Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0C038007.342ON44744714350.0
NCAS0H006707.342ON4831436332e-76
Skud_4.947.342ON4472436274e-76
Suva_4.837.342ON4622436276e-76
CAGL0A03872g7.342ON5101436263e-75
YDL161W (ENT1)7.342ON4542436206e-75
Smik_4.757.342ON4602436199e-75
TDEL0C020507.342ON5012436211e-74
Skud_12.2707.342ON6261426133e-72
Smik_12.2647.342ON6121426115e-72
YLR206W (ENT2)7.342ON6131416072e-71
Suva_10.3007.342ON6181426054e-71
ZYRO0F11550g7.342ON5382425971e-70
KAFR0B008907.342ON4141415862e-70
Kpol_2001.707.342ON5332415751e-67
SAKL0F10934g7.342ON4981715722e-67
TBLA0E004807.342ON5991465764e-67
NDAI0D006107.342ON4861765633e-66
TPHA0D045607.342ON4872455503e-64
Kwal_56.246107.342ON5081715427e-63
KLLA0C16731g7.342ON4781425311e-61
KAFR0L014607.342ON5501315324e-61
KLTH0H01430g7.342ON5021315085e-58
Ecym_47317.342ON5141444675e-52
TBLA0E020407.342ON7011434474e-48
KNAG0B026507.342ON6461414455e-48
ACL157C7.342ON5151284186e-45
Suva_12.2164.346ON4101392511e-22
Kwal_47.168574.346ON3821392482e-22
Kpol_1001.24.346ON4181392492e-22
NDAI0D032004.346ON4351392493e-22
TBLA0E047604.346ON4261392483e-22
TDEL0D007104.346ON3751392464e-22
KLTH0D16896g4.346ON4011392455e-22
KLLA0B04587g4.346ON4001392456e-22
SAKL0G17952g4.346ON4151392448e-22
Skud_10.3494.346ON4101392449e-22
YJR125C (ENT3)4.346ON4081392431e-21
Smik_10.4184.346ON4091392421e-21
NCAS0A062104.346ON4231392394e-21
KNAG0M003804.346ON4031392394e-21
ZYRO0B14784g4.346ON4241392379e-21
KAFR0B067404.346ON3991392369e-21
TPHA0B004004.346ON3991392271e-19
AER155C4.346ON3641392208e-19
CAGL0H04323g4.346ON4121392201e-18
Ecym_11334.346ON3921392092e-17
Kwal_55.206114.17ON2541461787e-14
TDEL0G017404.17ON2571461663e-12
SAKL0H25762g4.17ON2621471531e-10
KLTH0E05874g4.17ON2551461494e-10
Kpol_388.54.17ON2681441451e-09
Suva_10.354.17ON2471341352e-08
TPHA0F002304.17ON2801451327e-08
Ecym_84074.17ON2541351317e-08
ZYRO0G07876g4.17ON2591371282e-07
TBLA0B062204.346ON3391401292e-07
TBLA0G006504.17ON4231461293e-07
ACL061C4.17ON2341351192e-06
Skud_12.304.17ON2471341183e-06
Suva_7.5335.84ON5601251196e-06
KLLA0D03949g4.17ON2251421112e-05
YHR161C (YAP1801)5.84ON637961134e-05
NCAS0C058404.17ON2671391095e-05
CAGL0E03806g4.17ON2601171078e-05
Skud_8.2255.84ON621941081e-04
NDAI0H002804.17ON3101531052e-04
SAKL0H02530g5.84ON669971063e-04
KAFR0I014604.17ON2751551033e-04
NDAI0J009308.335ON4181691043e-04
Suva_7.536singletonON2781251025e-04
Smik_12.194.17ON247113999e-04
Smik_8.2455.84ON627961000.001
NCAS0B036608.335ON416169990.002
YLL038C (ENT4)4.17ON247114950.003
Skud_7.5755.84ON566125940.005
TBLA0B057705.84ON680123910.015
Kpol_344.88.335ON384169880.026
KLLA0D16654g8.335ON399166880.030
TDEL0G010805.84ON515124870.041
ZYRO0F13508g5.84ON68772870.043
KAFR0B058008.335ON382169860.044
YGR241C (YAP1802)5.84ON568124870.046
KLTH0G11902g8.335ON399174860.047
Smik_16.655.84ON56589860.053
Kwal_YGOB_27.112618.335ON404171860.057
NDAI0A028305.84ON473121850.066
ZYRO0F13684g8.335ON407170850.074
KNAG0A051008.335ON421168830.11
TBLA0A040408.335ON415166830.13
CAGL0E01199g8.335ON412169820.15
NCAS0E038205.84ON42890800.30
Kwal_27.11263singletonOFF275171770.53
KNAG0E006105.84ON60413714.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0C03800
         (447 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.3...   557   0.0  
NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342    248   2e-76
Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W (...   246   4e-76
Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W (...   246   6e-76
CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {...   245   3e-75
YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}  ENT1Epsin-...   243   6e-75
Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W (...   243   9e-75
TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.3...   243   1e-74
Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206...   240   3e-72
Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206...   239   5e-72
YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}  ENT2Epsin...   238   2e-71
Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206...   237   4e-71
ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {...   234   1e-70
KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.3...   230   2e-70
Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa] ...   226   1e-67
SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some s...   224   2e-67
TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}...   226   4e-67
NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.3...   221   3e-66
TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {O...   216   3e-64
Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]...   213   7e-63
KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]...   209   1e-61
KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {...   209   4e-61
KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some s...   200   5e-58
Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar...   184   5e-52
TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {O...   176   4e-48
KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.3...   176   5e-48
ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON} Syn...   165   6e-45
Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {...   101   1e-22
Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125...   100   2e-22
Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..931...   100   2e-22
NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {O...   100   3e-22
TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa] ...   100   3e-22
TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.3...    99   4e-22
KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]...    99   5e-22
KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} simila...    99   6e-22
SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]...    99   8e-22
Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {...    99   9e-22
YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON} ...    98   1e-21
Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {...    98   1e-21
NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa] ...    97   4e-21
KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.34...    97   4e-21
ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]...    96   9e-21
KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON} Anc_4...    96   9e-21
TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346...    92   1e-19
AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON} S...    89   8e-19
CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} simila...    89   1e-18
Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar t...    85   2e-17
Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {O...    73   7e-14
TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17...    69   3e-12
SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some ...    64   1e-10
KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {O...    62   4e-10
Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON} c...    60   1e-09
Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON} ...    57   2e-08
TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON} ...    55   7e-08
Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to...    55   7e-08
ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {O...    54   2e-07
TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON} Anc_4...    54   2e-07
TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.1...    54   3e-07
ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON} Sy...    50   2e-06
Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON} ...    50   3e-06
Suva_7.533 Chr7 complement(929391..929933,930519..931655) [1680 ...    50   6e-06
KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar...    47   2e-05
YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}  ...    48   4e-05
NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4....    47   5e-05
CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar...    46   8e-05
Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON...    46   1e-04
NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON} ...    45   2e-04
SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly...    45   3e-04
KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17...    44   3e-04
NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8....    45   3e-04
Suva_7.536 Chr7 complement(930822..931655) [834 bp, 278 aa] {ON}...    44   5e-04
Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON} ...    43   9e-04
Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON...    43   0.001
NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {O...    43   0.002
YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}  EN...    41   0.003
Skud_7.575 Chr7 complement(949623..951323) [1701 bp, 566 aa] {ON...    41   0.005
TBLA0B05770 Chr2 complement(1364772..1366814) [2043 bp, 680 aa] ...    40   0.015
Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON} ...    39   0.026
KLLA0D16654g Chr4 complement(1413507..1414706) [1200 bp, 399 aa]...    39   0.030
TDEL0G01080 Chr7 (220997..222544) [1548 bp, 515 aa] {ON} Anc_5.8...    38   0.041
ZYRO0F13508g Chr6 complement(1114200..1116263) [2064 bp, 687 aa]...    38   0.043
KAFR0B05800 Chr2 complement(1200666..1201814) [1149 bp, 382 aa] ...    38   0.044
YGR241C Chr7 complement(974875..976581) [1707 bp, 568 aa] {ON}  ...    38   0.046
KLTH0G11902g Chr7 (1002588..1003787) [1200 bp, 399 aa] {ON} simi...    38   0.047
Smik_16.65 Chr16 (120202..121899) [1698 bp, 565 aa] {ON} YGR241C...    38   0.053
Kwal_YGOB_27.11261 s27 complement(716644..717033,717035..717859)...    38   0.057
NDAI0A02830 Chr1 (636619..638040) [1422 bp, 473 aa] {ON} Anc_5.8...    37   0.066
ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]...    37   0.074
KNAG0A05100 Chr1 (744989..746254) [1266 bp, 421 aa] {ON} Anc_8.3...    37   0.11 
TBLA0A04040 Chr1 complement(1004703..1005950) [1248 bp, 415 aa] ...    37   0.13 
CAGL0E01199g Chr5 (108041..109279) [1239 bp, 412 aa] {ON} simila...    36   0.15 
NCAS0E03820 Chr5 (750631..751917) [1287 bp, 428 aa] {ON} Anc_5.8...    35   0.30 
Kwal_27.11263 s27 complement(717032..717859) [828 bp, 275 aa] {O...    34   0.53 
KNAG0E00610 Chr5 complement(102826..104640) [1815 bp, 604 aa] {O...    32   4.1  

>KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.342
           YLR206W
          Length = 447

 Score =  557 bits (1435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/447 (65%), Positives = 294/447 (65%)

Query: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60
           MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN
Sbjct: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60

Query: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120
           DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV
Sbjct: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120

Query: 121 KAKELTSLLMDEERLKEERAMNIXXXXXXXXXXXXXXXXXXXXDEDLQRAIXXXXXXXXX 180
           KAKELTSLLMDEERLKEERAMNI                    DEDLQRAI         
Sbjct: 121 KAKELTSLLMDEERLKEERAMNIRRRGGPKRRSGGSRERNNRSDEDLQRAIEESKRTAEE 180

Query: 181 XXXXXXXXXXXXXDRQAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPMYYDVFGNPIT 240
                        DRQAA                              PMYYDVFGNPIT
Sbjct: 181 EERRRRNGASSEADRQAALQLSREEEDLRRLQEQARLAQQQQQQQQQQPMYYDVFGNPIT 240

Query: 241 PEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLPTGSN 300
           PEE                                                  TLPTGSN
Sbjct: 241 PEEYLQFQQQQALLAQQQQQQAALEQQYWAQQQQNMLAQQQQQQQPLYGIQQQTLPTGSN 300

Query: 301 NPFALNNXXXXXXXXXXXXXXXXXIETPATQTKPLTQTRSGNQAISDKYSALNNLLASGT 360
           NPFALNN                 IETPATQTKPLTQTRSGNQAISDKYSALNNLLASGT
Sbjct: 301 NPFALNNATQPSAPASTTAARPAAIETPATQTKPLTQTRSGNQAISDKYSALNNLLASGT 360

Query: 361 GIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVNNDDKPNPFLNGQYTGLPSTNIVPTQ 420
           GIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVNNDDKPNPFLNGQYTGLPSTNIVPTQ
Sbjct: 361 GIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVNNDDKPNPFLNGQYTGLPSTNIVPTQ 420

Query: 421 TGFGFGNQAXXXXXXXXXXXXXXLVDL 447
           TGFGFGNQA              LVDL
Sbjct: 421 TGFGFGNQANSSGTNNNNNNNGTLVDL 447

>NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342
          Length = 483

 Score =  248 bits (633), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 134/143 (93%)

Query: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60
            +RSAKN+VKGYS T+VLVRDAT+N+++NPS ELL +LA +S++SV+FFEI+DMLDKR+N
Sbjct: 5   FVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLDKRLN 64

Query: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120
           DKGKYWRHVAK+LTVLDYLVRFGSENCV+WC+ENLYIIKTLREF HED GG D+G+IIRV
Sbjct: 65  DKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQIIRV 124

Query: 121 KAKELTSLLMDEERLKEERAMNI 143
           KAKELTSLL+DEERLKEER +N+
Sbjct: 125 KAKELTSLLLDEERLKEERTINL 147

 Score =  172 bits (437), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 93/139 (66%), Positives = 100/139 (71%), Gaps = 6/139 (4%)

Query: 295 LPTGSNNPFALNN------XXXXXXXXXXXXXXXXXIETPATQTKPLTQTRSGNQAISDK 348
           L TGSNNPFA+NN                             Q +PL QTR+GNQ+I+DK
Sbjct: 320 LQTGSNNPFAMNNFNNKPAVESTQAYTASAPQLNQQPAQQQPQQQPLKQTRTGNQSITDK 379

Query: 349 YSALNNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVNNDDKPNPFLNGQY 408
           YS LN LLA+GTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQV ND K NPFLN QY
Sbjct: 380 YSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTNDPKNNPFLNSQY 439

Query: 409 TGLPSTNIVPTQTGFGFGN 427
           TGLPSTNIV TQTG+GFGN
Sbjct: 440 TGLPSTNIVSTQTGYGFGN 458

>Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W
           (REAL)
          Length = 447

 Score =  246 bits (627), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 126/243 (51%), Positives = 154/243 (63%), Gaps = 5/243 (2%)

Query: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60
            +RSAKN+VKGYS T+VLVR+AT+N++   S++ L +LA+KSY+S +FFEI+DMLDKR+N
Sbjct: 5   FVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDKRLN 64

Query: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120
           DKGKYWRH+AKALTVLDYL+RFGSENCV+WC+ENLYIIKTL+EF HED  G D+G+I+RV
Sbjct: 65  DKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGVDQGQIVRV 124

Query: 121 KAKELTSLLMDEERLKEERAMNIXXXXXXXXXXXXXXXXXXXXDEDLQRAIXXXXXXXXX 180
           KAKELT+LL D+ERL EER MNI                    D+DLQRAI         
Sbjct: 125 KAKELTTLLSDDERLNEERNMNI-KGRSRKGRKRRGTGRNDEDDDDLQRAI----DASRM 179

Query: 181 XXXXXXXXXXXXXDRQAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPMYYDVFGNPIT 240
                        D + A                              PMYYD+FGNPIT
Sbjct: 180 TAEEDERRRKQDEDYETALQLSKEEEELKRLQDLQRMQQVHAQQQQQQPMYYDIFGNPIT 239

Query: 241 PEE 243
           PEE
Sbjct: 240 PEE 242

 Score =  177 bits (449), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 112/197 (56%), Gaps = 36/197 (18%)

Query: 230 MYYDVFGNPITPEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 289
           MYYDVFGNPI+PEE                                              
Sbjct: 265 MYYDVFGNPISPEELAHFQQQQYIASLQQQQQ---------------------------- 296

Query: 290 XXXXTLPTGSNNPFALNNXXXXXXXXXXXXXXXXXIETPATQTKPLTQTRSGNQAISDKY 349
                +P  SNNPFA  N                 ++    Q +PLTQTR+GNQ+++DKY
Sbjct: 297 -----VP--SNNPFAKPNQEVTSQKQDQSFMASSSMQQ-QQQQQPLTQTRTGNQSMTDKY 348

Query: 350 SALNNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVNNDDKPNPFLNGQYT 409
             LN LLA+GTGIDTFGN G+ R+PAQHT+TGTFINSQGTGYRQV+ND K NPFLN QYT
Sbjct: 349 GKLNELLATGTGIDTFGNVGDSRVPAQHTKTGTFINSQGTGYRQVSNDPKQNPFLNSQYT 408

Query: 410 GLPSTNIVPTQTGFGFG 426
           GLPSTNIVPTQTG+GFG
Sbjct: 409 GLPSTNIVPTQTGYGFG 425

>Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W
           (REAL)
          Length = 462

 Score =  246 bits (627), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 126/243 (51%), Positives = 154/243 (63%), Gaps = 5/243 (2%)

