Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0C037907.350ON38238219450.0
Ecym_47237.350ON38138213760.0
KLTH0H01254g7.350ON38137813680.0
TBLA0E00390singletonON38338113600.0
NCAS0A141607.350ON45138113610.0
KLLA0D12342g7.350ON38437813530.0
Kwal_56.246427.350ON38138413520.0
TDEL0C019807.350ON38538013470.0
Kpol_530.317.350ON38038213370.0
YDL168W (SFA1)7.350ON38638113330.0
Suva_4.787.350ON38538213310.0
Skud_4.897.350ON38538313230.0
ZYRO0F11704g7.350ON38238613210.0
Smik_4.707.350ON38638213160.0
ACL148C7.350ON38138213130.0
SAKL0F11374g7.350ON38338713120.0
CAGL0L01111g7.350ON38138513031e-180
KAFR0B008807.350ON38138412831e-177
TPHA0F029707.350ON38137812791e-176
NDAI0A018907.350ON42238711101e-150
SAKL0A00880gsingletonON3883849301e-123
KLLA0D19929gsingletonON3863081984e-16
KLLA0B00451gsingletonON3863081922e-15
YAL060W (BDH1)7.3ON3822121871e-14
Smik_1.67.3ON3822121871e-14
KLLA0F00506g7.3ON3852081809e-14
Skud_1.37.3ON3821981809e-14
Suva_1.77.3ON3822081745e-13
KLTH0D00616g7.3ON3822151728e-13
SAKL0B00814g8.16ON3543251692e-12
TBLA0A042907.3ON3951911682e-12
Kwal_55.19574singletonON3562121673e-12
TDEL0H044607.3ON3822101664e-12
Kwal_26.67397.3ON3821981631e-11
TBLA0I011402.480ON3772561576e-11
KLTH0D05588g2.480ON3892051577e-11
KAFR0I001607.2ON3851911496e-10
SAKL0D14894g7.2ON3851911452e-09
KLTH0G18986g8.16ON3543241443e-09
CAGL0J01441g2.480ON3722021443e-09
KNAG0K01040singletonON3913221443e-09
KAFR0A007902.480ON3773621434e-09
SAKL0D14872g7.3ON3832091425e-09
Kpol_1058.118.16ON3532001408e-09
Skud_20.2singletonON3573311408e-09
Skud_4.2singletonON3573311408e-09
Kwal_26.6684singletonON3561861381e-08
NCAS0I023503.118ON3513061381e-08
YJR159W (SOR1)na 1ON3573311381e-08
CAGL0D00198g7.3ON3833261382e-08
KLLA0F21010g3.118ON3502021372e-08
KLTH0G15686g3.118ON3511881372e-08
TDEL0C003908.16ON3532001372e-08
Kwal_47.17532na 2ON3733341363e-08
YDL246C (SOR2)singletonON3573311354e-08
CAGL0I07843g3.118ON3521851354e-08
Smik_48.1singletonON3573321354e-08
Kpol_431.82.480ON3802021345e-08
Ecym_53313.118ON3482031336e-08
NDAI0H020507.3ON3851941329e-08
Kpol_1049.187.2ON3862111301e-07
NDAI0H021602.480ON3812541301e-07
Skud_13.2402.480ON3752021302e-07
TBLA0E034403.118ON3513661292e-07
NCAS0A076707.2ON4392111302e-07
Suva_1.67.2ON4171911302e-07
NDAI0A069303.118ON3511851292e-07
Smik_2.2843.118ON3511831292e-07
YBR145W (ADH5)3.118ON3511831292e-07
Kwal_26.77992.480ON3871881292e-07
TPHA0G032102.480ON3772541292e-07
KNAG0I00120singletonON3811791282e-07
Suva_4.3943.118ON3511831282e-07
YOL086C (ADH1)3.118ON3483261273e-07
Suva_13.2612.480ON3752021273e-07
TBLA0E03430singletonON3513091264e-07
Suva_10.1548.16ON3563231264e-07
KLTH0E05588gna 3ON3482031264e-07
KNAG0K020003.118ON3503611264e-07
Suva_12.260singletonON3573311264e-07
KLLA0B09064gna 4ON3741851265e-07
AER032W3.118ON3512591255e-07
Smik_13.520na 5ON3483091255e-07
NCAS0A076607.3ON3862141256e-07
YMR083W (ADH3)2.480ON3752021256e-07
KAFR0G014203.118ON3512371256e-07
Kpol_1036.193.118ON3531851256e-07
ABR229C8.16ON3532181257e-07
YMR303C (ADH2)na 5ON3483091247e-07
Smik_13.2662.480ON3752021247e-07
Skud_2.2723.118ON3511831249e-07
AAR084WsingletonON3852021249e-07
NCAS0J003008.16ON3571881239e-07
NCAS0I01720singletonON3513711239e-07
Skud_13.477na 5ON3483091221e-06
Kwal_55.20564singletonON2161741191e-06
YLR070C (XYL2)8.16ON3563091221e-06
YAL061W (BDH2)7.2ON4171881221e-06
Smik_15.713.118ON3483091212e-06
Kwal_56.231983.118ON3512421212e-06
KLTH0E07964gna 2ON3743341212e-06
KLLA0F13530g2.480ON3752421212e-06
TDEL0D050503.118ON3511851202e-06
Suva_15.813.118ON3483261202e-06
SAKL0C10164g3.118ON3513661193e-06
TDEL0A025602.480ON3732021193e-06
Suva_13.494na 5ON3483091193e-06
KAFR0L02010singletonON3511971194e-06
SAKL0B08184gna 4ON3733181185e-06
KLLA0F18260gsingletonON3481851175e-06
Smik_1.57.2ON4171881185e-06
Skud_1.27.2ON4171881176e-06
Skud_15.683.118ON3483091176e-06
KLLA0D05511g8.16ON3542051168e-06
NCAS0A077802.480ON3732371168e-06
SAKL0F06270gna 3ON3513091159e-06
SAKL0E02838g2.480ON3771851151e-05
ZYRO0G03388g2.480ON3703061122e-05
TPHA0M007303.118ON3502451113e-05
SAKL0H22088gna 2ON3763261123e-05
ZYRO0G03410gsingletonON3733241113e-05
Ecym_73912.480ON3752041113e-05
KAFR0I001707.3ON381871113e-05
NDAI0H02950singletonON3633111104e-05
ZYRO0C12562gna 3ON3483091096e-05
KLTH0A00418gsingletonON3562011096e-05
KNAG0E025902.480ON3742091096e-05
ZYRO0B05940g3.118ON3793171088e-05
CAGL0M14047gna 6ON3593301061e-04
ZYRO0F02552g8.16ON3511921042e-04
KLLA0A10549g3.253ON3532421042e-04
TPHA0J00170singletonON3613041033e-04
NCAS0C03020singletonON3623151024e-04
Ecym_1093singletonON3833311024e-04
NDAI0A08470singletonON3633121015e-04
TDEL0F03190na 3ON3511861016e-04
SAKL0D14938gsingletonON3783321008e-04
KAFR0L02000singletonON361185990.001
NDAI0H020607.2ON39993940.004
KAFR0A08730singletonON360198930.005
NCAS0D01220na 7ON362295910.010
ABL033C2.480ON373184900.011
Kwal_56.229853.253ON346108890.018
KLLA0F00528g7.2ON38163890.019
TPHA0H03100singletonON392188840.065
NDAI0G04880singletonON361312810.15
KLLA0F00638gna 8ON382114800.22
KLTH0C10538gsingletonON27368770.39
YMR318C (ADH6)na 6ON360332770.42
Skud_13.494na 6ON360332750.72
TDEL0D037203.253ON335108750.74
Kpol_257.4singletonON36083750.88
TPHA0F02090singletonON360334750.93
Kpol_529.30na 6ON36083731.7
TPHA0A00140singletonON362305721.7
TDEL0A00140singletonON405119722.3
Suva_13.513na 6ON360332712.8
TBLA0A06640singletonON361291712.9
TDEL0E00230singletonON36270694.0
KLTH0C07854g3.253ON358238694.2
Kpol_1057.24na 9ON36068686.2
KNAG0E042007.2ON385188677.0
Suva_6.13singletonON6859618.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0C03790
         (382 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0C03790 Chr3 complement(745394..746542) [1149 bp, 382 aa] {O...   753   0.0  
Ecym_4723 Chr4 (1415078..1416223) [1146 bp, 381 aa] {ON} similar...   534   0.0  
KLTH0H01254g Chr8 (121076..122221) [1146 bp, 381 aa] {ON} highly...   531   0.0  
TBLA0E00390 Chr5 complement(71890..73041) [1152 bp, 383 aa] {ON}      528   0.0  
NCAS0A14160 Chr1 complement(2782022..2783377) [1356 bp, 451 aa] ...   528   0.0  
KLLA0D12342g Chr4 (1050181..1051335) [1155 bp, 384 aa] {ON} high...   525   0.0  
Kwal_56.24642 s56 complement(1085556..1086701) [1146 bp, 381 aa]...   525   0.0  
TDEL0C01980 Chr3 (344639..345796) [1158 bp, 385 aa] {ON} Anc_7.3...   523   0.0  
Kpol_530.31 s530 (77132..78274) [1143 bp, 380 aa] {ON} (77132..7...   519   0.0  
