLLLLDMP 82
               N   LTE D+  ++G L LD+P
Sbjct: 765 NDLSNAKTLTELDLHNMIGRLFLDIP 790

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.339 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,608,609
Number of extensions: 254196
Number of successful extensions: 932
Number of sequences better than 10.0: 31
Number of HSP's gapped: 915
Number of HSP's successfully gapped: 31
Length of query: 82
Length of database: 53,481,399
Length adjustment: 54
Effective length of query: 28
Effective length of database: 47,289,435
Effective search space: 1324104180
Effective search space used: 1324104180
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 59 (27.3 bits)