Query: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60
           ++RSAKN+VKGYS T+VLVR+AT+N++   S++ L +LA+KSY+S +FFEI+DMLDKR+N
Sbjct: 5   LVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLDKRLN 64

Query: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120
           DKGKYWRH+AKALTVLDYL+RFGSENCV+WC+ENLYIIKTL+EF H+D  G D+G+I+RV
Sbjct: 65  DKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQIVRV 124

Query: 121 KAKELTSLLMDEERLKEERAMNIXXXXXXXXXXXXXXXXXXXXDEDLQRAIXXXXXXXXX 180
           KAKELTSLL DEERL EER MNI                    D+DLQRAI         
Sbjct: 125 KAKELTSLLSDEERLNEERNMNI-KGRNRGGRRRRRTNRSSEDDDDLQRAI----DASRM 179

Query: 181 XXXXXXXXXXXXXDRQAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPMYYDVFGNPIT 240
                        D + A                              PMY D+FGNPIT
Sbjct: 180 TADEDERRRKQDEDYETALQLSKEEEELKRLQDLQRIQAQQQQQQQQQPMYCDIFGNPIT 239

Query: 241 PEE 243
           PEE
Sbjct: 240 PEE 242

 Score =  167 bits (423), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 87/96 (90%)

Query: 333 KPLTQTRSGNQAISDKYSALNNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYR 392
           +PLTQTR+GNQ+++DKYS LN LL +GTGIDTFGN G+ R+PAQHT+TGTFINSQGTGYR
Sbjct: 347 EPLTQTRTGNQSMTDKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYR 406

Query: 393 QVNNDDKPNPFLNGQYTGLPSTNIVPTQTGFGFGNQ 428
           QV+ND K NPFLN QYTGLPSTN+VP QTG+GFGNQ
Sbjct: 407 QVSNDPKHNPFLNSQYTGLPSTNVVPAQTGYGFGNQ 442

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 11/13 (84%), Positives = 13/13 (100%)

Query: 229 PMYYDVFGNPITP 241
           PMYYD+FGNPI+P
Sbjct: 267 PMYYDMFGNPISP 279

>CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|Q05785 Saccharomyces
           cerevisiae YLR206w ENT2
          Length = 510

 Score =  245 bits (626), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 134/143 (93%), Gaps = 1/143 (0%)

Query: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60
           ++RSAKN+VKGYS T+V+VRDATAN+ST+PS  +L+DLADK+Y++VEFFEI+DMLDKR+N
Sbjct: 5   LVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRLN 64

Query: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHED-AGGEDEGKIIR 119
           DKGKYWRHVAK+LTVLDYLVRFGSENCV+WC+ENLYIIKTLREF HED   G DEG+IIR
Sbjct: 65  DKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEGQIIR 124

Query: 120 VKAKELTSLLMDEERLKEERAMN 142
           VKAKELTSLL D+ERL+EERA+N
Sbjct: 125 VKAKELTSLLTDDERLREERALN 147

 Score =  161 bits (407), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 74/90 (82%), Positives = 83/90 (92%)

Query: 337 QTRSGNQAISDKYSALNNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVNN 396
           +TR+GNQ+ISDKYS LNNLLASGTGIDTFGNTGE RIPAQHT+TGTFINSQGTGY+QV N
Sbjct: 360 KTRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTN 419

Query: 397 DDKPNPFLNGQYTGLPSTNIVPTQTGFGFG 426
           + K NPFL+ QYTGLPSTNIVP+ TG+GFG
Sbjct: 420 EPKNNPFLSSQYTGLPSTNIVPSHTGYGFG 449

>YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}
           ENT1Epsin-like protein involved in endocytosis and actin
           patch assembly and functionally redundant with Ent2p;
           binds clathrin via a clathrin-binding domain motif at
           C-terminus
          Length = 454

 Score =  243 bits (620), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 125/243 (51%), Positives = 154/243 (63%), Gaps = 5/243 (2%)

Query: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60
            +RSAKN+VKGYS T+VLVR+AT+N++   S++ L +LA+KSY+S +FFEI+DMLDKR+N
Sbjct: 5   FVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDKRLN 64

Query: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120
           DKGKYWRH+AKALTV+DYL+RFGSENCV+WC+ENLYIIKTL+EF HED  G D+G+I+RV
Sbjct: 65  DKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQIVRV 124

Query: 121 KAKELTSLLMDEERLKEERAMNIXXXXXXXXXXXXXXXXXXXXDEDLQRAIXXXXXXXXX 180
           KAKELT+LL D+ERL EER MNI                    D+DLQRAI         
Sbjct: 125 KAKELTALLSDDERLNEERNMNI-KGRNRKGRRRRGTGRSDENDDDLQRAI----SASRL 179

Query: 181 XXXXXXXXXXXXXDRQAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPMYYDVFGNPIT 240
                        D + A                              PMYYD+FGNPIT
Sbjct: 180 TAEEDERRRKQDEDYETALQLSKEEEELKRLQDLQRMQQQQGQQQLQQPMYYDIFGNPIT 239

Query: 241 PEE 243
           PEE
Sbjct: 240 PEE 242

 Score =  159 bits (401), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 83/93 (89%)

Query: 333 KPLTQTRSGNQAISDKYSALNNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYR 392
           +PL Q R+GNQ+++DKYS LN LLA+GTGIDTFGN GE RIPAQHT+TGTFINSQGTGYR
Sbjct: 339 EPLIQNRTGNQSMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYR 398

Query: 393 QVNNDDKPNPFLNGQYTGLPSTNIVPTQTGFGF 425
           QV++D   NPFLN QYTGLPST++VPTQTG+GF
Sbjct: 399 QVSDDPNHNPFLNSQYTGLPSTSVVPTQTGYGF 431

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 13/13 (100%), Positives = 13/13 (100%)

Query: 229 PMYYDVFGNPITP 241
           PMYYDVFGNPITP
Sbjct: 263 PMYYDVFGNPITP 275

>Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W
           (REAL)
          Length = 460

 Score =  243 bits (619), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 123/243 (50%), Positives = 152/243 (62%), Gaps = 5/243 (2%)

Query: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60
            +RSAKN+VKGYS T+VLVR+AT+N++   S++ L +LA+KSY+S +FFEI+DMLDKR+N
Sbjct: 5   FVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDKRLN 64

Query: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120
           DKGKYWRH+AKALTVLDYL+RFGSENCV+WC+ENLYIIKTL+EF HED  G D+G+I+RV
Sbjct: 65  DKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQIVRV 124

Query: 121 KAKELTSLLMDEERLKEERAMNIXXXXXXXXXXXXXXXXXXXXDEDLQRAIXXXXXXXXX 180
           K+KELT+LL D+ERL EER MNI                    D DLQRA+         
Sbjct: 125 KSKELTALLSDDERLNEERNMNIKGRNRKGRSRRGTGRSSNDNDNDLQRALDASRMTAEE 184

Query: 181 XXXXXXXXXXXXXDRQAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPMYYDVFGNPIT 240
                          Q +                              PMYYD+FGNPIT
Sbjct: 185 DEKRRKMDEDYETALQLS-----KEEEELKRLQDLQRMQQLQTQQQQQPMYYDIFGNPIT 239

Query: 241 PEE 243
           PEE
Sbjct: 240 PEE 242

 Score =  165 bits (417), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 73/94 (77%), Positives = 88/94 (93%)

Query: 333 KPLTQTRSGNQAISDKYSALNNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYR 392
           +PLTQTR+GNQ+++DKY+ LN LLA+GTGIDTFGN G+ R+PAQHT+TGTFINSQGTGY+
Sbjct: 345 EPLTQTRTGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYK 404

Query: 393 QVNNDDKPNPFLNGQYTGLPSTNIVPTQTGFGFG 426
           QV+ND K NPFL+GQYTGLPSTN+VPTQTG+GFG
Sbjct: 405 QVSNDPKYNPFLSGQYTGLPSTNVVPTQTGYGFG 438

 Score = 38.5 bits (88), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 15/15 (100%)

Query: 229 PMYYDVFGNPITPEE 243
           P+YYDVFGNPITPEE
Sbjct: 264 PLYYDVFGNPITPEE 278

>TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.342
           YLR206W
          Length = 501

 Score =  243 bits (621), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 125/243 (51%), Positives = 153/243 (62%), Gaps = 2/243 (0%)

Query: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60
            +RSAKN+VKGYS  +VLVR+ATAN S  PS + LD+LA+K+Y+SVEFFEI+DM+DKR+N
Sbjct: 5   FVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRLN 64

Query: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120
           DKGKYWRH+AK+LTVLDYLVRFGSENCV+WC+ENLY+IKTL EF ++D GG D+G+IIRV
Sbjct: 65  DKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNDDDGGVDQGQIIRV 124

Query: 121 KAKELTSLLMDEERLKEERAMNIXXXXXXXXXXXXXXXXXXXXDEDLQRAIXXXXXXXXX 180
           KAKELT+LL D+ERL+EER MN                     D+DLQRA+         
Sbjct: 125 KAKELTNLLSDDERLREEREMNRKGRKNGTRRRRRTTGEQDGFDDDLQRALDESRLTAEE 184

Query: 181 XXXXXXXXXXXXXDRQAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPMYYDVFGNPIT 240
                        D QAA                                YYD+FGNPI+
Sbjct: 185 DERRRKMLGSEDDDLQAALQLSKEEEELKRLQEMQKLQQQQTQQQPS--QYYDIFGNPIS 242

Query: 241 PEE 243
           PEE
Sbjct: 243 PEE 245

 Score =  147 bits (370), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 79/156 (50%), Positives = 93/156 (59%), Gaps = 26/156 (16%)

Query: 295 LPTGSNNPFALNNXXXXXXXXXXXXXXXXXIET-----------------------PATQ 331
           + TGSNNPFALNN                   T                       P   
Sbjct: 326 MATGSNNPFALNNLQLQQARPAQSSPVPNFTSTQAQSPPKPQPQAQPQKQAPLPQQPQQA 385

Query: 332 TKPLTQTRSGNQAISDKYSALNNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGY 391
            KP+   R+G+ A+++KY  LN LLA+GTGIDTFGNTG+ RIPAQHT+TGTFINSQGTGY
Sbjct: 386 LKPV---RTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGY 442

Query: 392 RQVNNDDKPNPFLNGQYTGLPSTNIVPTQTGFGFGN 427
           RQV  + K NPFL  QYTG+PS+NIVP  TG+GFGN
Sbjct: 443 RQVTGEPKKNPFLQSQYTGIPSSNIVPAHTGYGFGN 478

>Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206W
           (REAL)
          Length = 626

 Score =  240 bits (613), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 109/142 (76%), Positives = 128/142 (90%)

Query: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60
            +RSAKN+VKGYS T+VLVRDATAN+S  PS + LDDLA +SY+SV+FFEI+DMLDKR+N
Sbjct: 5   FVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLN 64

Query: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120
           DKGKYWRHVAK+LTVLDYLVRFGSENCV+WC+EN Y+IKTLREF HE+  G DEG+IIRV
Sbjct: 65  DKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQIIRV 124

Query: 121 KAKELTSLLMDEERLKEERAMN 142
           KAKEL SLL D+ERL+EER+MN
Sbjct: 125 KAKELVSLLNDDERLREERSMN 146

 Score =  162 bits (411), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 87/95 (91%)

Query: 334 PLTQTRSGNQAISDKYSALNNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQ 393
           PL QTR+GNQ+ISDKY+ LN LLA+GTG+DTFGNTGE RIPAQHT+TGTFINSQGTGY+Q
Sbjct: 450 PLEQTRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 509

Query: 394 VNNDDKPNPFLNGQYTGLPSTNIVPTQTGFGFGNQ 428
           V ++ K NPFL+ QYTGLPSTNIVPTQTG+GFGNQ
Sbjct: 510 VTSEPKNNPFLSNQYTGLPSTNIVPTQTGYGFGNQ 544

>Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206W
           (REAL)
          Length = 612

 Score =  239 bits (611), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 128/142 (90%)

Query: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60
            +RSAKN++KGYS T+VLVRDATAN+S  PS + LDDLA +SY+SV+FFEI+DMLDKR+N
Sbjct: 5   FVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLN 64

Query: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120
           DKGKYWRHVAK+LTVLDYLVRFGSENCV+WC+EN Y+IKTLREF HE+  G DEG+IIRV
Sbjct: 65  DKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQIIRV 124

Query: 121 KAKELTSLLMDEERLKEERAMN 142
           KAKEL SLL D+ERL+EER+MN
Sbjct: 125 KAKELVSLLNDDERLREERSMN 146

 Score =  164 bits (414), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 77/95 (81%), Positives = 86/95 (90%)

Query: 334 PLTQTRSGNQAISDKYSALNNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQ 393
           PL QTR+GNQ+ISDKY+ LN LLA+GTG DTFGNTGE RIPAQHT+TGTFINSQGTGY+Q
Sbjct: 425 PLKQTRTGNQSISDKYNDLNTLLATGTGTDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 484

Query: 394 VNNDDKPNPFLNGQYTGLPSTNIVPTQTGFGFGNQ 428
           V N+ K NPFL+ QYTGLPSTNIVPTQTG+GFGNQ
Sbjct: 485 VINEPKNNPFLSNQYTGLPSTNIVPTQTGYGFGNQ 519

>YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}
           ENT2Epsin-like protein required for endocytosis and
           actin patch assembly and functionally redundant with
           Ent1p; contains clathrin-binding motif at C-terminus
          Length = 613

 Score =  238 bits (607), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 108/141 (76%), Positives = 127/141 (90%)

Query: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60
            +RSAKN++KGYS T+VLVRDATAN+S  PS + LDDLA +SY+SV+FFEI+DMLDKR+N
Sbjct: 5   FVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLN 64

Query: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120
           DKGKYWRHVAK+LTVLDYLVRFGSENCV+WC+EN Y+IKTLREF HE+  G DEG+IIRV
Sbjct: 65  DKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQIIRV 124

Query: 121 KAKELTSLLMDEERLKEERAM 141
           KAKEL SLL DEERL+EER+M
Sbjct: 125 KAKELVSLLNDEERLREERSM 145

 Score =  168 bits (426), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 79/95 (83%), Positives = 87/95 (91%)

Query: 334 PLTQTRSGNQAISDKYSALNNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQ 393
           PL QTR+GNQ+ISDKYS LN LLA+GTGIDTFGNTGE RIPAQHT+TGTFINSQGTGY+Q
Sbjct: 424 PLKQTRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 483

Query: 394 VNNDDKPNPFLNGQYTGLPSTNIVPTQTGFGFGNQ 428
           V N+ K NPFL+ QYTGLPSTNIVPTQTG+GFGNQ
Sbjct: 484 VTNEPKNNPFLSNQYTGLPSTNIVPTQTGYGFGNQ 518

>Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206W
           (REAL)
          Length = 618

 Score =  237 bits (605), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 126/142 (88%)

Query: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60
            +RSAKN+VKGYS T+VLVRDATAN+   PS + LDDLA +SY+SV+FFEI+DMLDKR+N
Sbjct: 5   FVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLN 64

Query: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120
           DKGKYWRHVAK+LTVLDYLVRFGSENCV+WC+EN Y+IKTLREF HE+  G DEG+IIRV
Sbjct: 65  DKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQIIRV 124

Query: 121 KAKELTSLLMDEERLKEERAMN 142
           KAKEL SLL D+ERL+EER MN
Sbjct: 125 KAKELVSLLNDDERLREERTMN 146

 Score =  165 bits (417), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 78/95 (82%), Positives = 87/95 (91%)

Query: 334 PLTQTRSGNQAISDKYSALNNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQ 393
           PLTQTR+GNQ+ISDKY+ LN LLA+GTG DTFGNTGE RIPAQHT+TGTFINSQGTGY+Q
Sbjct: 433 PLTQTRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQ 492