YDL168W Chr4 (159604..160764) [1161 bp, 386 aa] {ON}  SFA1Bifunc...   518   0.0  
Suva_4.78 Chr4 (147109..148266) [1158 bp, 385 aa] {ON} YDL168W (...   517   0.0  
Skud_4.89 Chr4 (155298..156455) [1158 bp, 385 aa] {ON} YDL168W (...   514   0.0  
ZYRO0F11704g Chr6 complement(958546..959694) [1149 bp, 382 aa] {...   513   0.0  
Smik_4.70 Chr4 (136242..137402) [1161 bp, 386 aa] {ON} YDL168W (...   511   0.0  
ACL148C Chr3 complement(90932..92077) [1146 bp, 381 aa] {ON} Syn...   510   0.0  
SAKL0F11374g Chr6 complement(885478..886629) [1152 bp, 383 aa] {...   509   0.0  
CAGL0L01111g Chr12 (133129..134274) [1146 bp, 381 aa] {ON} highl...   506   e-180
KAFR0B00880 Chr2 complement(164475..165620) [1146 bp, 381 aa] {O...   498   e-177
TPHA0F02970 Chr6 complement(653405..654550) [1146 bp, 381 aa] {O...   497   e-176
NDAI0A01890 Chr1 (425090..426358) [1269 bp, 422 aa] {ON} Anc_7.350    432   e-150
SAKL0A00880g Chr1 complement(92246..93412) [1167 bp, 388 aa] {ON...   362   e-123
KLLA0D19929g Chr4 (1694826..1695986) [1161 bp, 386 aa] {ON} weak...    81   4e-16
KLLA0B00451g Chr2 complement(31822..32982) [1161 bp, 386 aa] {ON...    79   2e-15
YAL060W Chr1 (35155..36303) [1149 bp, 382 aa] {ON}  BDH1NAD-depe...    77   1e-14
Smik_1.6 Chr1 (18115..19263) [1149 bp, 382 aa] {ON} YAL060W (REAL)     77   1e-14
KLLA0F00506g Chr6 complement(36518..37675) [1158 bp, 385 aa] {ON...    74   9e-14
Skud_1.3 Chr1 (11174..12322) [1149 bp, 382 aa] {ON} YAL060W (REAL)     74   9e-14
Suva_1.7 Chr1 (12310..13458) [1149 bp, 382 aa] {ON} YAL060W (REAL)     72   5e-13
KLTH0D00616g Chr4 (59883..61031) [1149 bp, 382 aa] {ON} similar ...    71   8e-13
SAKL0B00814g Chr2 (74565..75629) [1065 bp, 354 aa] {ON} similar ...    70   2e-12
TBLA0A04290 Chr1 (1063289..1064476) [1188 bp, 395 aa] {ON} Anc_7...    69   2e-12
Kwal_55.19574 s55 complement(32260..33330) [1071 bp, 356 aa] {ON...    69   3e-12
TDEL0H04460 Chr8 complement(769988..771136) [1149 bp, 382 aa] {O...    69   4e-12
Kwal_26.6739 s26 (46044..47192) [1149 bp, 382 aa] {ON} YAL060W (...    67   1e-11
TBLA0I01140 Chr9 (233777..234910) [1134 bp, 377 aa] {ON} Anc_2.4...    65   6e-11
KLTH0D05588g Chr4 complement(502176..503345) [1170 bp, 389 aa] {...    65   7e-11
KAFR0I00160 Chr9 (33043..34200) [1158 bp, 385 aa] {ON} Anc_7.2 Y...    62   6e-10
SAKL0D14894g Chr4 complement(1230497..1231654) [1158 bp, 385 aa]...    60   2e-09
KLTH0G18986g Chr7 complement(1639254..1640318) [1065 bp, 354 aa]...    60   3e-09
CAGL0J01441g Chr10 complement(134383..135501) [1119 bp, 372 aa] ...    60   3e-09
KNAG0K01040 Chr11 complement(204636..205811) [1176 bp, 391 aa] {...    60   3e-09
KAFR0A00790 Chr1 complement(140666..141799) [1134 bp, 377 aa] {O...    60   4e-09
SAKL0D14872g Chr4 complement(1226093..1227244) [1152 bp, 383 aa]...    59   5e-09
Kpol_1058.11 s1058 (41165..42226) [1062 bp, 353 aa] {ON} (41165....    59   8e-09
Skud_20.2 Chr20 (1588..2661) [1074 bp, 357 aa] {ON} YJR159W (REAL)     59   8e-09
Skud_4.2 Chr4 complement(6287..7360) [1074 bp, 357 aa] {ON} YJR1...    59   8e-09
Kwal_26.6684 s26 (21910..22980) [1071 bp, 356 aa] {ON} YJR159W (...    58   1e-08
NCAS0I02350 Chr9 (444097..445152) [1056 bp, 351 aa] {ON} Anc_3.118     58   1e-08
YJR159W Chr10 (736044..737117) [1074 bp, 357 aa] {ON}  SOR1Sorbi...    58   1e-08
CAGL0D00198g Chr4 (27559..28710) [1152 bp, 383 aa] {ON} similar ...    58   2e-08
KLLA0F21010g Chr6 (1962951..1964003) [1053 bp, 350 aa] {ON} unip...    57   2e-08
KLTH0G15686g Chr7 complement(1367997..1369052) [1056 bp, 351 aa]...    57   2e-08
TDEL0C00390 Chr3 (53995..55056) [1062 bp, 353 aa] {ON} Anc_8.16 ...    57   2e-08
Kwal_47.17532 s47 (444594..445715) [1122 bp, 373 aa] {ON} YMR318...    57   3e-08
YDL246C Chr4 complement(8683..9756) [1074 bp, 357 aa] {ON}  SOR2...    57   4e-08
CAGL0I07843g Chr9 complement(756345..757403) [1059 bp, 352 aa] {...    57   4e-08
Smik_48.1 Chr48 complement(1..1074) [1074 bp, 357 aa] {ON} YJR15...    57   4e-08
Kpol_431.8 s431 (21043..22185) [1143 bp, 380 aa] {ON} (21043..22...    56   5e-08
Ecym_5331 Chr5 (676233..677279) [1047 bp, 348 aa] {ON} similar t...    56   6e-08
NDAI0H02050 Chr8 complement(500914..502071) [1158 bp, 385 aa] {O...    55   9e-08
Kpol_1049.18 s1049 complement(35191..36351) [1161 bp, 386 aa] {O...    55   1e-07
NDAI0H02160 Chr8 (528551..529696) [1146 bp, 381 aa] {ON} Anc_2.480     55   1e-07
Skud_13.240 Chr13 (408909..410036) [1128 bp, 375 aa] {ON} YMR083...    55   2e-07
TBLA0E03440 Chr5 (852767..853822) [1056 bp, 351 aa] {ON} Anc_3.1...    54   2e-07
NCAS0A07670 Chr1 complement(1527273..1528592) [1320 bp, 439 aa] ...    55   2e-07
Suva_1.6 Chr1 (10591..11844) [1254 bp, 417 aa] {ON} YAL061W (REAL)     55   2e-07
NDAI0A06930 Chr1 (1585575..1586630) [1056 bp, 351 aa] {ON} Anc_3...    54   2e-07
Smik_2.284 Chr2 (518341..519396) [1056 bp, 351 aa] {ON} YBR145W ...    54   2e-07
YBR145W Chr2 (533762..534817) [1056 bp, 351 aa] {ON}  ADH5Alcoho...    54   2e-07
Kwal_26.7799 s26 complement(515580..516743) [1164 bp, 387 aa] {O...    54   2e-07
TPHA0G03210 Chr7 complement(688137..689270) [1134 bp, 377 aa] {O...    54   2e-07
KNAG0I00120 Chr9 (9352..10497) [1146 bp, 381 aa] {ON}                  54   2e-07
Suva_4.394 Chr4 (702935..703990) [1056 bp, 351 aa] {ON} YBR145W ...    54   2e-07
YOL086C Chr15 complement(159548..160594) [1047 bp, 348 aa] {ON} ...    54   3e-07
Suva_13.261 Chr13 (416378..417505) [1128 bp, 375 aa] {ON} YMR083...    54   3e-07
TBLA0E03430 Chr5 (850493..851548) [1056 bp, 351 aa] {ON}               53   4e-07
Suva_10.154 Chr10 complement(275737..276807) [1071 bp, 356 aa] {...    53   4e-07
KLTH0E05588g Chr5 complement(494815..495861) [1047 bp, 348 aa] {...    53   4e-07
KNAG0K02000 Chr11 (410263..411315) [1053 bp, 350 aa] {ON} Anc_3....    53   4e-07
Suva_12.260 Chr12 (427406..428479) [1074 bp, 357 aa] {ON} YJR159...    53   4e-07
KLLA0B09064g Chr2 complement(792849..793973) [1125 bp, 374 aa] {...    53   5e-07
AER032W Chr5 (696807..697862) [1056 bp, 351 aa] {ON} Syntenic ho...    53   5e-07
Smik_13.520 Chr13 complement(856008..857054) [1047 bp, 348 aa] {...    53   5e-07
NCAS0A07660 Chr1 complement(1525755..1526915) [1161 bp, 386 aa] ...    53   6e-07
YMR083W Chr13 (434788..435915) [1128 bp, 375 aa] {ON}  ADH3Mitoc...    53   6e-07
KAFR0G01420 Chr7 complement(314119..315174) [1056 bp, 351 aa] {O...    53   6e-07