Query: 394 VNNDDKPNPFLNGQYTGLPSTNIVPTQTGFGFGNQ 428
           V N+ K NPFLN QYTGLPST+IVPTQTG+GFGNQ
Sbjct: 493 VVNEPKNNPFLNSQYTGLPSTSIVPTQTGYGFGNQ 527

>ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {ON}
           some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 538

 Score =  234 bits (597), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 119/242 (49%), Positives = 147/242 (60%), Gaps = 2/242 (0%)

Query: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60
            +RSAKN +KGY+  +VLVRDATAN    PS ++LD+LA +SY+SVEFFEI+DM+DKR+N
Sbjct: 5   FVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRLN 64

Query: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120
           DKGKYWRHVAK+LTVLDYLVRFGSENCV+WC+ENLYIIKTLREF H+D G +D G+IIRV
Sbjct: 65  DKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHDDDGTQDGGQIIRV 124

Query: 121 KAKELTSLLMDEERLKEERAMNIXXXXXXXXXXXXXXXXXXXXDEDLQRAIXXXXXXXXX 180
           KAKELT+LLMD+ERL+ ER  +                     D ++QRA+         
Sbjct: 125 KAKELTNLLMDDERLRMERGED-KGAPPRMMSPSPPTPRRNSYDSEMQRALDASRLTAEE 183

Query: 181 XXXXXXXXXXXXXDRQAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPM-YYDVFGNPI 239
                        D + A                              P  YYD+FGNPI
Sbjct: 184 DERRRKTLNNEDADLETALQLSKEEEELKRLQELQKAQQDQQRLSQMQPQGYYDIFGNPI 243

Query: 240 TP 241
           +P
Sbjct: 244 SP 245

 Score =  143 bits (361), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 95/155 (61%), Gaps = 24/155 (15%)

Query: 297 TGSNNPFALNNXXXXXXXXXXXXX-----------XXXXIETP-------------ATQT 332
           TGSNNPFALN                             +E P             A + 
Sbjct: 358 TGSNNPFALNGMPLQSNSKPQAASDLAGLNNWGNNSTGQLEMPKYQPRPQQPQHNTAPEP 417

Query: 333 KPLTQTRSGNQAISDKYSALNNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYR 392
           +P+   R+GNQ+ISDKY+ LN LLA  TG+DTFGN G+ RIPAQHT+TGTFINSQGTG++
Sbjct: 418 QPMQPVRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGTFINSQGTGFK 477

Query: 393 QVNNDDKPNPFLNGQYTGLPSTNIVPTQTGFGFGN 427
           Q +N+ K NPFL  Q+TG+P++++VP+ TG+GFGN
Sbjct: 478 QYSNEPKKNPFLPTQFTGIPTSSVVPSHTGYGFGN 512

>KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.342
           YLR206W
          Length = 414

 Score =  230 bits (586), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 126/141 (89%)

Query: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60
           MLRSAKN+VKGYS T+ LVRDAT+N+  NP  + L +LA+ +YN++EFFEI+DMLDKRIN
Sbjct: 1   MLRSAKNLVKGYSSTQKLVRDATSNSHDNPPIDQLSELAEMTYNNMEFFEIMDMLDKRIN 60

Query: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120
            KGKYW+HV K+L VLDYLVRFGSENCVIWC+ENLYIIKTLREF++ED  G D+G+++RV
Sbjct: 61  SKGKYWKHVIKSLIVLDYLVRFGSENCVIWCKENLYIIKTLREFTYEDESGMDQGQMVRV 120

Query: 121 KAKELTSLLMDEERLKEERAM 141
           +AKELTSLLMDEERL+EERA+
Sbjct: 121 RAKELTSLLMDEERLREERAL 141

 Score =  174 bits (440), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 100/133 (75%), Gaps = 5/133 (3%)

Query: 295 LPTGSNNPFALNNXXXXXXXXXXXXXXXXXIETPATQTKPLTQTRSGNQAISDKYSALNN 354
           L TGSNNPFALNN                 I+T      PL QTR+G+Q+ISDKYSALN 
Sbjct: 276 LATGSNNPFALNNKKLQQHTPEPSV-----IDTTLNTQAPLKQTRTGSQSISDKYSALNT 330

Query: 355 LLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVNNDDKPNPFLNGQYTGLPST 414
           LLA+GTGIDTFGNTG QRIPAQHT+TGTFINSQGTGY+QV+ +   N FLN QYTGLPS+
Sbjct: 331 LLATGTGIDTFGNTGNQRIPAQHTKTGTFINSQGTGYKQVSTNGFNNVFLNSQYTGLPSS 390

Query: 415 NIVPTQTGFGFGN 427
           NIVP+QTG+GFGN
Sbjct: 391 NIVPSQTGYGFGN 403

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 15/15 (100%)

Query: 229 PMYYDVFGNPITPEE 243
           PMYYD+FGNPITPEE
Sbjct: 217 PMYYDIFGNPITPEE 231

>Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa]
           {ON} complement(192214..193815) [1602 nt, 534 aa]
          Length = 533

 Score =  226 bits (575), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 120/241 (49%), Positives = 149/241 (61%), Gaps = 5/241 (2%)

Query: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60
            +RSAKN+VKGYS T+V+VR+AT+N+S  P  + LD LA+K+Y+SVEFFEI+DMLDKR+N
Sbjct: 5   FVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKRLN 64

Query: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120
           DKGKYW+H+AK+LTVLDYLVRFGSENCV+WC+ENLYII+TL+EFS+ D    D+G+IIRV
Sbjct: 65  DKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQIIRV 124

Query: 121 KAKELTSLLMDEERLKEERAMNIXXXXXXXXXXXXXXXXXXXXDEDLQRAIXXXXXXXXX 180
           KAKELTSLL DEERL++ER M                      D++LQRAI         
Sbjct: 125 KAKELTSLLNDEERLRDERGM----NRRGGRRERARPRRRPSDDDELQRAIEESKRTAED 180

Query: 181 XXXXXXXXXXXXXDRQAA-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPMYYDVFGNPI 239
                        D Q A                               PMYYD+FGNPI
Sbjct: 181 DDRRRRMRDDEEADLQTALQLSKEEEELKRLQELQRLQQQQQQQQQQQQPMYYDIFGNPI 240

Query: 240 T 240
           +
Sbjct: 241 S 241

 Score =  163 bits (413), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 98/158 (62%), Gaps = 31/158 (19%)

Query: 297 TGSNNPFALNNXXXXXXXXXXXXXXXXXIETPATQTKPLT-------------------- 336
           TGSNNPFA+NN                  E P    KP++                    
Sbjct: 319 TGSNNPFAMNNQALQLNNQNDKAHS----ELPDFNAKPVSAYQPAELPPQQQISLPPQPQ 374

Query: 337 -------QTRSGNQAISDKYSALNNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGT 389
                  QTR+GNQ I+DK+  LN LLASGTGIDTFGNTGE RIPAQHT+TGTFINSQGT
Sbjct: 375 QPQQPLKQTRTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGT 434

Query: 390 GYRQVNNDDKPNPFLNGQYTGLPSTNIVPTQTGFGFGN 427
           GYRQV ND K NPFLN QYTGLPSTNIVP+ TG+GFGN
Sbjct: 435 GYRQVTNDPKNNPFLNSQYTGLPSTNIVPSHTGYGFGN 472

>SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 498

 Score =  224 bits (572), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)

Query: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60
           +LR+AKN+V GYS  +VLVR+AT+N  T P+ + LD+LA+K+Y++VEFFEI+DMLDKR+N
Sbjct: 5   LLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRLN 64

Query: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120
           DKGK WRHVAK+LTVLDYLVR+GSENCV+W QENLYIIKTLREF HED  G D G+IIRV
Sbjct: 65  DKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQIIRV 124

Query: 121 KAKELTSLLMDEERLKEERAMNIXXXXXXXXXXXXXXXXXXXXDEDLQRAI 171
           KAKELTSLL DEERL EER  N+                    D+DLQRA+
Sbjct: 125 KAKELTSLLRDEERLTEER--NMRKKRRGKTRRPERSRGGEEYDDDLQRAL 173

 Score =  149 bits (375), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 94/138 (68%), Gaps = 7/138 (5%)

Query: 297 TGSNNPFALNNXX------XXXXXXXXXXXXXXXIETPATQTKPLTQTRSGNQAISDKYS 350
           TGSNNPFAL                           T  TQ + L  TR+GNQ+IS KY+
Sbjct: 327 TGSNNPFALGRQEPDEEQITPKVSESVATTAGTTTATTTTQQQALNPTRTGNQSISQKYN 386

Query: 351 ALNNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVNNDD-KPNPFLNGQYT 409
            LNNLLASGTG+DTFGNTG+ RIPAQHT+TG FINSQGTGY+QV ND  K NPFL  QYT
Sbjct: 387 DLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQVTNDQPKNNPFLAAQYT 446

Query: 410 GLPSTNIVPTQTGFGFGN 427
           GLPST++VP+ TG+GFGN
Sbjct: 447 GLPSTSVVPSYTGYGFGN 464

 Score = 34.3 bits (77), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 13/13 (100%), Positives = 13/13 (100%)

Query: 231 YYDVFGNPITPEE 243
           YYDVFGNPITPEE
Sbjct: 237 YYDVFGNPITPEE 249

>TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}
           Anc_7.342 YLR206W
          Length = 599

 Score =  226 bits (576), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 129/146 (88%), Gaps = 4/146 (2%)

Query: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60
            LRS KN+VKGYS T++LVRDATAN+   PS ++LDD+A+K+Y+SV+FFEI+DMLDKR+N
Sbjct: 5   FLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLDKRLN 64

Query: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDA----GGEDEGK 116
           DKGKYW+HVAK+LTVLDYL+RFGSENCV WC+ENLY+IKTL+EF  +DA     G D+G+
Sbjct: 65  DKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGYDQGQ 124

Query: 117 IIRVKAKELTSLLMDEERLKEERAMN 142
           I+RV+A ELTSLLMD+ERL+EER+++
Sbjct: 125 IVRVRATELTSLLMDDERLREERSLH 150

 Score =  155 bits (392), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 83/157 (52%), Positives = 99/157 (63%), Gaps = 25/157 (15%)

Query: 297 TGSNNPFALNN------------XXXXXXXXXXXXXXXXXIETPATQT------------ 332
           TG+NNPF+L+N                                PATQ+            
Sbjct: 404 TGTNNPFSLSNINNPQQQQPPLMSSSSTTLPDLSSFKQSTSVPPATQSSYTTKTNASSLP 463

Query: 333 -KPLTQTRSGNQAISDKYSALNNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGY 391
            +P+ Q R+GNQ ISDKY+ LN LLA+GTGIDTFGNTG+ RIPAQHT TGTFINSQGTGY
Sbjct: 464 PQPIPQMRTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQGTGY 523

Query: 392 RQVNNDDKPNPFLNGQYTGLPSTNIVPTQTGFGFGNQ 428
           +Q  ND K NPF++ QYTGLPSTN+VP+ TG+GFGNQ
Sbjct: 524 KQYINDPKNNPFMSNQYTGLPSTNVVPSYTGYGFGNQ 560

>NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.342
           YDL161W
          Length = 486

 Score =  221 bits (563), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 137/176 (77%), Gaps = 6/176 (3%)

Query: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60
            +RSAKN++KGYS T+VLVRDAT+N+S+NPS E+L +++ +S++SV+FFEI+DMLDKR+N
Sbjct: 5   FVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDKRLN 64

Query: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120
           DKGKYW+H+AK+LTVLDYLVRFGSENCV+WC++NLYIIKTL+EF  ED    DE  IIRV
Sbjct: 65  DKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLED-DNVDESSIIRV 123

Query: 121 KAKELTSLLMDEERLKEERAMNIXXXXXXXXXXXX-----XXXXXXXXDEDLQRAI 171
           KAKELT+LL D+ERLKEER++N+                         DEDLQ+A+
Sbjct: 124 KAKELTALLQDDERLKEERSINLKNNRRSERKNRSRRGTNATRRGTKSDEDLQKAL 179

 Score =  159 bits (403), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 97/134 (72%), Gaps = 5/134 (3%)

Query: 297 TGSNNPFALNNXXXXX----XXXXXXXXXXXXIETPATQTKPLTQTRSGNQAISDKYSAL 352
           TGSNNPFALN                       +      +PL QTR+GNQ+ISDKY+ L
Sbjct: 323 TGSNNPFALNATINTSPIRPAEQQPQPQFTAPQQQQQPLQQPLKQTRTGNQSISDKYNEL 382

Query: 353 NNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVNNDD-KPNPFLNGQYTGL 411
           NNLLASGTGIDTFGNTG+QRIPAQHTQTGTFINSQGTGY+Q+ ND  K NPFLN QYTGL
Sbjct: 383 NNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIVNDPVKKNPFLNNQYTGL 442

Query: 412 PSTNIVPTQTGFGF 425
           PS+NIVP+ TG+GF
Sbjct: 443 PSSNIVPSHTGYGF 456

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 11/14 (78%), Positives = 14/14 (100%)

Query: 230 MYYDVFGNPITPEE 243
           +YYD+FGNPI+PEE
Sbjct: 251 VYYDIFGNPISPEE 264

>TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {ON}
           Anc_7.342 YLR206W
          Length = 487

 Score =  216 bits (550), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 125/245 (51%), Positives = 155/245 (63%), Gaps = 11/245 (4%)

Query: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60
            +RS KN+VKGYS T+VLVR+ATAN  T P+ +LL D+A+K+Y+S +FFEI+DMLDKR+N
Sbjct: 5   FVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRLN 64

Query: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHED--AGGEDEGKII 118
           DKGKYW+H+AK+LTVLDYLVRFGSENCV+WC+ENLY+IKTL EF +ED  +GG D+G+II
Sbjct: 65  DKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQGQII 124

Query: 119 RVKAKELTSLLMDEERLKEERAMNIXXXXXXXXXXXXXXXXXXXXDEDLQRAIXXXXXXX 178
           RVKAKELT+LLMD+ERL+EER +N                     DEDLQRA+       
Sbjct: 125 RVKAKELTALLMDDERLREERRLN----NRRDRNRNRRPPARNGSDEDLQRAL-EESRRT 179

Query: 179 XXXXXXXXXXXXXXXDRQAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPMYYDVFGNP 238
                          D QAA                              P+YYDVFGNP
Sbjct: 180 AEEDERKRRLNQDDSDLQAA----LQLSKEEEELKRLQELQSSMHMQQQQPVYYDVFGNP 235

Query: 239 ITPEE 243
           I+ EE
Sbjct: 236 ISYEE 240

 Score =  149 bits (375), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 82/150 (54%), Positives = 96/150 (64%), Gaps = 20/150 (13%)

Query: 297 TGSNNPFALNNXXXXXXXXXXXXXXXXXIETPATQTKP--------------------LT 336
           TGSNNPFALNN                  +  A   +P                    L 
Sbjct: 313 TGSNNPFALNNQQTNNNNVQAASELPDFTKPQAQSYQPAKLPEQIEIQQPVQQPVQQPLQ 372

Query: 337 QTRSGNQAISDKYSALNNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVNN 396
           Q R+GN+ +++KY+ LN LLASGTGIDTFGNTGE RIPAQHTQTGTFINSQGTGYRQ + 
Sbjct: 373 QNRTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSG 432

Query: 397 DDKPNPFLNGQYTGLPSTNIVPTQTGFGFG 426
           + K NPFL+ QYTGLPS+NI+PTQTG+GFG
Sbjct: 433 ESKVNPFLSNQYTGLPSSNIIPTQTGYGFG 462

>Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]
           {ON} YDL161W (ENT1) - Ent1p [contig 161] FULL
          Length = 508

 Score =  213 bits (542), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 99/171 (57%), Positives = 133/171 (77%), Gaps = 6/171 (3%)

Query: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60
           ++R AKN+V GYS T+VL+R+AT+N+   PS +++D++A++S++SV FFEI+DMLDKR+N
Sbjct: 5   LIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDKRLN 64

Query: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120
           DKGK WRHVAK+LTVLDYLVR GSE+CV W +ENLY+IKTLREF HED  G D+G+I+RV
Sbjct: 65  DKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQIVRV 124

Query: 121 KAKELTSLLMDEERLKEERAMNIXXXXXXXXXXXXXXXXXXXXDEDLQRAI 171
           KA+ELT+LL+D+ERL+EER++                      DEDLQRA+
Sbjct: 125 KARELTALLLDDERLREERSLRT------KNRKPRRRPTAGSEDEDLQRAM 169

 Score =  147 bits (370), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 80/89 (89%)

Query: 338 TRSGNQAISDKYSALNNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVNND 397
           TR+GNQ+I++K+S LNNLLASGTG+DTFGNTG+ RIPAQHT+TG FINSQGTGY+QV++ 
Sbjct: 395 TRTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVSST 454

Query: 398 DKPNPFLNGQYTGLPSTNIVPTQTGFGFG 426
            K NPFL  QYTGLPSTN+VP+ TG+GFG
Sbjct: 455 PKHNPFLGQQYTGLPSTNVVPSYTGYGFG 483

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 13/15 (86%), Positives = 14/15 (93%)

Query: 229 PMYYDVFGNPITPEE 243
           PMYYDVFGNPI+ EE
Sbjct: 242 PMYYDVFGNPISAEE 256

>KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]
           {ON} some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 478

 Score =  209 bits (531), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 120/142 (84%), Gaps = 1/142 (0%)

Query: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60
            LRSAKN+V GYS  +VLVR AT+N+   PS + L++LA++++++VEFFEI+DMLDKR+N
Sbjct: 5   FLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDKRLN 64

Query: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGE-DEGKIIR 119
           DKG+ WRHVAK+LT LD+LVR GSENCV WC+ENLYIIKTLREF+H D   E D G+I+R
Sbjct: 65  DKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNGEIVR 124

Query: 120 VKAKELTSLLMDEERLKEERAM 141
           VKAKELT+LL DEERLKEER M
Sbjct: 125 VKAKELTALLRDEERLKEERMM 146

 Score =  161 bits (407), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 100/143 (69%), Gaps = 10/143 (6%)

Query: 297 TGSNNPFALNNXXXXXXXXXXXXXXXXXIETPAT---------QTKPLTQTRSGNQAISD 347
           TGSNNPFALN                  ++ P +         + KP+ + R+GNQ+ISD
Sbjct: 309 TGSNNPFALNRPPSPQEIEEIEEPDFTPVQLPPSPSPAAVPQQEFKPVPKQRTGNQSISD 368

Query: 348 KYSALNNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVNND-DKPNPFLNG 406
           K+S LNNLLASGTGIDTFGNTGE R+PAQHT+TGTFINSQGTGY+Q+ ND  K NPFL  
Sbjct: 369 KFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYKQITNDAPKHNPFLTS 428

Query: 407 QYTGLPSTNIVPTQTGFGFGNQA 429
           QYTG+PS+ I P+ TG+GFGNQA
Sbjct: 429 QYTGIPSSAIAPSYTGYGFGNQA 451

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 10/12 (83%), Positives = 12/12 (100%)

Query: 229 PMYYDVFGNPIT 240
           PMYYD+FGNPI+
Sbjct: 235 PMYYDIFGNPIS 246

>KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {ON}
           Anc_7.342 YLR206W
          Length = 550

 Score =  209 bits (532), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 93/131 (70%), Positives = 117/131 (89%)

Query: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60
            +RSAKN++KGYS T+VLVRDAT+N++   + + LDD+A +SY+SV+FFEI+DMLDKR+N
Sbjct: 5   FVRSAKNVMKGYSSTQVLVRDATSNDNRVTNIDTLDDIASRSYDSVDFFEIMDMLDKRLN 64

Query: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120
           DKGKYW+H+ K+LTVLDYLVRFGSENCV+WC+ENLY+IKTLREF +ED  G D+G+IIRV
Sbjct: 65  DKGKYWKHIVKSLTVLDYLVRFGSENCVLWCKENLYVIKTLREFRYEDDTGIDQGQIIRV 124

Query: 121 KAKELTSLLMD 131
           KAKELTSLL D
Sbjct: 125 KAKELTSLLQD 135

 Score =  154 bits (390), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 100/151 (66%), Gaps = 17/151 (11%)

Query: 295 LPTGSNNPFALNN--XXXXXXXXXXXXXXXXXIETPATQTKPLTQT-------------- 338
           + TGSNNPF+++N                   +++P  Q   +                 
Sbjct: 329 MVTGSNNPFSMDNLGKVNNAPPPQPVPQPQLAVQSPPQQIPQVAMPPLPQQQEQQPLKQN 388

Query: 339 RSGNQAISDKYSALNNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVNND- 397
           R+GN+ I++KYS LNNLLA GTG+DTFGNTG++RIPAQHT+TGTFINSQGTGY+QV N+ 
Sbjct: 389 RTGNEEITEKYSELNNLLAQGTGVDTFGNTGQERIPAQHTKTGTFINSQGTGYKQVTNER 448

Query: 398 DKPNPFLNGQYTGLPSTNIVPTQTGFGFGNQ 428
            K NPFLN QYTGLPS+NIVP+ TG+GFGNQ
Sbjct: 449 SKNNPFLNTQYTGLPSSNIVPSSTGYGFGNQ 479

>KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 502

 Score =  200 bits (508), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 115/131 (87%)

Query: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60
           ++R AKN+V GYS T+VL+R+AT+N+   PS +L+D++A++S++SV FFEI+DMLDKR+N
Sbjct: 5   LMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDKRLN 64

Query: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120
           DKGK WRHVAK+LTVLDYLVR GSE+CV W +ENLYIIKTLREF+HED  G D+G+I+RV
Sbjct: 65  DKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQIVRV 124

Query: 121 KAKELTSLLMD 131
           KA+ELT+LL D
Sbjct: 125 KARELTALLQD 135

 Score =  149 bits (375), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 83/93 (89%), Gaps = 2/93 (2%)

Query: 338 TRSGNQAISDKYSALNNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVNN- 396
           TR+GNQ+++DK+S LNNLLASGTG+DTFGNTG+ RIPAQHT+TGTFINSQGTGY+QV+N 
Sbjct: 387 TRTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVSNM 446

Query: 397 -DDKPNPFLNGQYTGLPSTNIVPTQTGFGFGNQ 428
              K NPFL  QYTGLPST++VP+ TG+GFGNQ
Sbjct: 447 PQGKHNPFLGQQYTGLPSTSVVPSYTGYGFGNQ 479

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 13/15 (86%), Positives = 14/15 (93%)

Query: 229 PMYYDVFGNPITPEE 243
           PMYYDVFGNPI+ EE
Sbjct: 240 PMYYDVFGNPISAEE 254

>Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar to
           Ashbya gossypii ACL157C
          Length = 514

 Score =  184 bits (467), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 116/144 (80%), Gaps = 1/144 (0%)

Query: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60
           +LRSAKN++ GYS  +VLVR+AT+N+   PS + +++LA+++Y++VEFFEI+ MLD+R+N
Sbjct: 5   LLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDRRLN 64

Query: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHED-AGGEDEGKIIR 119
           DK K WRHVAK+LTV DYLVR G+E CV W +EN++II+ L EF H D + G D G++IR
Sbjct: 65  DKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHGQLIR 124

Query: 120 VKAKELTSLLMDEERLKEERAMNI 143
           VKAKEL +LL D+ERLKEER + +
Sbjct: 125 VKAKELIALLRDDERLKEERNLRL 148

 Score =  140 bits (353), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 66/93 (70%), Positives = 79/93 (84%), Gaps = 1/93 (1%)

Query: 338 TRSGNQAISDKYSALNNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVNND 397
           TR+GNQ+ISDKY  LN LLA+GTGIDTFGNTG+ RI +QHT+T TFINS GTG++QV+N+
Sbjct: 403 TRTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNE 462

Query: 398 -DKPNPFLNGQYTGLPSTNIVPTQTGFGFGNQA 429
             K NPFL  QYTGLPSTNIVP+ TG+GFGN +
Sbjct: 463 PPKHNPFLTTQYTGLPSTNIVPSHTGYGFGNAS 495

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 11/12 (91%), Positives = 12/12 (100%)

Query: 229 PMYYDVFGNPIT 240
           PMYYD+FGNPIT
Sbjct: 244 PMYYDIFGNPIT 255

>TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {ON}
           Anc_7.342 YLR206W
          Length = 701

 Score =  176 bits (447), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 108/143 (75%)

Query: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60
            +RS KN+ KGYS T+VLVRDATANN +  S ++LD L + SY++ EF +I  +LD+RI+
Sbjct: 5   FVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLDRRIS 64

Query: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120
           DK KYWRHVAK+LTV+DYLVRFGSE CV W ++N   ++ LR+F + D+ G D+G++IRV
Sbjct: 65  DKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQLIRV 124

Query: 121 KAKELTSLLMDEERLKEERAMNI 143
           KA EL  LL D ERL  ER MN+
Sbjct: 125 KAAELIDLLRDPERLATERGMNM 147

 Score =  111 bits (278), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 59/83 (71%)

Query: 335 LTQTRSGNQAISDKYSALNNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQV 394
           L    +GN  IS KYS LN LLA GTGIDTFGN G  RIPAQHT+TGTFINSQGTGY+QV
Sbjct: 591 LQPMHTGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQV 650

Query: 395 NNDDKPNPFLNGQYTGLPSTNIV 417
            +   P P L  QYTGLP+   V
Sbjct: 651 TSSSSPIPLLPTQYTGLPAQTAV 673

>KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.342
           YLR206W
          Length = 646

 Score =  176 bits (445), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 110/141 (78%), Gaps = 1/141 (0%)

Query: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60
            +RSAKN++KGYS T+VLVRDATAN+   P  + L+D+A  S++SV+FFEI+D+L+KR+N
Sbjct: 5   FVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLEKRLN 64

Query: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAG-GEDEGKIIR 119
           D GKYWRH+ K+LTVLDYLVRFGSE+C  W +++L+++K LR F   D G G D+G+I+R
Sbjct: 65  DSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQGQIVR 124

Query: 120 VKAKELTSLLMDEERLKEERA 140
           VKA++L  LL   E+L   +A
Sbjct: 125 VKARDLVELLQSGEQLGGRKA 145

 Score =  149 bits (376), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 71/106 (66%), Positives = 85/106 (80%), Gaps = 3/106 (2%)

Query: 327 TPATQTKPLTQTRSGNQAISDKYSALNNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINS 386
            PA   +P+ +  +GNQ +++KYS LNNLLA GTG+DTFGN G QRIPAQHTQTGTFINS
Sbjct: 483 APAPVPQPMPRMNTGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINS 542

Query: 387 QGTGYRQVNNDDK---PNPFLNGQYTGLPSTNIVPTQTGFGFGNQA 429
           QGTG++QVN++ K    NPFLN QYTGLPST IVP  TG+GFGNQ+
Sbjct: 543 QGTGFKQVNSEGKDPNSNPFLNSQYTGLPSTGIVPAYTGYGFGNQS 588

>ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR206W
           (ENT2) and YDL161W (ENT1)
          Length = 515

 Score =  165 bits (418), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 74/128 (57%), Positives = 102/128 (79%), Gaps = 1/128 (0%)

Query: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60
           +LRSAKN+V GYS  ++LVR+AT+N    PS + +++LA++SY++VEFFEI+ MLDKR++
Sbjct: 5   LLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDKRLS 64

Query: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHED-AGGEDEGKIIR 119
           DK K+WRHVAK+LTV D+LVR G+E CV W +ENLY+ + L EF H D + G D G+IIR
Sbjct: 65  DKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHGQIIR 124

Query: 120 VKAKELTS 127
           VKA+EL +
Sbjct: 125 VKARELVA 132

 Score =  150 bits (378), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 73/106 (68%), Positives = 88/106 (83%), Gaps = 4/106 (3%)

Query: 326 ETPATQTKP---LTQTRSGNQAISDKYSALNNLLASGTGIDTFGNTGEQRIPAQHTQTGT 382
           + P  Q++P   L  TR+GNQ+I+DKYS LN LLASGTG+DTFGNTG+ RIPAQHT+TGT
Sbjct: 386 QLPRPQSQPGPQLQPTRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGT 445

Query: 383 FINSQGTGYRQVNND-DKPNPFLNGQYTGLPSTNIVPTQTGFGFGN 427
           FINSQGTGY+QV N+  K NPF+  QYTGLPSTN+VP+ TG+GFGN
Sbjct: 446 FINSQGTGYKQVGNEPPKHNPFIATQYTGLPSTNMVPSHTGYGFGN 491

>Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score =  101 bits (251), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 82/139 (58%), Gaps = 1/139 (0%)

Query: 2   LRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIND 61
            R A+N+V  Y++ E  VR+AT N     S  L+D ++  +YN  E  EIL M+ +R  +
Sbjct: 19  FRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFRRFTE 78

Query: 62  K-GKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120
           K G  WR + KAL +LDYL++ GSE  +   + ++ +IK L  F + D+ G D+G  +R 
Sbjct: 79  KAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILESFHYTDSQGRDQGINVRT 138

Query: 121 KAKELTSLLMDEERLKEER 139
           + K L  LL D+ +++ ER
Sbjct: 139 RVKALVELLSDDSKIRAER 157

>Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125C
           (ENT3) - Ent3p [contig 219] FULL
          Length = 382

 Score =  100 bits (248), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 54/139 (38%), Positives = 82/139 (58%), Gaps = 1/139 (0%)

Query: 2   LRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIND 61
            R A+N+V  Y++ E  VR+AT N     S  L++ +A  +YN  E  EIL M+ +R  +
Sbjct: 19  FRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQIAQGTYNYREREEILGMIFRRFTE 78

Query: 62  K-GKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120
           K    WR + KAL +LDYL+R G+E  +   + NL +IK L  F + D+ G D+G  +R 
Sbjct: 79  KTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYIDSQGRDQGINVRN 138

Query: 121 KAKELTSLLMDEERLKEER 139
           +A EL  LL D+ +++ ER
Sbjct: 139 RAHELALLLDDDAKVRAER 157

>Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..9313)
           [1257 nt, 419 aa]
          Length = 418

 Score =  100 bits (249), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 85/139 (61%), Gaps = 1/139 (0%)

Query: 2   LRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIND 61
            R A+N++  Y++ E  VR+AT N     S  L++ ++  +YN  E  EIL M+ +R  +
Sbjct: 19  FRKAQNVMFNYTEMEGKVREATNNEPWGASSTLMEQISQGTYNIREREEILSMIFRRFTE 78

Query: 62  K-GKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120
           K    WR + KAL +L+YL++ GSE  +   + +L +IK L  F + D+ G D+G  +R 
Sbjct: 79  KTASEWRQIYKALQLLEYLIKHGSERFIDDVRSSLSLIKMLESFHYIDSQGRDQGINVRN 138

Query: 121 KAKELTSLLMDEERLKEER 139
           KA+ LT+LL D+E+++ ER
Sbjct: 139 KAQSLTALLKDDEQIRAER 157

>NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {ON}
           Anc_4.346
          Length = 435

 Score =  100 bits (249), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 84/139 (60%), Gaps = 1/139 (0%)

Query: 2   LRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIND 61
            R A+N+V  Y++ E  VR+AT N     S  L++ +A  +YN  E +EI+ M+ +R  +
Sbjct: 19  FRKAQNVVFNYTEMESKVREATNNEPWGASSTLMEQIAQGTYNVRERYEIVGMIFRRFTE 78