Kpol_1036.19 s1036 (51276..52337) [1062 bp, 353 aa] {ON} (51276....    53   6e-07
ABR229C Chr2 complement(831895..832956) [1062 bp, 353 aa] {ON} S...    53   7e-07
YMR303C Chr13 complement(873291..874337) [1047 bp, 348 aa] {ON} ...    52   7e-07
Smik_13.266 Chr13 (418869..419996) [1128 bp, 375 aa] {ON} YMR083...    52   7e-07
Skud_2.272 Chr2 (501260..502315) [1056 bp, 351 aa] {ON} YBR145W ...    52   9e-07
AAR084W Chr1 (494021..495178) [1158 bp, 385 aa] {ON} Non-synteni...    52   9e-07
NCAS0J00300 Chr10 (43719..44792) [1074 bp, 357 aa] {ON} Anc_8.16       52   9e-07
NCAS0I01720 Chr9 (318144..319199) [1056 bp, 351 aa] {ON}               52   9e-07
Skud_13.477 Chr13 complement(846790..847836) [1047 bp, 348 aa] {...    52   1e-06
Kwal_55.20564 s55 complement(459253..459903) [651 bp, 216 aa] {O...    50   1e-06
YLR070C Chr12 complement(274141..275211) [1071 bp, 356 aa] {ON} ...    52   1e-06
YAL061W Chr1 (33448..34701) [1254 bp, 417 aa] {ON}  BDH2Putative...    52   1e-06
Smik_15.71 Chr15 complement(122645..123691) [1047 bp, 348 aa] {O...    51   2e-06
Kwal_56.23198 s56 (443881..444936) [1056 bp, 351 aa] {ON} YOL086...    51   2e-06
KLTH0E07964g Chr5 (735214..736338) [1125 bp, 374 aa] {ON} simila...    51   2e-06
KLLA0F13530g Chr6 (1251162..1252289) [1128 bp, 375 aa] {ON} unip...    51   2e-06
TDEL0D05050 Chr4 (921065..922120) [1056 bp, 351 aa] {ON} Anc_3.1...    51   2e-06
Suva_15.81 Chr15 complement(132739..133785) [1047 bp, 348 aa] {O...    51   2e-06
SAKL0C10164g Chr3 complement(914732..915787) [1056 bp, 351 aa] {...    50   3e-06
TDEL0A02560 Chr1 complement(462053..463174) [1122 bp, 373 aa] {O...    50   3e-06
Suva_13.494 Chr13 complement(856051..857097) [1047 bp, 348 aa] {...    50   3e-06
KAFR0L02010 Chr12 (379623..380678) [1056 bp, 351 aa] {ON}              50   4e-06
SAKL0B08184g Chr2 (698686..699807) [1122 bp, 373 aa] {ON} unipro...    50   5e-06
KLLA0F18260g Chr6 complement(1683417..1684463) [1047 bp, 348 aa]...    50   5e-06
Smik_1.5 Chr1 (16385..17638) [1254 bp, 417 aa] {ON} YAL061W (REAL)     50   5e-06
Skud_1.2 Chr1 (9513..10766) [1254 bp, 417 aa] {ON} YAL061W (REAL)      50   6e-06
Skud_15.68 Chr15 complement(118795..119841) [1047 bp, 348 aa] {O...    50   6e-06
KLLA0D05511g Chr4 complement(476363..477427) [1065 bp, 354 aa] {...    49   8e-06
NCAS0A07780 Chr1 (1548197..1549318) [1122 bp, 373 aa] {ON} Anc_2...    49   8e-06
SAKL0F06270g Chr6 (472877..473932) [1056 bp, 351 aa] {ON} simila...    49   9e-06
SAKL0E02838g Chr5 (226264..227397) [1134 bp, 377 aa] {ON} unipro...    49   1e-05
ZYRO0G03388g Chr7 complement(265952..267064) [1113 bp, 370 aa] {...    48   2e-05
TPHA0M00730 Chr13 complement(137798..138850) [1053 bp, 350 aa] {...    47   3e-05
SAKL0H22088g Chr8 (1934171..1935301) [1131 bp, 376 aa] {ON} simi...    48   3e-05
ZYRO0G03410g Chr7 complement(269170..270291) [1122 bp, 373 aa] {...    47   3e-05
Ecym_7391 Chr7 (801773..802900) [1128 bp, 375 aa] {ON} similar t...    47   3e-05
KAFR0I00170 Chr9 (34519..35664) [1146 bp, 381 aa] {ON} Anc_7.3 Y...    47   3e-05
NDAI0H02950 Chr8 complement(718762..719853) [1092 bp, 363 aa] {O...    47   4e-05
ZYRO0C12562g Chr3 (993434..994480) [1047 bp, 348 aa] {ON} highly...    47   6e-05
KLTH0A00418g Chr1 complement(34685..35755) [1071 bp, 356 aa] {ON...    47   6e-05
KNAG0E02590 Chr5 complement(513565..514689) [1125 bp, 374 aa] {O...    47   6e-05
ZYRO0B05940g Chr2 (480279..481418) [1140 bp, 379 aa] {ON} highly...    46   8e-05
CAGL0M14047g Chr13 complement(1386775..1387854) [1080 bp, 359 aa...    45   1e-04
ZYRO0F02552g Chr6 (203037..204092) [1056 bp, 351 aa] {ON} simila...    45   2e-04
KLLA0A10549g Chr1 (921022..922083) [1062 bp, 353 aa] {ON} highly...    45   2e-04
TPHA0J00170 Chr10 (40911..41996) [1086 bp, 361 aa] {ON}                44   3e-04
NCAS0C03020 Chr3 complement(593785..594873) [1089 bp, 362 aa] {O...    44   4e-04
Ecym_1093 Chr1 complement(195854..197005) [1152 bp, 383 aa] {ON}...    44   4e-04
NDAI0A08470 Chr1 (1954035..1955126) [1092 bp, 363 aa] {ON}             44   5e-04
TDEL0F03190 Chr6 (583849..584904) [1056 bp, 351 aa] {ON}  possib...    44   6e-04
SAKL0D14938g Chr4 complement(1235542..1236678) [1137 bp, 378 aa]...    43   8e-04
KAFR0L02000 Chr12 (378013..379098) [1086 bp, 361 aa] {ON}              43   0.001
NDAI0H02060 Chr8 complement(502872..504071) [1200 bp, 399 aa] {O...    41   0.004
KAFR0A08730 Chr1 complement(1747657..1748739) [1083 bp, 360 aa] ...    40   0.005
NCAS0D01220 Chr4 (223821..224909) [1089 bp, 362 aa] {ON}               40   0.010
ABL033C Chr2 complement(337866..338987) [1122 bp, 373 aa] {ON} S...    39   0.011
Kwal_56.22985 s56 complement(357501..358541) [1041 bp, 346 aa] {...    39   0.018
KLLA0F00528g Chr6 complement(40081..41226) [1146 bp, 381 aa] {ON...    39   0.019
TPHA0H03100 Chr8 complement(736924..738102) [1179 bp, 392 aa] {O...    37   0.065
NDAI0G04880 Chr7 complement(1175518..1176603) [1086 bp, 361 aa] ...    36   0.15 
KLLA0F00638g Chr6 (51849..52997) [1149 bp, 382 aa] {ON} weakly s...    35   0.22 
KLTH0C10538g Chr3 complement(873623..874444) [822 bp, 273 aa] {O...    34   0.39 
YMR318C Chr13 complement(911061..912143) [1083 bp, 360 aa] {ON} ...    34   0.42 
Skud_13.494 Chr13 complement(884038..885120) [1083 bp, 360 aa] {...    33   0.72 
TDEL0D03720 Chr4 (683833..684840) [1008 bp, 335 aa] {ON} Anc_3.2...    33   0.74 
Kpol_257.4 s257 complement(12348..13430) [1083 bp, 360 aa] {ON} ...    33   0.88 
TPHA0F02090 Chr6 (465913..466995) [1083 bp, 360 aa] {ON}               33   0.93 
Kpol_529.30 s529 (89344..90426) [1083 bp, 360 aa] {ON} (89344..9...    33   1.7  
TPHA0A00140 Chr1 (14857..15945) [1089 bp, 362 aa] {ON}                 32   1.7  
TDEL0A00140 Chr1 (23016..24233) [1218 bp, 405 aa] {ON}                 32   2.3  
Suva_13.513 Chr13 complement(894394..895476) [1083 bp, 360 aa] {...    32   2.8  
TBLA0A06640 Chr1 (1621352..1622437) [1086 bp, 361 aa] {ON}             32   2.9  
TDEL0E00230 Chr5 (36310..37398) [1089 bp, 362 aa] {ON}   Added 3...    31   4.0  
KLTH0C07854g Chr3 (673945..675021) [1077 bp, 358 aa] {ON} simila...    31   4.2  
Kpol_1057.24 s1057 (53467..54549) [1083 bp, 360 aa] {ON} (53467....    31   6.2  
KNAG0E04200 Chr5 complement(837232..838389) [1158 bp, 385 aa] {O...    30   7.0  
Suva_6.13 Chr6 (21861..22031,22035..22067) [204 bp, 68 aa] {ON} ...    28   8.6  