Query: 62  K-GKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120
           K G  WR + KAL +LDYL++ GSE  +   + +L +I+ L  F + D+ G D+G  +R 
Sbjct: 79  KAGSEWRQIYKALQLLDYLIKHGSEPFIDDVRSSLKLIQMLETFHYIDSEGRDQGINVRN 138

Query: 121 KAKELTSLLMDEERLKEER 139
           +AK L  LL D+  +++ER
Sbjct: 139 RAKLLVELLQDDSNIRQER 157

>TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa]
           {ON} Anc_4.346 YJR125C
          Length = 426

 Score =  100 bits (248), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 50/139 (35%), Positives = 82/139 (58%), Gaps = 1/139 (0%)

Query: 2   LRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIND 61
            R A+N+V  Y+D E  VR+AT N     S  L++ +A  +YN  E  EIL M+ +R  +
Sbjct: 19  FRKAQNVVFNYTDMEAKVREATNNEPWGASSTLMEQIAQGTYNPREREEILSMILRRFTE 78

Query: 62  K-GKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120
           K G  WR + KAL +L+YL+  G+E  +   + +L +I+ L  F + D+ G D+G  +R 
Sbjct: 79  KSGNLWRQIYKALQLLEYLITHGAERFIDEARSSLGLIRMLESFHYVDSEGRDQGANVRS 138

Query: 121 KAKELTSLLMDEERLKEER 139
           +A+ +TSLL  ++ ++  R
Sbjct: 139 RAQAMTSLLSSDDAIRSAR 157

>TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.346
           YJR125C
          Length = 375

 Score = 99.4 bits (246), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 82/139 (58%), Gaps = 1/139 (0%)

Query: 2   LRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIND 61
            R A+N+V  Y+D E  VR+AT N     S  L++ ++  +YN  E  EIL M+ +R+ +
Sbjct: 19  FRRAQNVVFNYTDMEAKVREATNNEPWGASTTLMEQISQGTYNMREREEILGMIFRRLTE 78

Query: 62  K-GKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120
           K    WR + KAL +LDYL+R  SE  +   + ++ +IK L  F + D+ G D+G  +R 
Sbjct: 79  KRANEWRQIYKALQLLDYLIRHASERFIDDTRSSISLIKMLESFHYIDSQGRDQGINVRN 138

Query: 121 KAKELTSLLMDEERLKEER 139
           +AK L  LL D+E ++ ER
Sbjct: 139 RAKALAELLSDDETIRAER 157

>KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 401

 Score = 99.0 bits (245), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 82/139 (58%), Gaps = 1/139 (0%)

Query: 2   LRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIND 61
            R A+N+V  Y++ E  VR+AT N     S  L++ ++  +YN  E  EIL M+ +R  +
Sbjct: 19  FRKAQNMVFNYTEMEAKVREATNNEPWGASSTLMEQISQGTYNYREREEILGMIFRRFTE 78

Query: 62  K-GKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120
           K    WR + KAL +LDYL+R G+E  +   + NL +IK L  F + D+ G D+G  +R 
Sbjct: 79  KTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYIDSQGRDQGINVRN 138

Query: 121 KAKELTSLLMDEERLKEER 139
           +A EL  LL D+ +++ ER
Sbjct: 139 RAHELVLLLDDDGKIRTER 157

>KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125C ENT3
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p
          Length = 400

 Score = 99.0 bits (245), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 83/139 (59%), Gaps = 1/139 (0%)

Query: 2   LRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIND 61
            R A+N+V  Y++ E  VR+AT N     S  L++ +A  +YN  E  EIL M+ +R  +
Sbjct: 19  FRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEHIAQGTYNYREREEILGMIFRRFTE 78

Query: 62  K-GKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120
           K    WR + KAL +L+YLV+ GSE  +   + NL ++K L  F + D+ G D+G  +R 
Sbjct: 79  KTASEWRQIYKALQLLEYLVKHGSERFIDDVRTNLNLVKMLESFHYIDSQGRDQGINVRN 138

Query: 121 KAKELTSLLMDEERLKEER 139
           +A +L  LL  +E++++ER
Sbjct: 139 RASQLVKLLESDEQIRQER 157

>SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 415

 Score = 98.6 bits (244), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 51/139 (36%), Positives = 84/139 (60%), Gaps = 1/139 (0%)

Query: 2   LRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIND 61
            R A+N+V  Y++ E  VR+AT N     S  L++ ++  +YN  E  EIL M+ +R  +
Sbjct: 19  FRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQISAGTYNYREREEILGMIFRRFTE 78

Query: 62  K-GKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120
           K    WR + KAL +L+YL++ GSE  +   + NL +IK L  F + D+ G D+G  +R 
Sbjct: 79  KTASEWRQIYKALQLLEYLIKHGSERFIDDSRANLTLIKMLESFHYTDSQGRDQGINVRN 138

Query: 121 KAKELTSLLMDEERLKEER 139
           +A+EL  LL ++++++ ER
Sbjct: 139 RAQELVKLLNNDDQIRAER 157

>Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 98.6 bits (244), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 82/139 (58%), Gaps = 1/139 (0%)

Query: 2   LRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIND 61
            R A+N+V  Y++ E  VR+AT N     S  L+D ++  +YN  E  EIL M+ +R  +
Sbjct: 19  FRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFRRFTE 78

Query: 62  K-GKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120
           K G  WR + KAL +LDYL++ GSE  +   + ++ +IK L  F + D+ G D+G  +R 
Sbjct: 79  KAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILETFHYIDSQGRDQGINVRT 138

Query: 121 KAKELTSLLMDEERLKEER 139
           + K L  LL D+ +++ ER
Sbjct: 139 RVKTLIELLSDDNKIRAER 157

>YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON}
           ENT3Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes; associates with the clathrin
           adaptor Gga2p
          Length = 408

 Score = 98.2 bits (243), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 51/139 (36%), Positives = 82/139 (58%), Gaps = 1/139 (0%)

Query: 2   LRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIND 61
            R A+N+V  Y++ E  VR+AT N     S  L+D ++  +YN  E  EIL M+ +R  +
Sbjct: 19  FRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFRRFTE 78

Query: 62  K-GKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120
           K G  WR + KAL +LDYL++ GSE  +   + ++ +I+ L  F + D+ G D+G  +R 
Sbjct: 79  KAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQGRDQGINVRT 138

Query: 121 KAKELTSLLMDEERLKEER 139
           + K L  LL D+ +++ ER
Sbjct: 139 RVKALIELLSDDNKIRAER 157

>Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {ON}
           YJR125C (REAL)
          Length = 409

 Score = 97.8 bits (242), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 51/139 (36%), Positives = 82/139 (58%), Gaps = 1/139 (0%)

Query: 2   LRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIND 61
            R A+N+V  Y++ E  VR+AT N     S  L+D ++  +YN  E  EIL M+ +R  +
Sbjct: 19  FRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFRRFTE 78

Query: 62  K-GKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120
           K G  WR + KAL +LDYL++ GSE  +   + ++ +I+ L  F + D+ G D+G  +R 
Sbjct: 79  KAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQGRDQGINVRT 138

Query: 121 KAKELTSLLMDEERLKEER 139
           + K L  LL D+ +++ ER
Sbjct: 139 RVKALIDLLSDDNKIRAER 157

>NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa]
           {ON} Anc_4.346
          Length = 423

 Score = 96.7 bits (239), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 51/139 (36%), Positives = 82/139 (58%), Gaps = 1/139 (0%)

Query: 2   LRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIND 61
            R A+N+V  Y++ E  VR+AT N     S  L++ +A  +YN  E  EIL M+ +R  +
Sbjct: 19  FRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNIREREEILSMIFRRFTE 78

Query: 62  K-GKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120
           K G  WR + KAL +LDYL++ GSE  +   + ++ ++K L+ F + DA G D+G  +R 
Sbjct: 79  KTGSEWRQIYKALQLLDYLIKHGSEKFIDDVRSSVAVLKLLQTFHYIDAEGRDQGINVRN 138

Query: 121 KAKELTSLLMDEERLKEER 139
           +   L  LL D+  +++ER
Sbjct: 139 RVTTLIELLRDDNSIRQER 157

>KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.346
           YJR125C
          Length = 403

 Score = 96.7 bits (239), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 50/139 (35%), Positives = 82/139 (58%), Gaps = 1/139 (0%)

Query: 2   LRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIND 61
            R A+N+V  +++ E  VR+AT N     S  L++ +A  +YN  E  E++ ML +R  +
Sbjct: 19  FRKAQNVVFNFTEMESKVREATNNEPWGASSTLMEQIAQGTYNYKEREEVMMMLMRRFTE 78

Query: 62  K-GKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120
           K G  WR + KAL +LDYL+R GSE  +   +  L I++ L  F + D+ G D+G  +R 
Sbjct: 79  KAGSEWRQIYKALQLLDYLIRRGSEKFIDDVRAALRIVRLLESFHYIDSQGRDQGVNVRN 138

Query: 121 KAKELTSLLMDEERLKEER 139
           +AK++  LL D+  +++ R
Sbjct: 139 RAKQIVELLQDDAAVRDAR 157

>ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 424

 Score = 95.9 bits (237), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 51/139 (36%), Positives = 83/139 (59%), Gaps = 1/139 (0%)

Query: 2   LRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIND 61
            R A+N+V  Y++ E  VR+AT N     S  L++ +A  +YN  E  EIL M+ +R  +
Sbjct: 54  FRKAQNVVFNYTEMEAKVREATNNEPWGTSSTLMEYIAQGTYNLREREEILGMIFRRFTE 113

Query: 62  K-GKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120
           K    WR + KAL +L+YL++ GSE  +   + ++ ++K L  F + D+ G D+G  +R 
Sbjct: 114 KTANEWRQIYKALQLLEYLIKHGSERFIDDTRCSISLLKMLESFHYVDSQGRDQGINVRT 173

Query: 121 KAKELTSLLMDEERLKEER 139
           +AK LT LL D+ +++ ER
Sbjct: 174 RAKALTELLGDDNKIRAER 192

>KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON}
           Anc_4.346 YJR125C
          Length = 399

 Score = 95.5 bits (236), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 84/139 (60%), Gaps = 1/139 (0%)

Query: 2   LRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIND 61
            R A+N+V  Y++ E  VR+AT N     S  L++ +A  +YN  E  EIL M+ +R  +
Sbjct: 19  FRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNLREREEILGMIFRRFTE 78

Query: 62  K-GKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120
           K G  WR + K+L +LDYL+R GSE  +   + ++ +I+ L  F + D+ G D+G  +R 
Sbjct: 79  KAGSEWRQIYKSLQLLDYLIRRGSERFIDDVRSSIRLIELLETFHYIDSQGRDQGINVRN 138

Query: 121 KAKELTSLLMDEERLKEER 139
           +AK L  LL D+ ++++ER
Sbjct: 139 RAKALGELLSDDTKIRQER 157

>TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346
           YJR125C
          Length = 399

 Score = 92.0 bits (227), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 80/139 (57%), Gaps = 1/139 (0%)

Query: 2   LRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIND 61
            R A+N++  Y+D E  VR+AT N     S  L+  +A  +YN  E  EIL M+ +R  +
Sbjct: 19  FRKAQNVMFNYTDMEAKVREATNNEPWGASSTLMKQIAQGTYNIREREEILGMVFRRYTE 78

Query: 62  K-GKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120
           K    WR + K+L + DYL++ GSE  +   + ++ +IK L  F + D+ G D+G  +R 
Sbjct: 79  KTASEWRQIYKSLQLTDYLIKHGSERFIDDVRTSISLIKMLESFHYIDSQGRDQGINVRN 138

Query: 121 KAKELTSLLMDEERLKEER 139
           KA+ L + L D++ ++ ER
Sbjct: 139 KAQSLVAFLKDDDLIRAER 157

>AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR125C
           (ENT3)
          Length = 364

 Score = 89.4 bits (220), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 50/139 (35%), Positives = 79/139 (56%), Gaps = 1/139 (0%)

Query: 2   LRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIND 61
            R A+N++  Y+  E  VR+AT N     S  L+  +A  +YN  E  EIL M+ +R  +
Sbjct: 19  FRKAQNVMLNYTGMEAKVREATNNEPWGASSTLMTQIAQGTYNFREREEILAMILRRFLE 78

Query: 62  K-GKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120
           K    WR + K++ +L+YLV+ GSE  +   + NL +I+ L  F + D+ G D+G  +R 
Sbjct: 79  KSANEWRQIYKSMQLLEYLVKHGSERFIDDVRSNLNLIRMLETFHYIDSQGRDQGINVRN 138

Query: 121 KAKELTSLLMDEERLKEER 139
           + K L  LL D+E ++ ER
Sbjct: 139 RTKALVKLLEDDELIRAER 157

>CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125c ENT3
           cytoskeletal adaptor
          Length = 412

 Score = 89.4 bits (220), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 83/139 (59%), Gaps = 1/139 (0%)

Query: 2   LRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIND 61
            R A+N+V  Y+D E  VR+AT N     S  L++ +A  +YN  E  EIL M+ +R  +
Sbjct: 19  FRKAQNVVYNYTDMESKVREATNNEPWGASSTLMEQIAQGTYNIREREEILGMIFRRFTE 78

Query: 62  K-GKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120
           K G  WR + KAL +L+YL++ GSE  +   + ++ I+K L  F + D+ G D+G  +R 
Sbjct: 79  KSGSEWRQIYKALQLLEYLIKHGSERFIDDTRNSISIVKLLESFHYIDSQGRDQGVNVRN 138

Query: 121 KAKELTSLLMDEERLKEER 139
           +A  LT+LL D+  ++ ER
Sbjct: 139 RAAALTALLADDSSIRAER 157

>Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar to
           Ashbya gossypii AER155C
          Length = 392

 Score = 85.1 bits (209), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 78/139 (56%), Gaps = 1/139 (0%)

Query: 2   LRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIND 61
            R A+N+V  Y+  E  VR+AT N S      L+  +A  +YN  E  EIL M+ +R  +
Sbjct: 19  FRKAQNVVFNYTGMEAKVREATNNESWGAPSSLMAQIAQGTYNYRERKEILGMIFRRFVE 78

Query: 62  K-GKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120
           K    WR + K++ +L+YL+  GSE  +   +  L +IK L  F + D+ G D+G  +R 
Sbjct: 79  KTASEWRQIYKSVQLLEYLIYHGSEGFIDDVRSGLNLIKMLESFHYIDSQGRDQGINVRN 138

Query: 121 KAKELTSLLMDEERLKEER 139
           + + L  LL ++E+++ ER
Sbjct: 139 RTQALVQLLNNDEQIRIER 157

>Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {ON}
           YLL038C (ENT4) - Ent4p [contig 144] FULL
          Length = 254

 Score = 73.2 bits (178), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 81/146 (55%), Gaps = 8/146 (5%)

Query: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTN-PSRELLDDLADKSYNSVEFFEILDMLDKRI 59
           +L++ +NI  G S TEV  R+AT ++  N  +  L+++L+  +Y+     EI  ++ KR+
Sbjct: 3   LLKTVRNI--GQSSTEVKTRNATNDDEHNGATGSLMNELSVLTYSPRTLREITQVIRKRL 60

Query: 60  NDKGKYWRH-----VAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDE 114
           +   +   H     + K LT++ YL+  GS+  V+W +  LY+I TL+EF+      E  
Sbjct: 61  SGNSRMSSHKNAVHLLKTLTLIAYLINNGSDEFVVWIRSYLYLIDTLKEFNGGSRTKERM 120

Query: 115 GKIIRVKAKELTSLLMDEERLKEERA 140
              IR  A  L ++L DEE L++ R+
Sbjct: 121 ASQIRNLASSLAAILRDEELLRQRRS 146

>TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17
           YLL038C
          Length = 257

 Score = 68.6 bits (166), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 84/146 (57%), Gaps = 8/146 (5%)

Query: 1   MLRSAKNIVKGYSDTEVLVRDAT-ANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRI 59
           +L S + +V+  S TE+ V+ AT  N S+  +  L+++++  +Y+     EI+ ++ KR+
Sbjct: 3   LLDSVRTLVQ--STTELKVKQATDENESSGATGTLMNEISVLTYSPKTLKEIVQVVRKRL 60

Query: 60  NDKG-----KYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDE 114
              G     K   H+ K LT++ YL+  GS + + W + N+ ++  L+EF+ +D   E  
Sbjct: 61  MGHGRRNSHKICIHLVKTLTLVTYLMNNGSNDFIAWVRGNMALVDCLKEFNVQDRNDEKI 120

Query: 115 GKIIRVKAKELTSLLMDEERLKEERA 140
           G+ IR  +++L +L+ D++ L+  RA
Sbjct: 121 GQQIRAMSQDLCTLIKDDDLLENRRA 146

>SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some
           similarities with uniprot|Q07872 Saccharomyces
           cerevisiae YLL038C ENT4 Protein of unknown function
           contains an N-terminal epsin-like domain
          Length = 262

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 82/147 (55%), Gaps = 12/147 (8%)

Query: 1   MLRSAKNIVKGYSDTEVLVRDATANNS-TNPSRELLDDLADKSYNSVEFFEILDMLDKRI 59
            +RS +N+  G S TEV V+ AT ++  +  +  L+++++  +Y++    EI  ++ +R+
Sbjct: 3   FIRSVRNM--GQSTTEVKVKKATDDDEYSGATGALMNEISVLTYSAKTLREITQVIHRRL 60

Query: 60  NDKGKYWR-------HVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGE 112
           +  G Y +       H+ K LT++ YL+  GS + V W ++  Y++ TLREF+       
Sbjct: 61  S--GNYRKSSHRNAVHILKTLTLISYLINNGSNDFVSWIRQYAYLVDTLREFNVSADKDR 118

Query: 113 DEGKIIRVKAKELTSLLMDEERLKEER 139
              + +R+ + +L+ LL D+  L+E R
Sbjct: 119 KMAEQVRMLSIKLSKLLKDDLMLQERR 145

>KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 255

 Score = 62.0 bits (149), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 80/146 (54%), Gaps = 8/146 (5%)

Query: 1   MLRSAKNIVKGYSDTEVLVRDATANNS-TNPSRELLDDLADKSYNSVEFFEILDMLDKRI 59
           +LR+ ++   G S TE+  ++AT ++  +  +  L+++++  +Y+S    EI  ++ KR+
Sbjct: 3   LLRTVRSF--GQSQTEIKTKNATNDDEYSGATGSLMNEISVLTYSSRTLREITAVVRKRL 60

Query: 60  ---NDKGKYWR--HVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDE 114
              N K  +    H+ K LT+  YL+  GS   V W +  +Y+I +L+EF+    G E  
Sbjct: 61  SGNNRKSSHKNAVHILKTLTLTAYLINNGSNEFVAWIRSYVYLIDSLKEFTIGSRGQERM 120

Query: 115 GKIIRVKAKELTSLLMDEERLKEERA 140
              IR  A  L+ +L D+E L++ R+
Sbjct: 121 AVQIRSLASTLSVILRDDELLRQRRS 146

>Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON}
           complement(17825..18631) [807 nt, 269 aa]
          Length = 268

 Score = 60.5 bits (145), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/144 (30%), Positives = 78/144 (54%), Gaps = 12/144 (8%)

Query: 4   SAKNIVKGYSDTEVLVRDATANNSTN-PSRELLDDLADKSYNSVEFFEILDMLDKRINDK 62
           S +N V+  S TE  V++AT +N T+  +  L+++++  +Y+     EI+ +L KR+   
Sbjct: 6   SVRNFVQ--SATEAKVKEATDDNETSGATGTLMNEISVLTYSPKTLKEIIQVLKKRLTGS 63

Query: 63  GKYWRH-----VAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFS--HEDAGGEDEG 115
            K   H     + K +T++ YL+  GS + + W + N+ I + L++F   HED   E   
Sbjct: 64  SKKSSHRNCVHILKTMTLISYLINNGSNDFIAWARSNIMIFEVLKDFEVIHED--DEKMA 121

Query: 116 KIIRVKAKELTSLLMDEERLKEER 139
           + IR  A +L  L+ D+E L+  R
Sbjct: 122 EQIRYIAGDLCILINDDELLEARR 145

>Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 73/134 (54%), Gaps = 7/134 (5%)

Query: 13  SDTEVLVRDATANNSTN-PSRELLDDLADKSYNSVEFFEILDMLDKRI------NDKGKY 65
           S TE  V+ AT+ + T+  +  L+++++  +Y+     EI+ ++ KR+       +  + 
Sbjct: 13  SPTESKVKQATSEDETSGATGTLMNEISILTYSPKTVREIIQIVRKRLLLGQNRRNSHRS 72

Query: 66  WRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRVKAKEL 125
              V K LT++ YL+  GS   + W + N+ +I+ L +F  +DA  +  G+ IR  ++ L
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQAQDARDDRNGEEIRKLSRNL 132

Query: 126 TSLLMDEERLKEER 139
             LL D+E L+ +R
Sbjct: 133 HELLQDDELLERQR 146

>TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON}
           Anc_4.17 YLL038C
          Length = 280

 Score = 55.5 bits (132), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 79/145 (54%), Gaps = 8/145 (5%)

Query: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTN-PSRELLDDLADKSYNSVEFFEILDMLDKRI 59
           +  S +N V+  S TE  VR AT ++ T+  +  L+++++  +Y+     EI+ +L KR+
Sbjct: 3   LFDSVRNFVQ--SPTESKVRQATDDDETSGATGTLMNEISVLTYSPKTLKEIVQILKKRL 60

Query: 60  -----NDKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDE 114
                 +  K   H+ K LT++ YL+  GS + + W + N+ + + L+ F  ++   E  
Sbjct: 61  TGYSKKNSHKNCVHILKTLTLITYLINNGSNDFIAWTRSNIMLFEYLKNFEVQNLEDEKM 120

Query: 115 GKIIRVKAKELTSLLMDEERLKEER 139
           G+ I     ++ +++ D++ L+++R
Sbjct: 121 GQQIVFICNDICNIINDDDMLEQKR 145

>Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to
           Ashbya gossypii ACL061C
          Length = 254

 Score = 55.1 bits (131), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 71/135 (52%), Gaps = 6/135 (4%)

Query: 11  GYSDTEVLVRDATANNSTNPSR-ELLDDLADKSYNSVEFFEILDMLDKRI-----NDKGK 64
           G S T V V+ AT ++  N +   L++++A  +Y+     EI  +L KR+         K
Sbjct: 11  GSSSTTVKVKKATDDSEHNGAYGSLMNEIAILTYSPNTLREITQVLKKRLVGNYKKTPSK 70

Query: 65  YWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRVKAKE 124
              ++ K LT++ +LV  GSE C+ W + +L +I++ ++F+  D   +     I++ + +
Sbjct: 71  RAVNLLKTLTLIRFLVINGSEECIAWLRRHLVLIRSFQDFTLRDGEKKQMVNQIQLLSCK 130

Query: 125 LTSLLMDEERLKEER 139
           L  LL D   L++ R
Sbjct: 131 LCQLLTDSNLLEDMR 145

>ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 259

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 69/137 (50%), Gaps = 6/137 (4%)

Query: 9   VKGYSDTEVLVRDAT-ANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRINDKGKYWR 67
           V G S TE+ VR AT  +  T  +  L+++++  +Y+     EI  +L +R++  G+   
Sbjct: 9   VFGPSSTELKVRKATNEDEKTGATGTLMNEISVLTYSPKTVREITQVLKRRLSSYGRRTS 68

Query: 68  H-----VAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRVKA 122
           H     + KALT++ YL+  GSE  V W + NL   + L+         E   K IR  +
Sbjct: 69  HKNSIHIVKALTLILYLINNGSEEFVAWVRGNLIYFECLKSCEVSQKRDEPLAKQIRSMS 128

Query: 123 KELTSLLMDEERLKEER 139
            ++   + D+E L+ ++
Sbjct: 129 NQICDCVKDDELLENKK 145

>TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON}
           Anc_4.346 YJR125C
          Length = 339

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 68/140 (48%), Gaps = 1/140 (0%)

Query: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60
             R A+N +   +D E  VR+AT N+    S  L+  +   ++   +  +I++ML  R  
Sbjct: 18  FFRMAENFLFNLTDMESKVREATNNDPWGTSVILMAQINAGTFEINQRADIINMLLNRFL 77

Query: 61  DK-GKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIR 119
           +K G  WR + K++ +L YL+  GS   V   + NL +IK L  F   D  G ++   I 
Sbjct: 78  EKNGSQWRQIYKSVLLLQYLLINGSTEFVSEVKLNLTLIKNLMLFEFIDDQGYNQSSKIS 137

Query: 120 VKAKELTSLLMDEERLKEER 139
              + L  L+ D+  L + R
Sbjct: 138 KATERLIELMTDDHLLNDLR 157

>TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.17
           YLL038C
          Length = 423

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 79/146 (54%), Gaps = 9/146 (6%)

Query: 1   MLRSAKNIVKGYSDTEVLVRDATANN-STNPSRELLDDLADKSYNSVEFFEILDMLDKRI 59
           +  S +N V+  S TE+ VR AT +N ++  +  L+++++  +Y++    EI+ +L KR+
Sbjct: 3   IFESVRNFVQ--SPTELKVRTATDDNENSGATGTLMNEISVLTYSTKTNKEIVTVLKKRL 60

Query: 60  NDKGKYWRH-----VAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDE 114
              GK   H     + K LT++ YL+  GS   + W  EN  + + ++ F   D   +++
Sbjct: 61  TGYGKKSSHRNCIHIIKTLTLIAYLMNNGSLEFIRWINENQLLFEVMKNFEVSDTIHDEK 120

Query: 115 GKI-IRVKAKELTSLLMDEERLKEER 139
             I IR  ++ +  L+ + E L+++R
Sbjct: 121 FAIQIRDLSERILELINNRELLEQKR 146

>ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL038C
           (ENT4)
          Length = 234

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 64/135 (47%), Gaps = 6/135 (4%)

Query: 11  GYSDTEVLVRDATANNS-TNPSRELLDDLADKSYNSVEFFEILDMLDKRIN-----DKGK 64
           G S T   VR AT +N     S  L+ ++   +Y+     ++  +L KR++        K
Sbjct: 11  GSSPTAAKVRKATDDNEFVGASSALISEITILTYSCKTLLDVTRVLKKRLSGNANKSSHK 70

Query: 65  YWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRVKAKE 124
              H+ KALT+ +YL+  GSE+ V W Q    +++ L++F+  +         IR  +  
Sbjct: 71  NAVHILKALTLTNYLIANGSEDFVQWLQGCAVLLRRLKDFTTGNERDSHMASQIRSFSLS 130

Query: 125 LTSLLMDEERLKEER 139
           L  L+ +   L++ R
Sbjct: 131 LLELMQNPALLEDHR 145

>Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 71/134 (52%), Gaps = 7/134 (5%)

Query: 13  SDTEVLVRDATANNSTN-PSRELLDDLADKSYNSVEFFEILDMLDKRI------NDKGKY 65
           S TE  V+ AT+ + T+  +  L+++++  +Y+     EI+ ++ KR+       +  + 
Sbjct: 13  SPTESKVKQATSEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNRRNSHRN 72

Query: 66  WRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRVKAKEL 125
              V K LT++ YL+  GS   + W + N+ +I+ L  F  +D   E + + IR  ++ L
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILENFHIQDVRDERKREEIRKLSRNL 132

Query: 126 TSLLMDEERLKEER 139
             LL D+  L+++R
Sbjct: 133 LELLQDDGLLEKQR 146

>Suva_7.533 Chr7 complement(929391..929933,930519..931655) [1680 bp,
           560 aa] {ON} YGR241C (REAL)
          Length = 560

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 60/125 (48%), Gaps = 11/125 (8%)

Query: 18  LVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRINDKGKYWRHVAKALTVLD 77
           LV+ AT      P ++ +D +   + N  EF EI D LD R++D    W  V KAL VL 
Sbjct: 8   LVKGATKIKMAPPKQKYVDPILMGTSNPREFQEITDALDVRLSDTA--WTIVYKALVVLH 65

Query: 78  YLVRFGSENCVI-WCQENLYIIKTLREFSHEDAGGEDEGK-------IIRVKAKELTSLL 129
            +++ G ++  +     NL + + LR+ SH      ++ K        ++V+ +E   L 
Sbjct: 66  LMIQQGEKDVTLRHYSHNLNVFQ-LRKISHTSKWSSNDMKALQKYDEYLKVRCEEYGRLH 124

Query: 130 MDEER 134
           MD  R
Sbjct: 125 MDHVR 129

>KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038C ENT4
           Protein of unknown function contains an N- terminal
           epsin- like domain
          Length = 225

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 78/142 (54%), Gaps = 11/142 (7%)

Query: 11  GYSDTEVLVRDAT-ANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRINDKGKYWR-- 67
           G S T++ V+ AT +N S   +  L+++L+  +Y+     EI +++ KR+ +     +  
Sbjct: 11  GQSTTQLKVKQATDSNESYGATGTLMNELSVLTYSEKSANEIYEVIRKRLMNGSSRLKNS 70

Query: 68  -----HVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRVKA 122
                 V K LT+++YL+  GSE  V+W + +L  I+ L+++    +  +D+ K+ ++K+
Sbjct: 71  HDSVVQVLKTLTLIEYLLYNGSEEFVLWMRRHLAYIEALKDY--HCSNDKDKSKVKQIKS 128

Query: 123 -KELTSLLMDEERLKEERAMNI 143
             E  S  + E+   E+R ++I
Sbjct: 129 LSEDISKNLKEDDFLEKRRLDI 150

>YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}
           YAP1801Protein involved in clathrin cage assembly; binds
           Pan1p and clathrin; homologous to Yap1802p, member of
           the AP180 protein family
          Length = 637

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 49/96 (51%), Gaps = 7/96 (7%)

Query: 18  LVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRINDKGKYWRHVAKALTVLD 77
           LV+ AT   S  P ++ LD +   + N  +F+EI+  LD RIND    W  V K+L V+ 
Sbjct: 7   LVKGATKIKSAPPKQKYLDPILLGTSNEEDFYEIVKGLDSRINDTA--WTIVYKSLLVVH 64

Query: 78  YLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGED 113
            ++R GS++  +      Y  + L  F  E+  G +
Sbjct: 65  LMIREGSKDVALR-----YYSRNLEFFDIENIRGSN 95

>NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4.17
           YLL038C
          Length = 267

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 68/139 (48%), Gaps = 8/139 (5%)

Query: 9   VKGY--SDTEVLVRDATANNST-NPSRELLDDLADKSYNSVEFFEILDMLDKRINDKGKY 65
           VK +  S TE  V+ AT  + T   +  L+++++  +Y+     EI+ +L KR++   + 
Sbjct: 7   VKSFVQSPTESKVKQATNEDETMGATGTLMNEISVLTYSPKTLKEIVQVLKKRLSGYSRK 66

Query: 66  WRH-----VAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120
             H     + K LT++ YL+  GS   V W + N  +I  L     E    +  G  I+ 
Sbjct: 67  TSHKNCIFIIKTLTLMAYLINNGSNEFVAWIRNNSSLISNLISEKVEYPKDDKMGPEIKS 126

Query: 121 KAKELTSLLMDEERLKEER 139
            A +L  L+ D++ L+E R
Sbjct: 127 IAADLMELIQDDDLLEERR 145

>CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038c ENT4
          Length = 260