>KNAG0C03790 Chr3 complement(745394..746542) [1149 bp, 382 aa] {ON}
           Anc_7.350 YDL168W
          Length = 382

 Score =  753 bits (1945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/382 (96%), Positives = 369/382 (96%)

Query: 1   MANTEGQTITCTAAVAYAAGKPLTVEQITVEAPTGARGAYQDHQHCYLPHGCVHSVWFGS 60
           MANTEGQTITCTAAVAYAAGKPLTVEQITVEAPTGARGAYQDHQHCYLPHGCVHSVWFGS
Sbjct: 1   MANTEGQTITCTAAVAYAAGKPLTVEQITVEAPTGARGAYQDHQHCYLPHGCVHSVWFGS 60

Query: 61  EVRCVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAVRA 120
           EVRCVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAVRA
Sbjct: 61  EVRCVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAVRA 120

Query: 121 TQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCG 180
           TQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCG
Sbjct: 121 TQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCG 180

Query: 181 VTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDF 240
           VTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDF
Sbjct: 181 VTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDF 240

Query: 241 GATDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACHKGWGQSIII 300
           GATDFVNPKTDLKDGQTIVEKLVEM             NVQVMRDALEACHKGWGQSIII
Sbjct: 241 GATDFVNPKTDLKDGQTIVEKLVEMTDGGLDFTFDGTGNVQVMRDALEACHKGWGQSIII 300

Query: 301 GVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRPF 360
           GVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRPF
Sbjct: 301 GVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRPF 360

Query: 361 KEINEGFEDLHHGDCLRTVLNY 382
           KEINEGFEDLHHGDCLRTVLNY
Sbjct: 361 KEINEGFEDLHHGDCLRTVLNY 382

>Ecym_4723 Chr4 (1415078..1416223) [1146 bp, 381 aa] {ON} similar to
           Ashbya gossypii ACL148C
          Length = 381

 Score =  534 bits (1376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/382 (69%), Positives = 304/382 (79%), Gaps = 1/382 (0%)

Query: 1   MANTEGQTITCTAAVAYAAGKPLTVEQITVEAPTGARGAYQDHQHCYLPHGCVHSVWFGS 60
           M+ T G+TI C AA+AY AG PL +E ITV+ P  A        H  L H   +++    
Sbjct: 1   MSITAGKTIQCKAAIAYTAGNPLKIETITVDPPK-AHEVRIKITHTALCHTDAYTLSGVD 59

Query: 61  EVRCVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAVRA 120
                    G  G+G+VESVG  VT+VKVGDHVI LYTAEC+ECK C SGKTNLC +VRA
Sbjct: 60  PEGIFPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRA 119

Query: 121 TQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCG 180
           TQGKG+MPDGTSRF+NSKGE + HFMGCSTF+EYTVVADVSVVAID  APL+KVCLLGCG
Sbjct: 120 TQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCG 179

Query: 181 VTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDF 240
           VTTGYGAA+KTA+VQKGDTVAVFGAGT+GLSVVQGA++R ASKIIVVDIND KKK++FDF
Sbjct: 180 VTTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDF 239

Query: 241 GATDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACHKGWGQSIII 300
           GATDF+NP  DL DG+TIV KL++M             N +VMRDALEACHKGWGQSIII
Sbjct: 240 GATDFINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIII 299

Query: 301 GVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRPF 360
           GVAAAG+EISTRPFQLVTGRVWKGSAFGG+KGRSEMG+LI DY  G LK+DEF+T+ RPF
Sbjct: 300 GVAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPF 359

Query: 361 KEINEGFEDLHHGDCLRTVLNY 382
            EIN+G  DLHHGDCLRTVLN+
Sbjct: 360 SEINDGLTDLHHGDCLRTVLNF 381

>KLTH0H01254g Chr8 (121076..122221) [1146 bp, 381 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 381

 Score =  531 bits (1368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/378 (71%), Positives = 300/378 (79%), Gaps = 1/378 (0%)

Query: 4   TEGQTITCTAAVAYAAGKPLTVEQITVEAPTGARGAYQDHQHCYLPHGCVHSVWFGSEVR 63
           +EG+ ITCTAAVAY AGKPLTVE+I V+ P  A       ++  + H   +++       
Sbjct: 2   SEGKPITCTAAVAYEAGKPLTVEEIVVDPPK-AHEVRIKVEYTAVCHTDAYTLSGVDPEG 60

Query: 64  CVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAVRATQG 123
                 G  GAGVVESVG  VT+VK GDHVIALYTAECKECK CKSGKTNLC +VRATQG
Sbjct: 61  AFPSILGHEGAGVVESVGEGVTNVKAGDHVIALYTAECKECKFCKSGKTNLCGSVRATQG 120

Query: 124 KGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTT 183
           KGVMPDGTSRF N KGE LLHFMGCSTF++YTVVADVSVVAID  APL+K CLLGCGVTT
Sbjct: 121 KGVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTT 180

Query: 184 GYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGAT 243
           GYGAA+KTA+VQKGDTVA+FGAGT+GLSVVQGA  R ASKIIVVDIND KK+++ DFGAT
Sbjct: 181 GYGAAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGAT 240

Query: 244 DFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACHKGWGQSIIIGVA 303
           DFVNP   LKDGQTIV+KLVEM             N  VMR ALEACHKGWGQSIIIGVA
Sbjct: 241 DFVNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVA 300

Query: 304 AAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRPFKEI 363
           AAGKEISTRPFQLVTGRVWKGSAFGG+KGRSEMG L+ DY  G LK+DEFIT++R F +I
Sbjct: 301 AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDI 360

Query: 364 NEGFEDLHHGDCLRTVLN 381
           N  FEDLHHGDCLRTVL+
Sbjct: 361 NSAFEDLHHGDCLRTVLD 378

>TBLA0E00390 Chr5 complement(71890..73041) [1152 bp, 383 aa] {ON} 
          Length = 383

 Score =  528 bits (1360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/381 (69%), Positives = 301/381 (79%), Gaps = 1/381 (0%)

Query: 1   MANTEGQTITCTAAVAYAAGKPLTVEQITVEAPTGARGAYQDHQHCYLPHGCVHSVWFGS 60
           M+ T+G+ I C AAVAY A +PLTVE+I VE P  A        H  + H   +++    
Sbjct: 1   MSETQGKPIKCLAAVAYKAAEPLTVEEIIVEPPE-AHEVRIKITHTAVCHTDAYTLSGVD 59

Query: 61  EVRCVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAVRA 120
                    G  G+G+VESVG  V+SVKVGDHVIALYTAEC  CK CKSGKTNLC +VR 
Sbjct: 60  PEGAFPCVLGHEGSGIVESVGEGVSSVKVGDHVIALYTAECGVCKFCKSGKTNLCGSVRE 119

Query: 121 TQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCG 180
           TQGKGVMPDGTSRF+N KGE LLHFMGCSTF++YTVVADVSVVAI++ APL+ VCLLGCG
Sbjct: 120 TQGKGVMPDGTSRFKNLKGESLLHFMGCSTFSQYTVVADVSVVAINKTAPLQSVCLLGCG 179

Query: 181 VTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDF 240
           VTTGYGAA+KTANVQK DTVAVFGAGT+GLSVVQGA+AR ASKII+VD+N  K+ ++  F
Sbjct: 180 VTTGYGAAIKTANVQKNDTVAVFGAGTVGLSVVQGAQARGASKIIMVDVNSKKETYSRQF 239

Query: 241 GATDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACHKGWGQSIII 300
           GATDF+NP TDLK G+TIV KLVEM             NV+VMRDALE CHKGWGQSIII
Sbjct: 240 GATDFINPMTDLKPGETIVSKLVEMTDGGLDHTFDCTGNVKVMRDALECCHKGWGQSIII 299

Query: 301 GVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRPF 360
           GVAAAG+EISTRPFQLVTGRVWKGSAFGGVKGRSEMG LIE Y KG+LK+D+FITNKRPF
Sbjct: 300 GVAAAGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMGGLIESYQKGDLKVDQFITNKRPF 359

Query: 361 KEINEGFEDLHHGDCLRTVLN 381
            EIN  FEDLHHGDCLRTVL+
Sbjct: 360 TEINAAFEDLHHGDCLRTVLD 380

>NCAS0A14160 Chr1 complement(2782022..2783377) [1356 bp, 451 aa]
           {ON} Anc_7.350
          Length = 451

 Score =  528 bits (1361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/381 (71%), Positives = 314/381 (82%), Gaps = 1/381 (0%)

Query: 1   MANTEGQTITCTAAVAYAAGKPLTVEQITVEAPTGARGAYQDHQHCYLPHGCVHSVWFGS 60
           M++T+G+ ITCTAAVAYAAGKPLTVEQI V+ P  A       ++  + H   +++    
Sbjct: 69  MSSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPK-AHEVRIKIEYTAVCHTDAYTLSGID 127

Query: 61  EVRCVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAVRA 120
                    G  G+G+VESVG  VT+VKVGDHVIALYTAEC +CK CKSGKTNLC +VRA
Sbjct: 128 PEGAFPSILGHEGSGIVESVGEGVTNVKVGDHVIALYTAECGKCKFCKSGKTNLCGSVRA 187

Query: 121 TQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCG 180
           TQGKGVMPDGTSRF N KGEPLLHFMGCSTF++YTVVADVSVVA+D  APL+ + LLGCG
Sbjct: 188 TQGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTVVADVSVVAVDPKAPLDSISLLGCG 247

Query: 181 VTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDF 240
           VTTGYGAA+KTANVQKGDTVAVFGAGT+GLSVVQGAK+R ASKIIVVDIN+ KK+++FDF
Sbjct: 248 VTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDF 307

Query: 241 GATDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACHKGWGQSIII 300
           GATDFVNPK DLK+G+TIV+KL+EM             NV+VMRDALEACHKGWG+SIII
Sbjct: 308 GATDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHKGWGESIII 367

Query: 301 GVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRPF 360
           GVA AG+EISTRPFQLVTGRVWKGSAFGG+KGRSEMG LIEDY  G LK+DEFIT++RPF
Sbjct: 368 GVAGAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPF 427

Query: 361 KEINEGFEDLHHGDCLRTVLN 381
            EIN+ FEDLHHGDCLRTVL+
Sbjct: 428 TEINDAFEDLHHGDCLRTVLD 448

>KLLA0D12342g Chr4 (1050181..1051335) [1155 bp, 384 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 384

 Score =  525 bits (1353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/378 (69%), Positives = 300/378 (79%), Gaps = 1/378 (0%)

Query: 4   TEGQTITCTAAVAYAAGKPLTVEQITVEAPTGARGAYQDHQHCYLPHGCVHSVWFGSEVR 63
           T G+ I C AAVAY AGKPLTVE+I V+AP       Q   H  + H   +++       
Sbjct: 5   TAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQ-VTHTAVCHTDAYTLSGVDPEG 63