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 62/117 (52%), Gaps = 8/117 (6%)

Query: 4   SAKNIVKGY--SDTEVLVRDATANNS-TNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60
           S  +  KG+  S TE+ VR AT +N     +  L+++++  +Y+     +++ ++ KR++
Sbjct: 2   SLMHTFKGFLLSPTELKVRQATDDNELAGATGTLMNEISVLTYSKKTLKDVIQVIRKRLS 61

Query: 61  -----DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGE 112
                +  +   HV K LT++ YL+  GS + + W + + Y+I+ L  F  + +  E
Sbjct: 62  GVNKRNSHRTCLHVLKTLTLVSYLLNNGSNDFIAWLKSSKYVIEYLSSFEAQSSSDE 118

>Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON}
           YHR161C (REAL)
          Length = 621

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 47/94 (50%), Gaps = 7/94 (7%)

Query: 18  LVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRINDKGKYWRHVAKALTVLD 77
           LV+ AT   S  P ++ LD +   + +  +F+EI+  LD R+ND    W  V K L V+ 
Sbjct: 7   LVKGATKIKSAPPKQKYLDPILLATGSEEDFYEIVKALDSRVNDTA--WTIVYKTLLVVH 64

Query: 78  YLVRFGSENCVIWCQENLYIIKTLREFSHEDAGG 111
            ++R G ++  +      Y  + L  FS E+  G
Sbjct: 65  LMMREGKKDVALR-----YYSRNLEFFSIENIRG 93

>NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON}
           Anc_4.17 YLL038C
          Length = 310

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 83/153 (54%), Gaps = 17/153 (11%)

Query: 1   MLRSAKNIVKGYSDTEVLVRDATANN-STNPSRELLDDLADKSYNSVEFFEILDMLDKRI 59
           +  + KN V+  + TE  V+ AT +N +T  +  L+++++  +Y+     +I+ ++ KR+
Sbjct: 3   LFDTVKNFVQ--TPTESKVKQATDDNETTGATGTLMNEISVLTYSPKTLKDIIQVIKKRL 60

Query: 60  ND---KGKYWRH-----VAKALTVLDYLVRFGSENCVIWCQENLYIIKTLRE---FSHED 108
           +      K   H     + K LT++ YL+  GS   + W + N Y+++ + +   F  +D
Sbjct: 61  SSATSSNKKLSHKTSVYIIKTLTLISYLINNGSNEFIEWLRLNFYLVENITKKCNFQLQD 120

Query: 109 AGGEDE--GKIIRVKAKELTSLLMDEERLKEER 139
              + +  G+ I+V A+++T+L+ +E  L++ R
Sbjct: 121 NSADSKMIGQ-IKVIAEDMTNLINNENLLEQRR 152

>SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly
           similar to uniprot|P53309 Saccharomyces cerevisiae
           YGR241C YAP1802 Yeast Assembly Polypeptide, member of
           AP180 protein family, binds Pan1p and clathrin; member
           of clathrin assembly polypeptide AP180 family and weakly
           similar to uniprot|P38856 Saccharomyces cerevisiae
           YHR161C YAP1801 Yeast Assembly Polypeptide member of
           AP180 protein family binds Pan1p and clathrin clathrin
           assembly protein
          Length = 669

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 47/97 (48%), Gaps = 4/97 (4%)

Query: 18  LVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRINDKGKYWRHVAKALTVLD 77
           LV+ AT      P ++ +D +   + +S EF EI+  L+ RIND    W  V K+L V+ 
Sbjct: 7   LVKGATKIKMAPPKQKYIDPILLGTSDSSEFMEIMKALESRINDTA--WTIVYKSLIVIH 64

Query: 78  YLVRFGSENCVI-WCQENLYIIKTLREFSHEDAGGED 113
            ++R G  +  I +   +L   + LR+  H      D
Sbjct: 65  LMMRDGDRDVTIKYLSHHLEFFQ-LRDVFHSKLSSGD 100

>KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17
           YLL038C
          Length = 275

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 80/155 (51%), Gaps = 17/155 (10%)

Query: 4   SAKNIVKGYSDTEVLVRDATANNSTNPSR-ELLDDLADKSYNSVEFFEILDMLDKRI--- 59
           S +N+V  YS TE+ VR AT  N    S   L+++++  +Y++    EI+ +L K++   
Sbjct: 6   SVRNLV--YSQTELKVRQATDENEIIRSTGTLMNEISVLTYSAKTLKEIIGILKKKLSLL 63

Query: 60  ----NDKG----KYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGG 111
               N  G    K    V K  T++ YL+  GS + + W + N  +++ L +    +   
Sbjct: 64  YGLKNGNGIISHKVCVQVLKTFTLISYLLNNGSNDFINWLKLNNGVLQILAKVDSNNHIT 123

Query: 112 EDEGKIIRVKAKELTS---LLMDEERLKEERAMNI 143
           +DE   I  +A+++T    LL+++ +L E+R  ++
Sbjct: 124 DDEDLHILNQAQKITKDIILLINDNKLLEKRRKDV 158

>NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8.335
           YDR153C
          Length = 418

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 74/169 (43%), Gaps = 31/169 (18%)

Query: 3   RSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRINDK 62
           R A+N++  Y   +V +R AT  ++  P+ + L  +    Y  V  + +++   KR+ D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLQKVLRNRY-QVPLYLMVEYTLKRLVDH 79

Query: 63  -------------------GKYWRHVAKALTVLDYL---VRFGSE-NCVIWCQENLYIIK 99
                              G  WR V K LTV++YL   V  G E N V+ C +    I 
Sbjct: 80  IAVKPKNFYERARKEYVNYGAEWRVVLKCLTVVEYLMLNVDDGDELNQVVRCLDTHKHIL 139

Query: 100 TLREFSHEDAGGEDEGKI------IRVKAKELTSLLMDEERLKEERAMN 142
           T RE      G  ++GK+      IR K +++   L D   LK+ER  N
Sbjct: 140 T-REIPMYKVGFSNDGKMEIHERGIRKKGEDILQYLEDPSFLKQERLKN 187

>Suva_7.536 Chr7 complement(930822..931655) [834 bp, 278 aa] {ON}
           YGR241C (REAL)
          Length = 278

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 60/125 (48%), Gaps = 11/125 (8%)

Query: 18  LVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRINDKGKYWRHVAKALTVLD 77
           LV+ AT      P ++ +D +   + N  EF EI D LD R++D    W  V KAL VL 
Sbjct: 8   LVKGATKIKMAPPKQKYVDPILMGTSNPREFQEITDALDVRLSDTA--WTIVYKALVVLH 65

Query: 78  YLVRFGSENCVI-WCQENLYIIKTLREFSHEDAGGEDEGK-------IIRVKAKELTSLL 129
            +++ G ++  +     NL + + LR+ SH      ++ K        ++V+ +E   L 
Sbjct: 66  LMIQQGEKDVTLRHYSHNLNVFQ-LRKISHTSKWSSNDMKALQKYDEYLKVRCEEYGRLH 124

Query: 130 MDEER 134
           MD  R
Sbjct: 125 MDHVR 129

>Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 59/113 (52%), Gaps = 7/113 (6%)

Query: 13  SDTEVLVRDATANNSTN-PSRELLDDLADKSYNSVEFFEILDMLDKRI------NDKGKY 65
           S TE  V+ AT  + T+  +  L+++++  +Y+     EI+ ++ KR+       +  + 
Sbjct: 13  SPTESKVKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVVRKRLLLGQNRRNSHRN 72

Query: 66  WRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKII 118
              V K LT++ YL+  GS   + W + N+ +++ L +F  +DA  E + + I
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKSNMILVEILEDFQVQDARDERKAEDI 125

>Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON}
           YHR161C (REAL)
          Length = 627

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 49/96 (51%), Gaps = 7/96 (7%)

Query: 18  LVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRINDKGKYWRHVAKALTVLD 77
           LV+ AT   S  P ++ LD +   + +  +F+EI+  L+ RIND    W  V K+L V+ 
Sbjct: 7   LVKGATKIKSAPPKQKYLDPILLGTSSEEDFYEIVKGLNFRINDTA--WTIVYKSLLVVH 64

Query: 78  YLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGED 113
            ++R G+++  +      Y  + L  F  E+  G +
Sbjct: 65  LMIREGAKDVALR-----YYSRNLEFFDIENIRGSN 95

>NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {ON}
           Anc_8.335 YDR153C
          Length = 416

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 73/169 (43%), Gaps = 31/169 (18%)

Query: 3   RSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRINDK 62
           R A+N++  Y   +V +R AT  ++  P+ + L  +    Y  V  + +++   KR+ D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLSKVLRNRY-QVPLYLMVEYTLKRLVDH 79

Query: 63  -------------------GKYWRHVAKALTVLDYLVRFGSE----NCVIWCQENLYIIK 99
                              G  WR V K L V+D+L+   SE    N V+ C      I 
Sbjct: 80  IASRPKNFYEKARKEYVNYGAEWRVVLKCLVVIDFLILNVSEGDELNQVLSCLTTHKHIL 139

Query: 100 TLREFSHEDAGGEDEGKI------IRVKAKELTSLLMDEERLKEERAMN 142
           T RE  +      ++GK+      IR K +++   + D   LK+ER+ N
Sbjct: 140 T-REIPNFKVKFSNDGKMEIHERGIRKKGEDILQYMEDPHFLKKERSKN 187

>YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}
           ENT4Protein of unknown function, contains an N-terminal
           epsin-like domain; proposed to be involved in the
           trafficking of Arn1p in the absence of ferrichrome
          Length = 247

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 59/114 (51%), Gaps = 7/114 (6%)

Query: 13  SDTEVLVRDATANNSTN-PSRELLDDLADKSYNSVEFFEILDMLDKRI------NDKGKY 65
           S TE  V+ AT  + T+  +  L+++++  +Y+     EI+ ++ KR+       +  + 
Sbjct: 13  SPTESKVKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNRRNSHRN 72

Query: 66  WRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIR 119
              V K LT++ YL+  GS   + W + N+ +I+ L +F  +D   E + + I+
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQVQDPRDERKAEDIQ 126

>Skud_7.575 Chr7 complement(949623..951323) [1701 bp, 566 aa] {ON}
           YGR241C (REAL)
          Length = 566

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 56/125 (44%), Gaps = 11/125 (8%)

Query: 18  LVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRINDKGKYWRHVAKALTVLD 77
           LV+ AT      P ++ +D +   + N+    EI   LD R++D    W  V KAL VL 
Sbjct: 8   LVKGATKIKMAPPKQKYVDPILSGTSNARGLQEITHALDTRLSDTA--WTIVYKALIVLH 65

Query: 78  YLVRFGSENCVI-WCQENLYIIKTLREFSHEDAGGEDEGK-------IIRVKAKELTSLL 129
            +++ G  +  +     NL + + LR+ SH      ++ K        ++ + +E   L 
Sbjct: 66  LMIQQGERDVTLRHYSHNLEVFQ-LRKISHTSKWSSNDMKALQRYDEYLKARCEEYGRLG 124

Query: 130 MDEER 134
           MD  R
Sbjct: 125 MDHLR 129

>TBLA0B05770 Chr2 complement(1364772..1366814) [2043 bp, 680 aa]
           {ON} Anc_5.84 YGR241C
          Length = 680

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 55/123 (44%), Gaps = 8/123 (6%)

Query: 18  LVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRINDKGKYWRHVAKALTVLD 77
           LV+ AT      P ++ +D +   S +  +F EI+  L  RI+D    W  V K+L V  
Sbjct: 7   LVKGATKIKMAPPKQKYIDPILMGSTDPRDFHEIIRALYSRISDSA--WTVVYKSLIVTH 64

Query: 78  YLVRFGSENCVI-WCQENLYIIK----TLREFSHEDAGG-EDEGKIIRVKAKELTSLLMD 131
            L+R G ++  + +   NL           +FS  D    E   + + V+AKE  +  +D
Sbjct: 65  LLIREGEKDITLDYLSNNLDFFNLNGINTSKFSSGDVRALERYNQYLLVRAKEFKNFRID 124

Query: 132 EER 134
             R
Sbjct: 125 FIR 127

>Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON}
           complement(20765..21919) [1155 nt, 385 aa]
          Length = 384

 Score = 38.5 bits (88), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 74/169 (43%), Gaps = 31/169 (18%)

Query: 3   RSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRINDK 62
           R  +N++  Y   ++ +R AT  ++  P+ + L  +    Y SV  + + + + KRI D 
Sbjct: 21  RFMQNMIVQYEPYQIDIRRATNTDAWGPTTKHLQKVIRNKY-SVPLYLMTEYVLKRIVDH 79

Query: 63  -------------------GKYWRHVAKALTVLDYLVRFGSE----NCVIWCQENLY--- 96
                              G  WR + K L V++YL+   SE    N V  C EN     
Sbjct: 80  LAKRPKNLYEKARKEYVNYGSEWRIILKCLIVIEYLLLNVSEPEELNQVKSCLENHKQIF 139

Query: 97  ---IIKTLREFSHEDAGGEDEGKIIRVKAKELTSLLMDEERLKEERAMN 142
              I+    EF + D   E   + I+ K + + +L+ D E L+EER+ N
Sbjct: 140 NSNILNYKIEFCN-DGKMEVHERGIQKKCEVIINLVDDPEFLREERSKN 187

>KLLA0D16654g Chr4 complement(1413507..1414706) [1200 bp, 399 aa]
           {ON} similar to uniprot|Q6Q5U2 Saccharomyces cerevisiae
           YDR153C ENT5 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p clathrin adaptor complex AP-1 and
           clathrin
          Length = 399

 Score = 38.5 bits (88), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 74/166 (44%), Gaps = 29/166 (17%)

Query: 3   RSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFF-------EILDML 55
           R A+N++  Y   ++ +R AT  +S  P+ + L  +    Y    F         ++D +
Sbjct: 21  RFAQNVIVQYEPYQIDIRRATNTDSWGPTPKHLAKVMRHRYEVSMFLMTEYTLKRLVDHM 80

Query: 56  DKRINDK-----------GKYWRHVAKALTVLDYLV----RFGSENCVIWC-QENLYII- 98
            KR  +            G  WR V K L +L+YL+    R    + V+ C Q + +I+ 
Sbjct: 81  AKRPKNMYEKARKQYVNYGNEWRVVLKCLVLLEYLLMRSDRGKETDQVLSCLQAHKHILT 140

Query: 99  -KTLR---EFSHEDAGGEDEGKIIRVKAKELTSLLMDEERLKEERA 140
            +T++   +FS  D   E   + I+ K + +  L+ D   LK ER+
Sbjct: 141 KETMQYRVDFS-SDGKMELHERGIKKKCEHIIQLIEDTSYLKRERS 185

>TDEL0G01080 Chr7 (220997..222544) [1548 bp, 515 aa] {ON} Anc_5.84
           YGR241C
          Length = 515

 Score = 38.1 bits (87), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 56/124 (45%), Gaps = 9/124 (7%)

Query: 18  LVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRINDKGKYWRHVAKALTVLD 77
           LV+ AT      P  + ++ +   + +  EF EI+  LD RI+D    W  V K+L V+ 
Sbjct: 7   LVKGATKIKMAPPKPKYIEPILLGTTDPAEFREIVRALDTRISDTA--WTIVYKSLIVVH 64

Query: 78  YLVRFGSENCVI-WCQENLY------IIKTLREFSHEDAGGEDEGKIIRVKAKELTSLLM 130
            + R G  N  I +  ++L       I K+ +  S +    E   + +R + KE  +  +
Sbjct: 65  LMFRDGDRNVAIRYYSDHLSFFQLSEITKSAKWASGDIRALERYNQYLRTRCKEYANTGI 124

Query: 131 DEER 134
           D  R
Sbjct: 125 DYVR 128

>ZYRO0F13508g Chr6 complement(1114200..1116263) [2064 bp, 687 aa]
          {ON} weakly similar to uniprot|P53309 Saccharomyces
          cerevisiae YGR241C YAP1802 Yeast Assembly Polypeptide,
          member of AP180 protein family, binds Pan1p and
          clathrin; member of clathrin assembly polypeptide AP180
          family and weakly similar to uniprot|P38856
          Saccharomyces cerevisiae YHR161C YAP1801 Yeast Assembly
          Polypeptide member of AP180 protein family binds Pan1p
          and clathrin clathrin assembly protein
          Length = 687

 Score = 38.1 bits (87), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 38/72 (52%), Gaps = 2/72 (2%)

Query: 18 LVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRINDKGKYWRHVAKALTVLD 77
          LV+ AT      P ++ ++ +   + +  +F EI   LD+RI+D    W  V K+L +L 
Sbjct: 7  LVKGATKIKMAPPKQKYVEPILLGTTDPHDFSEIAKALDERISDTA--WTIVYKSLMLLH 64

Query: 78 YLVRFGSENCVI 89
           ++R G +N  +
Sbjct: 65 LMIREGEKNVAL 76

>KAFR0B05800 Chr2 complement(1200666..1201814) [1149 bp, 382 aa]
           {ON} Anc_8.335 YDR153C
          Length = 382

 Score = 37.7 bits (86), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 76/169 (44%), Gaps = 31/169 (18%)

Query: 3   RSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRINDK 62
           R A+N++  Y   ++ VR AT  ++  P+ + L+ +    +  V  + + + + KR+ D 
Sbjct: 21  RFAQNVIVQYEPYQIDVRRATNTDAWGPTTKHLEKVMRNRF-QVPMYLVTEYILKRLIDH 79

Query: 63  -------------------GKYWRHVAKALTVLDYL---VRFGSE-----NCVIWCQENL 95
                              G  WR V K LTV++YL   V  G E     +C++  +  L
Sbjct: 80  IATKPKNLYEKARKEYVNYGSEWRVVLKCLTVIEYLLLNVNDGDELNQIKSCLLTHKHIL 139

Query: 96  Y--IIKTLREFSHEDAGGEDEGKIIRVKAKELTSLLMDEERLKEERAMN 142
              ++    +FS+ D   E   + IR K +++  +L D   LK+ER  N
Sbjct: 140 TREVLNFKIKFSN-DGKMEVHERSIRKKGEKILQMLDDSRFLKQERLAN 187

>YGR241C Chr7 complement(974875..976581) [1707 bp, 568 aa] {ON}
           YAP1802Protein involved in clathrin cage assembly; binds
           Pan1p and clathrin; homologous to Yap1801p, member of
           the AP180 protein family
          Length = 568

 Score = 38.1 bits (87), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 55/124 (44%), Gaps = 9/124 (7%)

Query: 18  LVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRINDKGKYWRHVAKALTVLD 77
           LV+ AT      P ++ +D +   + ++    EI   LD R++D    W  V KAL VL 
Sbjct: 8   LVKGATKIKMAPPKQKYVDPILSGTSSARGLQEITHALDIRLSDTA--WTIVYKALIVLH 65

Query: 78  YLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGK-------IIRVKAKELTSLLM 130
            +++ G ++  +    +   +  LR+ SH      ++ +        ++ + +E   L M
Sbjct: 66  LMIQQGEKDVTLRHYSHNLDVFQLRKISHTTKWSSNDMRALQRYDEYLKTRCEEYGRLGM 125

Query: 131 DEER 134
           D  R
Sbjct: 126 DHLR 129

>KLTH0G11902g Chr7 (1002588..1003787) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q6Q5U2 Saccharomyces cerevisiae YDR153C ENT5
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p clathrin adaptor complex AP-1 and clathrin
          Length = 399

 Score = 37.7 bits (86), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 75/174 (43%), Gaps = 41/174 (23%)

Query: 3   RSAKNIVKGYSDTEVLVRDATANNSTNPS------------------------RELLDDL 38
           R A+N++  Y   +V +R AT  +S  P+                        + L+D +
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKYQVPLHLMTEYTLKRLVDHI 80

Query: 39  ADKSYNSVEFFEILDMLDKRINDKGKYWRHVAKALTVLDYL---VRFGSE-----NCVIW 90
           A +  N   F+E      K+  + G  WR V K L VL+YL   V  GSE     +C++ 
Sbjct: 81  ASRPKN---FYE---KARKQYVNYGSEWRVVLKCLVVLEYLLLNVDNGSELDQVTSCLLT 134

Query: 91  CQENLY--IIKTLREFSHEDAGGEDEGKIIRVKAKELTSLLMDEERLKEERAMN 142
            +  L   +++   +FS  D   E   + I+ K +++   + D   LK ERA +
Sbjct: 135 HKHILTRDVMQFRVDFS-ADGKMEVHERGIKKKCEQMIQYIEDPAYLKRERAKH 187

>Smik_16.65 Chr16 (120202..121899) [1698 bp, 565 aa] {ON} YGR241C
           (REAL)
          Length = 565

 Score = 37.7 bits (86), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 42/89 (47%), Gaps = 2/89 (2%)

Query: 18  LVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRINDKGKYWRHVAKALTVLD 77
           LV+ AT      P ++ +D +   + +     EI   LD R++D    W  V KAL V+ 
Sbjct: 8   LVKGATKIKMAPPKQKYVDPILSGTSSGRGLQEITHALDIRLSDTA--WTIVYKALIVMH 65

Query: 78  YLVRFGSENCVIWCQENLYIIKTLREFSH 106
            +++ G +N  +    +   +  LR+ SH
Sbjct: 66  LMIQQGEKNVTLRHYSHNLDVFQLRKISH 94

>Kwal_YGOB_27.11261 s27 complement(716644..717033,717035..717859)
           [1215 bp, 404 aa] {ON} ANNOTATED BY YGOB -
          Length = 404

 Score = 37.7 bits (86), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 70/171 (40%), Gaps = 39/171 (22%)

Query: 3   RSAKNIVKGYSDTEVLVRDATANNSTNPS------------------------RELLDDL 38
           R A+N++  Y   +V +R AT  +S  P+                        + L+D +
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKYQVPLHLMTEYTLKRLVDHI 80

Query: 39  ADKSYNSVEFFEILDMLDKRINDKGKYWRHVAKALTVLDYL---VRFGSE-NCVIWC--Q 92
           A +  N      + +   K+  + G  WR V K L VL+YL   V  GSE + VI C   
Sbjct: 81  ASRPKN------LYEKARKQYVNYGNEWRVVLKCLVVLEYLLLNVDSGSEVDQVIGCLTT 134

Query: 93  ENLYIIKTLREFS---HEDAGGEDEGKIIRVKAKELTSLLMDEERLKEERA 140
               + + + +F      D   E   + I+ K +++   L D   LK ERA
Sbjct: 135 HKRILSRDVMQFRVDFSADGKMEVHERGIKKKCEQILQYLEDPSYLKRERA 185

>NDAI0A02830 Chr1 (636619..638040) [1422 bp, 473 aa] {ON} Anc_5.84
           YGR241C
          Length = 473

 Score = 37.4 bits (85), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 28/121 (23%), Positives = 57/121 (47%), Gaps = 8/121 (6%)

Query: 18  LVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRINDKGKYWRHVAKALTVLD 77
           LV+ AT      P ++ +D +   + N++EF +I+  L  RIN+    W  + K L V+ 
Sbjct: 7   LVKGATKIKMAPPKQKYVDPILLGTSNNIEFQQIVSELTSRINN-CNIWSVIYKTLIVVH 65

Query: 78  YLVRFGSENCVI-WCQENL------YIIKTLREFSHEDAGGEDEGKIIRVKAKELTSLLM 130
            ++  G  N  + +  +NL       I+ + +  S++    E   + I+++ +E     +
Sbjct: 66  LMISIGEPNVTLRYFSKNLNFFDIKRILNSSKWSSNDLKALERYDRYIKIRCREFGKFKI 125

Query: 131 D 131
           D
Sbjct: 126 D 126

>ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|Q6Q5U2 Saccharomyces
           cerevisiae YDR153C ENT5 Protein containing an N-terminal
           epsin-like domain involved in clathrin recruitment and
           traffic between the Golgi and endosomes associates with
           the clathrin adaptor Gga2p clathrin adaptor complex AP-1
           and clathrin
          Length = 407

 Score = 37.4 bits (85), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 75/170 (44%), Gaps = 31/170 (18%)

Query: 3   RSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRINDK 62
           R A+N++  Y   +V VR AT  +S  P+ + L+ +    Y  V  + I +   KR+ D 
Sbjct: 21  RFAQNMIVQYEPYQVDVRRATNTDSWGPTPKHLEKVLRNRY-QVPMYLITEYTLKRLIDH 79

Query: 63  -------------------GKYWRHVAKALTVLDYL---VRFGSE-----NCVIWCQENL 95
                              G  WR V K LTV++YL   V  G E     +C+   +  L
Sbjct: 80  IATRPKNFYEKARKEYVNYGSEWRVVLKCLTVVEYLLLNVSDGDELNQVRSCLTTHKHIL 139

Query: 96  Y--IIKTLREFSHEDAGGEDEGKIIRVKAKELTSLLMDEERLKEERAMNI 143
              +++   +FS+ D   E   + I+ K + +  +L D + LK ER  ++
Sbjct: 140 SREVLEYRVKFSN-DGKMEVHERGIKKKCEFIIQMLEDSQFLKRERQKHV 188

>KNAG0A05100 Chr1 (744989..746254) [1266 bp, 421 aa] {ON} Anc_8.335
           YDR153C
          Length = 421

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 67/168 (39%), Gaps = 29/168 (17%)

Query: 3   RSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRINDK 62
           R A+N++  Y   +V +R AT  ++  P+ + L  +    Y  V  + + + + KR+ D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLSKVLRHRYQ-VPMYLMTEYILKRLVDH 79

Query: 63  -------------------GKYWRHVAKALTVLDYL---VRFGSENCVIWCQENLYIIKT 100
                              G  WR V K LTV+++L   V  G E   I      +    
Sbjct: 80  IATRPKNLYEKARKDYVNYGAEWRVVLKCLTVIEFLMLNVDEGDELNQIRSSLQTHKHIL 139

Query: 101 LREFSHEDAGGEDEGKI------IRVKAKELTSLLMDEERLKEERAMN 142
            RE +       ++GK+      IR K + +   + D   LK ER  N
Sbjct: 140 TREVAQYRVKFSNDGKMEVHERGIRKKGETIVQFMEDPHFLKRERNKN 187

>TBLA0A04040 Chr1 complement(1004703..1005950) [1248 bp, 415 aa]
           {ON} Anc_8.335 YDR153C
          Length = 415

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 71/166 (42%), Gaps = 31/166 (18%)

Query: 3   RSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRINDK 62
           R A+N++  Y   ++ +R AT  ++  P+ + L  +    Y  V  + + + + KRI D 
Sbjct: 21  RFAQNVIVQYEPYQIDIRRATNTDAWGPTSKHLAKVLRNRYQ-VPLYLMTEYILKRIVDH 79

Query: 63  -------------------GKYWRHVAKALTVLDYL---VRFGSE-NCVIWCQENLYIIK 99
                              G  WR V K L V+D+L   V  G E N V  C      I 
Sbjct: 80  IAVRPKNFYEKARKDYVNYGAEWRVVLKCLVVIDFLFLNVEEGEELNQVKSCMLTHKHIL 139

Query: 100 TLREFSHE-----DAGGEDEGKIIRVKAKELTSLLMDEER-LKEER 139
           T +  S++     D   E   + IR K+ EL    MD+ R L+EER
Sbjct: 140 TSQVASYKIPFSNDGKMEIHERGIRKKS-ELILQYMDDPRFLREER 184

>CAGL0E01199g Chr5 (108041..109279) [1239 bp, 412 aa] {ON} similar
           to uniprot|Q03769 Saccharomyces cerevisiae YDR153c ENT5
          Length = 412

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 73/169 (43%), Gaps = 31/169 (18%)

Query: 3   RSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRINDK 62
           R A+N++  Y   +V VR AT  +S  P+ + L  +    Y  V  + I + + KR+ D 
Sbjct: 21  RFAQNVIVQYEPYQVDVRRATNTDSWGPTPKHLAKVLRNRYQ-VPLYLITEYILKRLIDH 79

Query: 63  -------------------GKYWRHVAKALTVLDYL---VRFGSE-NCVIWC---QENLY 96
                              G  WR V K L V++YL   V  G E N V  C    ++L 
Sbjct: 80  IAQRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEYLLMNVDDGDEINQVRSCLLTHKHLI 139

Query: 97  IIKTLR---EFSHEDAGGEDEGKIIRVKAKELTSLLMDEERLKEERAMN 142
             + L    +FS+ D   E   + IR K + +   + D + LK+ER  N
Sbjct: 140 SKEVLNFKIKFSN-DGKMEVHERGIRKKGELIMQFIEDSKFLKQERLKN 187

>NCAS0E03820 Chr5 (750631..751917) [1287 bp, 428 aa] {ON} Anc_5.84
           YGR241C
          Length = 428

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 41/90 (45%), Gaps = 6/90 (6%)

Query: 18  LVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRINDKGKYWRHVAKALTVLD 77
           LV+ AT      P ++ +D +   + N +EF +I+  L  RIN+    W  V K L V+ 
Sbjct: 7   LVKGATKVKMAPPKQKYVDPILLGTANPMEFEQIVSQLTARINN-CNIWSVVYKTLIVVH 65

Query: 78  YLVRFGSENCVIWCQENLYIIKTLREFSHE 107
            ++  G +   +      Y  K L  F+ E
Sbjct: 66  LMISIGEQGVTL-----RYFAKNLEFFNLE 90

>Kwal_27.11263 s27 complement(717032..717859) [828 bp, 275 aa] {OFF}
           YDR153C - Hypothetical ORF [contig 29] FULL
          Length = 275

 Score = 34.3 bits (77), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 71/171 (41%), Gaps = 39/171 (22%)

Query: 3   RSAKNIVKGYSDTEVLVRDATANNSTNPS------------------------RELLDDL 38
           R A+N++  Y   +V +R AT  +S  P+                        + L+D +
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKYQVPLHLMTEYTLKRLVDHI 80

Query: 39  ADKSYNSVEFFEILDMLDKRINDKGKYWRHVAKALTVLDYL---VRFGSE-NCVIWC--Q 92
           A +  N      + +   K+  + G  WR V K L VL+YL   V  GSE + VI C   
Sbjct: 81  ASRPKN------LYEKARKQYVNYGNEWRVVLKCLVVLEYLLLNVDSGSEVDQVIGCLTT 134

Query: 93  ENLYIIKTLREFSHE---DAGGEDEGKIIRVKAKELTSLLMDEERLKEERA 140
               + + + +F  +   D   E   + I+ K +++   L D   LK ERA
Sbjct: 135 HKRILSRDVMQFRVDFSADGKMEVHERGIKKKCEQILQYLEDPSYLKRERA 185

>KNAG0E00610 Chr5 complement(102826..104640) [1815 bp, 604 aa] {ON}
           Anc_5.84 YGR241C
          Length = 604

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 13/13 (100%), Positives = 13/13 (100%)

Query: 295 LPTGSNNPFALNN 307
           LPTGSNNPFALNN
Sbjct: 448 LPTGSNNPFALNN 460

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,810,762
Number of extensions: 1374670
Number of successful extensions: 3570
Number of sequences better than 10.0: 110
Number of HSP's gapped: 3603
Number of HSP's successfully gapped: 158
Length of query: 447
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 334
Effective length of database: 40,524,141
Effective search space: 13535063094
Effective search space used: 13535063094
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)