Query: 64  CVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAVRATQG 123
                 G  GAG+VESVG  VT+VKVGDHV+ LYTAEC +CK CKS KTNLC +VRATQG
Sbjct: 64  AFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQG 123

Query: 124 KGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTT 183
           KGVMPDGT+RF N KGEPLLHFMGCSTF++YTVVADVS+V ID  APL  VCLLGCGVTT
Sbjct: 124 KGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTT 183

Query: 184 GYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGAT 243
           GYGAA+KTANVQ+GDTVAVFGAGT+GLSVVQGAK+R ASKIIVVD+ND KK+++ DFGAT
Sbjct: 184 GYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGAT 243

Query: 244 DFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACHKGWGQSIIIGVA 303
            FVNP  DLK+G+TIV KL++M             NV+VMRDALEACHKGWGQSIIIGVA
Sbjct: 244 GFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKGWGQSIIIGVA 303

Query: 304 AAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRPFKEI 363
           AAG+EISTRPFQL+TGRVWKGSAFGG+KGRSEMG L+  Y KG+LK+D+FIT+KRPF EI
Sbjct: 304 AAGEEISTRPFQLITGRVWKGSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPFTEI 363

Query: 364 NEGFEDLHHGDCLRTVLN 381
           N  FEDLHHGDCLRTVL+
Sbjct: 364 NNAFEDLHHGDCLRTVLD 381

>Kwal_56.24642 s56 complement(1085556..1086701) [1146 bp, 381 aa]
           {ON} YDL168W (SFA1) - Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
           [contig 161] FULL
          Length = 381

 Score =  525 bits (1352), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/384 (70%), Positives = 300/384 (78%), Gaps = 13/384 (3%)

Query: 4   TEGQTITCTAAVAYAAGKPLTVEQITVEAPTG----ARGAYQD--HQHCYLPHGCVHSVW 57
           +EG+ ITC AAVAY AGKPLT+E+I V+ P       + AY    H   Y   G      
Sbjct: 2   SEGKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGA 61

Query: 58  FGSEVRCVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSA 117
           F S         G  GAG+VES+G  VT+VK GDHVIALYTAECKECK CKSGKTNLC +
Sbjct: 62  FPS-------ILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGS 114

Query: 118 VRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLL 177
           VRATQGKGVMPDGT+RF N KGE +LHFMGCSTF++YTV+ADVSVVAID  APL+K CLL
Sbjct: 115 VRATQGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLL 174

Query: 178 GCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFA 237
           GCGVTTGYGAA+KTANVQKGDTVAVFGAGT+GLSVVQGAK R AS+IIVVDIND KK++A
Sbjct: 175 GCGVTTGYGAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWA 234

Query: 238 FDFGATDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACHKGWGQS 297
            +FGATDFVNP  DLKDG+TIV+ LVEM             N  VMR ALEACHKGWG+S
Sbjct: 235 NEFGATDFVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGES 294

Query: 298 IIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNK 357
           IIIGVAAAGKEISTRPFQLVTGRVWKGSAFGG+KGRSEMG LI DY  G LK+DEFIT++
Sbjct: 295 IIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHR 354

Query: 358 RPFKEINEGFEDLHHGDCLRTVLN 381
           R F +IN  FEDLHHGDCLRTVL+
Sbjct: 355 RGFTDINSAFEDLHHGDCLRTVLD 378

>TDEL0C01980 Chr3 (344639..345796) [1158 bp, 385 aa] {ON} Anc_7.350
           YDL168W
          Length = 385

 Score =  523 bits (1347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/380 (71%), Positives = 309/380 (81%), Gaps = 1/380 (0%)

Query: 2   ANTEGQTITCTAAVAYAAGKPLTVEQITVEAPTGARGAYQDHQHCYLPHGCVHSVWFGSE 61
           A TEG++ITC AAVAY AGKPLTVE+ITVEAP  A       ++  + H   +++     
Sbjct: 4   AATEGKSITCVAAVAYEAGKPLTVEEITVEAPR-AHEVRIKIEYTAVCHTDAYTLSGVDP 62

Query: 62  VRCVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAVRAT 121
                   G  GAG+VESVG  VT+VK GDHVIALYTAEC++CK CKSGKTNLCS+VRAT
Sbjct: 63  EGAFPSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRAT 122

Query: 122 QGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGV 181
           QGKGVMPDGTSRF+N KGE L HFMGCSTF++YTVVADVSVVA+D  APLE +CLLGCGV
Sbjct: 123 QGKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTVVADVSVVAVDPSAPLESICLLGCGV 182

Query: 182 TTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFG 241
           TTGYGAA KTANVQKGDTVAVFGAGT+GLSV+QGAK R AS+II+VDIND K+K+  +FG
Sbjct: 183 TTGYGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFG 242

Query: 242 ATDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACHKGWGQSIIIG 301
           ATDF+NPK+DLKDGQTIVEKL+EM             N +VMRDALEACHKGWG S+IIG
Sbjct: 243 ATDFINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIG 302

Query: 302 VAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRPFK 361
           VAAA +EISTRPFQLVTGRVWKGSAFGG+KGRSEMG LIEDY KG LK+DEFITN+RPF 
Sbjct: 303 VAAAEEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFT 362

Query: 362 EINEGFEDLHHGDCLRTVLN 381
           EIN+ FEDLH GDCLRTVL+
Sbjct: 363 EINKAFEDLHAGDCLRTVLD 382

>Kpol_530.31 s530 (77132..78274) [1143 bp, 380 aa] {ON}
           (77132..78274) [1143 nt, 381 aa]
          Length = 380

 Score =  519 bits (1337), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/382 (69%), Positives = 303/382 (79%), Gaps = 6/382 (1%)

Query: 3   NTEGQTITCTAAVAYAAGKPLTVEQITVEAPTG--ARGAYQDHQHCYLPHGCVHSVWFGS 60
           +T G+ ITC AAVAY A KPL VE+I V+ P     R    +   C+     +  V    
Sbjct: 2   STVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEG 61

Query: 61  EVRCVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAVRA 120
              CV    G  G+G+VESVG +VT+VK GDHV+ALYTAEC +CK C SGKTNLC +VRA
Sbjct: 62  LFPCV---LGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRA 118

Query: 121 TQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCG 180
           TQGKGVMPDGT RF N KGEPL HFMGCSTF+EYTVVADVSVVAID  APL+ VCLLGCG
Sbjct: 119 TQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCG 178

Query: 181 VTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDF 240
           VTTGYGAA+KTANVQKGDTVAVFGAGT+GLSVVQGAK+R ASKIIVVDIN+ KK+++ +F
Sbjct: 179 VTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEF 238

Query: 241 GATDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACHKGWGQSIII 300
           GATDFVNP ++L +GQ IV KLVEM             NV VMRDALEACHKGWGQSIII
Sbjct: 239 GATDFVNP-SELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIII 297

Query: 301 GVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRPF 360
           GVAAAGKEISTRPFQLVTGRVWKGSAFGG+KGRSEMG LI+DY  G+LK+DEFITN+RPF
Sbjct: 298 GVAAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPF 357

Query: 361 KEINEGFEDLHHGDCLRTVLNY 382
            EIN+ FE+LHHG+CLRTVL++
Sbjct: 358 VEINDAFEELHHGNCLRTVLSF 379

>YDL168W Chr4 (159604..160764) [1161 bp, 386 aa] {ON}
           SFA1Bifunctional enzyme containing both alcohol
           dehydrogenase and glutathione-dependent formaldehyde
           dehydrogenase activities, functions in formaldehyde
           detoxification and formation of long chain and complex
           alcohols, regulated by Hog1p-Sko1p
          Length = 386

 Score =  518 bits (1333), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/381 (69%), Positives = 303/381 (79%), Gaps = 3/381 (0%)

Query: 2   ANTEGQTITCTAAVAYAAGKPLTVEQITVEAPTGARGAYQDHQHCYLPHGCVHSVWFGSE 61
           A T G+ I C AAVAY A KPL+VE+ITV+AP  A       ++  + H   +++  GS+
Sbjct: 3   AATVGKPIKCIAAVAYDAKKPLSVEEITVDAPK-AHEVRIKIEYTAVCHTDAYTLS-GSD 60

Query: 62  VRCVSLC-FGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAVRA 120
              +  C  G  GAG+VESVG DV +VK GDHVIALYTAEC +CK C SGKTNLC AVRA
Sbjct: 61  PEGLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRA 120

Query: 121 TQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCG 180
           TQGKGVMPDGT+RF N+KGE + HFMGCSTF+EYTVVADVSVVAID  APL+  CLLGCG
Sbjct: 121 TQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCG 180

Query: 181 VTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDF 240
           VTTG+GAALKTANVQKGDTVAVFG GT+GLSV+QGAK R ASKII +DIN+ KK++   F
Sbjct: 181 VTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAIDINNKKKQYCSQF 240

Query: 241 GATDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACHKGWGQSIII 300
           GATDFVNPK DL   QTIVEKL+EM             N ++MRDALEACHKGWGQSIII
Sbjct: 241 GATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIII 300

Query: 301 GVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRPF 360
           GVAAAG+EISTRPFQLVTGRVWKGSAFGG+KGRSEMG LI+DY KG LK++EFIT++RPF
Sbjct: 301 GVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPF 360

Query: 361 KEINEGFEDLHHGDCLRTVLN 381
           KEIN+ FEDLH+GDCLRTVL 
Sbjct: 361 KEINQAFEDLHNGDCLRTVLK 381

>Suva_4.78 Chr4 (147109..148266) [1158 bp, 385 aa] {ON} YDL168W
           (REAL)
          Length = 385

 Score =  517 bits (1331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/382 (68%), Positives = 304/382 (79%), Gaps = 3/382 (0%)

Query: 2   ANTEGQTITCTAAVAYAAGKPLTVEQITVEAPTGARGAYQDHQHCYLPHGCVHSVWFGSE 61
           A+T G+ I C AA+AY A KPL+VE+ITV+ P  A       ++  + H   +++  GS+
Sbjct: 3   ASTVGKPIQCIAAIAYDAKKPLSVEEITVDPPK-AHEVRIKIEYTAVCHTDAYTLS-GSD 60

Query: 62  VRCVSLC-FGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAVRA 120
              +  C  G  GAG+VESVG DVT+VK GDHVIALYTAEC +CK C SGKTNLCSAVRA
Sbjct: 61  PEGLFPCILGHEGAGIVESVGDDVTTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRA 120

Query: 121 TQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCG 180
           TQG+G+MPD T+RF N KGE + HFMGCSTF+EYTVVADVSVVAID  APL+   LLGCG
Sbjct: 121 TQGRGIMPDETTRFHNGKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAASLLGCG 180

Query: 181 VTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDF 240
           VTTGYGAA+KTANVQKGDTVAVFG GT+GLSV+QGAKAR ASKII +DIN+ KK++ FDF
Sbjct: 181 VTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKARGASKIIGIDINNKKKQYCFDF 240

Query: 241 GATDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACHKGWGQSIII 300
           GATDF+NPK DL  GQTIVEKL+E              N ++MRDALEACHKGWGQSIII
Sbjct: 241 GATDFINPKEDLAKGQTIVEKLIETTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIII 300

Query: 301 GVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRPF 360
           GVAAAG+EISTRPFQLVTGRVWKGSAFGG+KGRSEMG LI+DY  G LK++EFIT++RPF
Sbjct: 301 GVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGALKVEEFITHRRPF 360

Query: 361 KEINEGFEDLHHGDCLRTVLNY 382
           KEIN+ FEDLH GDCLRTVL +
Sbjct: 361 KEINQAFEDLHQGDCLRTVLKF 382

>Skud_4.89 Chr4 (155298..156455) [1158 bp, 385 aa] {ON} YDL168W
           (REAL)
          Length = 385

 Score =  514 bits (1323), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/383 (67%), Positives = 305/383 (79%), Gaps = 3/383 (0%)

Query: 1   MANTEGQTITCTAAVAYAAGKPLTVEQITVEAPTGARGAYQDHQHCYLPHGCVHSVWFGS 60
           +A T G+ I C AAVAY A K L+VE+ITV+ P  A       +   + H   +++  GS
Sbjct: 2   LAATVGKPIQCVAAVAYNAKKSLSVEEITVDPPK-AHEVRIKIEFTAVCHTDAYTLS-GS 59

Query: 61  EVRCVSLC-FGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAVR 119
           +   +  C  G  GAG+VESVG DV +VK GDHVIALYTAEC +CK C SGKTNLCSAVR
Sbjct: 60  DPEGLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVR 119

Query: 120 ATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGC 179
           ATQGKGVMPDGT+RF N+KGE + HFMGCSTF+EYTVVADVSVVAID  APL+  CLLGC
Sbjct: 120 ATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGC 179

Query: 180 GVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFD 239
           GVTTGYGAA+KTANVQ+GDTVAVFG GT+GLSV+QGAK+R ASKII VDIN+ K++++ +
Sbjct: 180 GVTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSN 239

Query: 240 FGATDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACHKGWGQSII 299
           FGATDF+NPK DL + QTIVEKL++M             N  +MRDALEACHKGWGQSII
Sbjct: 240 FGATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEACHKGWGQSII 299

Query: 300 IGVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRP 359
           IGVAAAG+EISTRPFQLVTGRVWKGSAFGG+KGRSEMG LI+DY  G LK++EFIT++RP
Sbjct: 300 IGVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRP 359

Query: 360 FKEINEGFEDLHHGDCLRTVLNY 382
           FKEIN+ FEDLH+GDCLRTVL +
Sbjct: 360 FKEINQAFEDLHNGDCLRTVLRF 382

>ZYRO0F11704g Chr6 complement(958546..959694) [1149 bp, 382 aa] {ON}
           highly similar to uniprot|P32771 Saccharomyces
           cerevisiae YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 382

 Score =  513 bits (1321), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/386 (69%), Positives = 304/386 (78%), Gaps = 13/386 (3%)

Query: 3   NTEGQTITCTAAVAYAAGKPLTVEQITVEAPTG------ARGAYQDHQHCYLPHGCVHSV 56
           +TEG+ +T  AAVAY AGKPL+VE+ITV+ P         +     H   Y   G     
Sbjct: 2   STEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEG 61

Query: 57  WFGSEVRCVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCS 116
            F S         G  GAG+VESVG  VTSVK GDHV+ALYTAEC +CK CKSGKTNLC 
Sbjct: 62  AFPS-------ILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCG 114

Query: 117 AVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCL 176
           +VRATQGKGVMPDGTSRF+N KGE LLHFMGCSTF+EYTVVADVSVVA+D  APLE  CL
Sbjct: 115 SVRATQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTVVADVSVVAVDPKAPLESACL 174

Query: 177 LGCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKF 236
           LGCGVTTGYGAA+KTANVQKGDTVA+FGAGT+GLSV QGAKAR AS+II+VDIND KKK+
Sbjct: 175 LGCGVTTGYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKY 234

Query: 237 AFDFGATDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACHKGWGQ 296
             +FGATDF+NP TDL++GQTIVEKL+EM             NV+VMRDALEACHKGWG 
Sbjct: 235 MHEFGATDFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHKGWGV 294

Query: 297 SIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITN 356
           S++IGVAA+G+EISTRPFQLVTGRVWKGSAFGG+KGRSEMG LI+DY  G LK+DEFITN
Sbjct: 295 SVVIGVAASGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITN 354

Query: 357 KRPFKEINEGFEDLHHGDCLRTVLNY 382
           +RPFK+INE FEDLH GD LRTVLNY
Sbjct: 355 RRPFKQINEAFEDLHAGDSLRTVLNY 380

>Smik_4.70 Chr4 (136242..137402) [1161 bp, 386 aa] {ON} YDL168W
           (REAL)
          Length = 386

 Score =  511 bits (1316), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/382 (68%), Positives = 301/382 (78%), Gaps = 3/382 (0%)

Query: 2   ANTEGQTITCTAAVAYAAGKPLTVEQITVEAPTGARGAYQDHQHCYLPHGCVHSVWFGSE 61
           A T G+ I C AAVAY A KP +VE+ITV+AP  A       ++  + H   +++  GS+
Sbjct: 3   AATVGKPIKCIAAVAYDAKKPSSVEEITVDAPK-AHEVRIKIEYTAVCHTDAYTLS-GSD 60

Query: 62  VRCVSLC-FGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAVRA 120
              +  C  G  GAG+VESVG  V +VK GDHVIALYTAEC +CK C SGKTNLCSAVRA
Sbjct: 61  PEGLFPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRA 120

Query: 121 TQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCG 180
           TQGKGVMPDGT+RF N+KG+ + HFMGCSTF+EYTVVADVSVVAID  APL+  CLLGCG
Sbjct: 121 TQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCG 180

Query: 181 VTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDF 240
           VTTGYGAA+KTANVQKGDTVAVFG GT+GLSV+QGAK R ASKII VDIN+ KKK+   F
Sbjct: 181 VTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQF 240

Query: 241 GATDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACHKGWGQSIII 300
           GATDF+NPK DL   QTIVEKLVEM             N ++MRDALEACHKGWGQSIII
Sbjct: 241 GATDFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIII 300

Query: 301 GVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRPF 360
           GVAAAG+EISTRPFQLVTGRVWKGSAFGG+KGRSEMG LI+DY  G LK++EFIT++RPF
Sbjct: 301 GVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPF 360

Query: 361 KEINEGFEDLHHGDCLRTVLNY 382
           KEIN  FEDLH+GDCLRTVL +
Sbjct: 361 KEINHAFEDLHNGDCLRTVLKF 382

>ACL148C Chr3 complement(90932..92077) [1146 bp, 381 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL168W
           (SFA1)
          Length = 381

 Score =  510 bits (1313), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/382 (69%), Positives = 312/382 (81%), Gaps = 3/382 (0%)

Query: 1   MANTEGQTITCTAAVAYAAGKPLTVEQITVEAPTGARGAYQDHQHCYLPHGCVHSVWFGS 60
           M+ T+G+ I CTAAVAYAAG+PL +E++TV+ P  A        +  + H   +++  GS
Sbjct: 1   MSETQGKPIQCTAAVAYAAGEPLRIEKVTVDPPK-AHEVRIKIVNSAICHTDAYTL-SGS 58

Query: 61  EVRCVSLC-FGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAVR 119
           +   +  C  G  G+G+VESVG  VT+VK GDHV+ LYTAEC++CK C SGKTNLC AVR
Sbjct: 59  DPEGLFPCILGHEGSGIVESVGEGVTNVKPGDHVVPLYTAECQQCKFCVSGKTNLCGAVR 118

Query: 120 ATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGC 179
           ATQGKGVMPDGTSRFRN KGE L HFMGCSTF+EYTVVADVSVVA+D+ APLE VCLLGC
Sbjct: 119 ATQGKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTVVADVSVVAVDQQAPLETVCLLGC 178

Query: 180 GVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFD 239
           GVTTGYGAA+KTA+VQ+GDTVAVFGAGT+GLSVVQGAKAR AS+IIVVDIND K+++A  
Sbjct: 179 GVTTGYGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASK 238

Query: 240 FGATDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACHKGWGQSII 299
           FGATDF+NPKTDLK+G+TIV +L+EM             N +VMRDALEACHKGWGQSII
Sbjct: 239 FGATDFINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSII 298

Query: 300 IGVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRP 359
           IGVAAAG+EISTRPFQLVTGRVWKGSAFGG+KGRSEMG L+ DY  G LK+ EF+T+KRP
Sbjct: 299 IGVAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRP 358

Query: 360 FKEINEGFEDLHHGDCLRTVLN 381
           F+EIN GFEDLHHGDCLRTVL+
Sbjct: 359 FEEINSGFEDLHHGDCLRTVLS 380

>SAKL0F11374g Chr6 complement(885478..886629) [1152 bp, 383 aa] {ON}
           highly similar to uniprot|P32771 Saccharomyces
           cerevisiae YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 383

 Score =  509 bits (1312), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/387 (69%), Positives = 303/387 (78%), Gaps = 13/387 (3%)

Query: 1   MANTEGQTITCTAAVAYAAGKPLTVEQITVEAPTG----ARGAYQD--HQHCYLPHGCVH 54
           M+ T G+ ITC AAVAY AGKPLTVE+I VE P       R  Y    H   Y   G   
Sbjct: 1   MSETVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP 60

Query: 55  SVWFGSEVRCVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNL 114
              F S         G  GAGVVESVG  VT+VK GDHV+ALYTAEC++CK C SGKTNL
Sbjct: 61  EGAFPS-------ILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNL 113

Query: 115 CSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKV 174
           C +VRATQGKGVMPDGTSRFR   GE +LHFMGCSTF++YTVVADVSVVA+D  APL+++
Sbjct: 114 CGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTVVADVSVVAVDSQAPLDRI 173

Query: 175 CLLGCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKK 234
           CLLGCGVTTGYGAA+KTANVQKGDTVAVFGAGT+GLSVVQGAKAR AS+IIVVDIND KK
Sbjct: 174 CLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKK 233

Query: 235 KFAFDFGATDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACHKGW 294
           ++A DFGATDFVNP  DLK+G+TIV KL+E+             N +VMRDALEACHKGW
Sbjct: 234 QWASDFGATDFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGW 293

Query: 295 GQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFI 354
           GQSIIIGVAAAG+EISTRPFQLVTGRVWKGSAFGG+KGRSEMG L+ DY  G LK+DEFI
Sbjct: 294 GQSIIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFI 353

Query: 355 TNKRPFKEINEGFEDLHHGDCLRTVLN 381
           T++RPF EIN  F+DLHHGDCLRTVL+
Sbjct: 354 THRRPFTEINAAFDDLHHGDCLRTVLD 380

>CAGL0L01111g Chr12 (133129..134274) [1146 bp, 381 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168w SFA1 long-chain alcohol dehydrogenase
          Length = 381

 Score =  506 bits (1303), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 262/385 (68%), Positives = 289/385 (75%), Gaps = 13/385 (3%)

Query: 4   TEGQTITCTAAVAYAAGKPLTVEQITVEAPTGARGAYQD------HQHCYLPHGCVHSVW 57
           TEG+ I C AAVAY AGKP  VEQI V+ P       +       H   Y   G      
Sbjct: 2   TEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL 61

Query: 58  FGSEVRCVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSA 117
           F     CV    G  GAG+VESVG  VT+VK GDHVIALYTAEC++CK C SGKTNLC A
Sbjct: 62  F----PCV---LGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGA 114

Query: 118 VRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLL 177
           VRATQGKGVMPDGTSRF N KGE L HFMGCSTF+EYTVVADVSVVAID+ APLE VCLL
Sbjct: 115 VRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLL 174

Query: 178 GCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFA 237
           GCGVTTGYGAA+KTANVQKGDTVAVFG GT+GLSV+QGA  R AS+II +D ND KK F 
Sbjct: 175 GCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFC 234

Query: 238 FDFGATDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACHKGWGQS 297
             FGATDF+NP  DLK+ +TIV KL+EM             NV VMR ALEACHKGWGQS
Sbjct: 235 TQFGATDFINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQS 294

Query: 298 IIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNK 357
           +IIGVAAAG+EISTRPFQLVTGRVWKGSAFGGVKGRSEM  LIE Y KG LK+DEFIT++
Sbjct: 295 VIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHR 354

Query: 358 RPFKEINEGFEDLHHGDCLRTVLNY 382
           R F EINE F+DLH+G CLRTVL++
Sbjct: 355 RSFNEINEAFDDLHNGLCLRTVLSF 379

>KAFR0B00880 Chr2 complement(164475..165620) [1146 bp, 381 aa] {ON}
           Anc_7.350 YDL168W
          Length = 381

 Score =  498 bits (1283), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 250/384 (65%), Positives = 294/384 (76%), Gaps = 5/384 (1%)

Query: 1   MANTEGQTITCTAAVAYAAGKPLTVEQITVEAPTG--ARGAYQDHQHCYLPHGCVHSVWF 58
           M++T+G+ I C AAVAY A KPL V+ + V+AP     R    +   C+     +  V  
Sbjct: 1   MSSTQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP 60

Query: 59  GSEVRCVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAV 118
                C+    G  G+G+VES+G  VTSVKVGDHVI LYTAEC++CK CKSGKTNLC AV
Sbjct: 61  EGLFPCI---LGHEGSGIVESIGEGVTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAV 117

Query: 119 RATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLG 178
           R TQGKGVMPDGTSRF   +G+ + HFMGCSTF+EYTVVADVSVVAID+   LE   LLG
Sbjct: 118 RETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLG 177

Query: 179 CGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAF 238
           CGVTTG+GAA+K ANVQKGDTVAVFGAGT+GLSVVQGA+ R  SK+IVVDIND KK+F++
Sbjct: 178 CGVTTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSY 237

Query: 239 DFGATDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACHKGWGQSI 298
           DFGATDFVNP TDLKDG+TIV KL+ M             NV VMR+ALEACHKGWGQS 
Sbjct: 238 DFGATDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSF 297

Query: 299 IIGVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKR 358
           IIGVAAAG+EISTRPFQLVTGRVW+G+AFG +KGR++M  L++DY KG LKIDEFIT++R
Sbjct: 298 IIGVAAAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRR 357

Query: 359 PFKEINEGFEDLHHGDCLRTVLNY 382
            F EIN+GFEDLH G CLRTVL +
Sbjct: 358 QFDEINDGFEDLHMGTCLRTVLKF 381

>TPHA0F02970 Chr6 complement(653405..654550) [1146 bp, 381 aa] {ON}
           Anc_7.350 YDL168W
          Length = 381

 Score =  497 bits (1279), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 250/378 (66%), Positives = 292/378 (77%), Gaps = 6/378 (1%)

Query: 6   GQTITCTAAVAYAAGKPLTVEQITVEAPTG--ARGAYQDHQHCYLPHGCVHSVWFGSEVR 63
           G+ ITCTAA+AY A KPLTV +I V+ P     R        C+     +  V       
Sbjct: 5   GKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGLFP 64

Query: 64  CVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAVRATQG 123
           CV    G  G+G+VES+G DVT+VKVGDHVIALYTAEC +CK C SGKTNLC +VRATQG
Sbjct: 65  CV---LGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQG 121

Query: 124 KGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTT 183
           KGVMPDGT+RF +  G+P+ HFMGCSTF++YTVVADVS+VA D+    E   LLGCGVTT
Sbjct: 122 KGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTT 181

Query: 184 GYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGAT 243
           GYGAA+KTAN+QKGDTVAVFGAGT+GLSVVQGAK+R ASKIIVVD+N+ KK ++F+FGAT
Sbjct: 182 GYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGAT 241

Query: 244 DFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACHKGWGQSIIIGVA 303
           DFVNPK +LKD + IV KL+EM             NV VMR+ALEACHKGWGQSIIIGVA
Sbjct: 242 DFVNPK-ELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVA 300

Query: 304 AAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRPFKEI 363
           AAG+EI+TRPFQLVTGRVW+GSAFGG+KGRSEMG LI+DY  G LK+DEFIT +RPF EI
Sbjct: 301 AAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEI 360

Query: 364 NEGFEDLHHGDCLRTVLN 381
           N  FEDLH+G CLRTVL+
Sbjct: 361 NAAFEDLHNGSCLRTVLD 378

>NDAI0A01890 Chr1 (425090..426358) [1269 bp, 422 aa] {ON} Anc_7.350
          Length = 422

 Score =  432 bits (1110), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 228/387 (58%), Positives = 261/387 (67%), Gaps = 59/387 (15%)

Query: 1   MANTEGQTITCTAAVAYAAGKPLTVEQITVEAPTGARGAYQD------HQHCYLPHGCVH 54
           M+ T+G+ ITCTAAVAY AGKPLTVE I V+ P       +       H   Y   G   
Sbjct: 86  MSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDP 145

Query: 55  SVWFGSEVRCVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNL 114
              F S         G  G+G+VESVG  VT+VKVGDHVIALYTAEC ECK CKSG    
Sbjct: 146 EGAFPS-------ILGHEGSGIVESVGEGVTNVKVGDHVIALYTAECGECKFCKSGXXX- 197

Query: 115 CSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKV 174
                                                            A+D++AP++ +
Sbjct: 198 ---------------------------------------------XXXXAVDKNAPMDSI 212

Query: 175 CLLGCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKK 234
           CLLGCGVTTGYGAA+KTANVQKGDTVAVFGAGT+GLSVVQGAKAR ASKIIVVD+ND KK
Sbjct: 213 CLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKK 272

Query: 235 KFAFDFGATDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACHKGW 294
           +++ DFGATDF+NPKTDLK+G+TIV KL+EM             N +VMRDALEACHKGW
Sbjct: 273 QWSMDFGATDFINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALEACHKGW 332

Query: 295 GQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFI 354
           G+SIIIGVAAAG+EISTRPFQLVTGRVWKGSAFGG+KGRSEMG LI+DY  GNLK+DEFI
Sbjct: 333 GESIIIGVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGNLKVDEFI 392

Query: 355 TNKRPFKEINEGFEDLHHGDCLRTVLN 381
           T++RPF EIN  FEDLHHGDCLRTVL+
Sbjct: 393 THRRPFTEINNAFEDLHHGDCLRTVLD 419

>SAKL0A00880g Chr1 complement(92246..93412) [1167 bp, 388 aa] {ON}
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione- dependent formaldehyde dehydrogenase)
          Length = 388

 Score =  362 bits (930), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 187/384 (48%), Positives = 253/384 (65%), Gaps = 8/384 (2%)

Query: 1   MANTEGQTITCTAAVAYAAGKPLTVEQITVEAPTG--ARGAYQDHQHCYLPHGCVHSVWF 58
           M   EG+ I CTAAVAY+  KPL +EQI V+ P     R    +   C      +  +  
Sbjct: 1   MFYKEGEPIRCTAAVAYSINKPLVLEQIIVDPPQEHEVRVKVTNTALCRTDLFTLKGLNP 60

Query: 59  GSEVRCVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAV 118
             +  CV    G  G+G+VES G  V +VK GDHV+ LY  EC  C  CKS K+NLCS +
Sbjct: 61  EGKFPCV---LGHEGSGIVESCGSKVETVKKGDHVLLLYIPECGHCADCKSEKSNLCSVI 117

Query: 119 RATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLG 178
           +ATQ +GVMP G+SR  N + + L HFMGCS+F++Y VV+D+S V I  DAPL+K+CLLG
Sbjct: 118 KATQAQGVMPQGSSRLHNLENKTLWHFMGCSSFSQYAVVSDISCVKIRDDAPLDKICLLG 177

Query: 179 CGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAF 238
           CGVTTG+GA +    V+ GD VAVFG+GT+GLSVVQ     +  ++IVVD+ D K+++A 
Sbjct: 178 CGVTTGFGAPI-AKGVKAGDRVAVFGSGTVGLSVVQSCSQLKCFQVIVVDVQDNKREWAL 236

Query: 239 DFGATDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXX-XXNVQVMRDALEACHKGWGQS 297
            FGATDF+NP+   K+ +++++ L++               +  VMR ALE+C KGWG S
Sbjct: 237 GFGATDFINPQKIPKN-KSLLQTLIDKSGGDGFDFTFDCTGSTSVMRTALESCRKGWGTS 295

Query: 298 IIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNK 357
           +IIG+A AG+EIST P+ L+ GR W+G AFGGVKGRSE+ +L+E Y    +K+DE+ITNK
Sbjct: 296 VIIGLAGAGEEISTLPYNLIVGRSWEGCAFGGVKGRSELPTLVERYMNNEIKLDEYITNK 355

Query: 358 RPFKEINEGFEDLHHGDCLRTVLN 381
           RP KEINE  ++L  G  L+TVL+
Sbjct: 356 RPLKEINEALKELEDGLVLKTVLD 379

>KLLA0D19929g Chr4 (1694826..1695986) [1161 bp, 386 aa] {ON} weakly
           similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase
          Length = 386

 Score = 80.9 bits (198), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 75/308 (24%), Positives = 124/308 (40%), Gaps = 36/308 (11%)

Query: 69  FGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAVRATQGKGVMP 128
            G  G G+++ VG  V + K GD VI    + C  C+ C     + C     T G G   
Sbjct: 98  LGHEGIGIIDEVGDAVHNFKKGDRVIVSCISRCGTCENCAKSLYSHC-----TNGGGW-- 150

Query: 129 DGTSRFRNSKGEPLLHFMGCSTFAEY--TVVADVSVVAIDRDAPLEKVCLLGCGVTTGYG 186
                        +L +M   T AEY  T  AD S+ ++  +   E   +L   + T + 
Sbjct: 151 -------------ILGYMIDGTQAEYVRTPFADTSLYSVPENLSDEAAVMLSDALPTAHE 197

Query: 187 AALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGATDFV 246
             ++  NV+ GDTVA+ GAG +G+  V  ++    S +IVVDI+D +   A + G+T  +
Sbjct: 198 IGVQMGNVKPGDTVAIVGAGPVGMGCVLTSQLYSPSLLIVVDIDDNRLAMAKEMGSTHTI 257

Query: 247 NPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACHKGWGQSIIIGVAAAG 306
           N        +  V K++E                Q   D  +   K  G    +GV    
Sbjct: 258 NSAK-----EDAVSKILEYTNGRGVDCVMEAVGAQATWDICQRVIKEGGHLANVGVHG-- 310

Query: 307 KEISTRPFQLVTGRVW--KGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRPFKEIN 364
                +P      ++W    +   G+   +  G L++    G LK +  +T+   F E++
Sbjct: 311 -----KPVNFEIDKLWIKNLTITSGLVNTNTTGMLMKSCCSGKLKSERLVTHHCNFGEMS 365

Query: 365 EGFEDLHH 372
             +    H
Sbjct: 366 GNYNIFKH 373

>KLLA0B00451g Chr2 complement(31822..32982) [1161 bp, 386 aa] {ON}
           weakly similar to uniprot|P35497 Saccharomyces
           cerevisiae YJR159W SOR1 Sorbitol dehydrogenase
          Length = 386

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 76/308 (24%), Positives = 125/308 (40%), Gaps = 36/308 (11%)

Query: 69  FGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAVRATQGKGVMP 128
            G  G G+V  VG  V ++K GD VI      C  C+ C  G    C           M 
Sbjct: 98  LGHEGTGIVTEVGDAVRNIKKGDKVIISCITRCGTCENCARGMYAHC-----------MN 146

Query: 129 DGTSRFRNSKGEPLLHFMGCSTFAEY--TVVADVSVVAIDRDAPLEKVCLLGCGVTTGYG 186
           DG        G  L + +   T AEY  T  AD S+ A+      E   LL   + T + 
Sbjct: 147 DG--------GWALGYSID-GTQAEYVRTPFADTSLYALPEGLSDENAVLLSDALPTAHE 197

Query: 187 AALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGATDFV 246
             ++  NV+ GD+VA+ GAG +G+  V  ++    S +IVVD++D + + A + GAT  +
Sbjct: 198 IGVQMGNVKPGDSVAILGAGPVGMGCVLTSQLYSPSLLIVVDMDDNRLEMAKEMGATHTI 257

Query: 247 NPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACHKGWGQSIIIGVAAAG 306
           N        +  V K++E+               Q   D  +   K  G    +GV    
Sbjct: 258 NSGK-----EDAVAKILEITNGRGVDCAMEAVGAQPTWDICQQIIKEGGHLANVGVHG-- 310

Query: 307 KEISTRPFQLVTGRVW--KGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRPFKEIN 364
                +P      ++W    +   G+   +    L+++   G L+ D+ +++   FK++ 
Sbjct: 311 -----KPVDFAIDKLWIKNLTITSGLVNTNTTSMLMKNCCSGKLQSDKLVSHHCNFKDMA 365

Query: 365 EGFEDLHH 372
             +    H
Sbjct: 366 NNYNIFKH 373

>YAL060W Chr1 (35155..36303) [1149 bp, 382 aa] {ON}
           BDH1NAD-dependent (R,R)-butanediol dehydrogenase,
           catalyzes oxidation of (R,R)-2,3-butanediol to
           (3R)-acetoin, oxidation of meso-butanediol to
           (3S)-acetoin, and reduction of acetoin; enhances use of
           2,3-butanediol as an aerobic carbon source
          Length = 382

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 64/212 (30%), Positives = 92/212 (43%), Gaps = 41/212 (19%)

Query: 65  VSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAEC--------------KECKMCKSG 110
           + L  G   +G+V  VGP VT VKVGDHV+    + C              K C  C+ G
Sbjct: 67  LPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAASSCADLHCWPHSKFYNSKPCDACQRG 126

Query: 111 KTNLCSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAP 170
             NLC+      G GV+  G                    FAE  VV+   ++ + ++ P
Sbjct: 127 SENLCTHA-GFVGLGVISGG--------------------FAEQVVVSQHHIIPVPKEIP 165

Query: 171 LEKVCLLGCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDIN 230
           L+   L+     T +  A+K +  +KG +  V GAG IGL  +   K   ASKI+V +I 
Sbjct: 166 LDVAALVEPLSVTWH--AVKISGFKKGSSALVLGAGPIGLCTILVLKGMGASKIVVSEIA 223

Query: 231 DTKKKFAFDFGATDFVNPKTDLKDGQTIVEKL 262
           + + + A   G   F NP    K G   +E L
Sbjct: 224 ERRIEMAKKLGVEVF-NPS---KHGHKSIEIL 251

>Smik_1.6 Chr1 (18115..19263) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 63/212 (29%), Positives = 94/212 (44%), Gaps = 41/212 (19%)

Query: 65  VSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAEC--------------KECKMCKSG 110
           + L  G   +G+V  VGP VT VKVGDHV+    + C              K C+ CK G
Sbjct: 67  LPLAMGHEMSGIVAEVGPKVTKVKVGDHVVVDAASSCADLHCWPQSKHYSSKPCEACKKG 126

Query: 111 KTNLCSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAP 170
             NLC+      G GV+  G                    FAE   V++  ++ + ++ P
Sbjct: 127 SENLCTH-GGFIGLGVISGG--------------------FAEQVAVSEHHIIPVPKEIP 165

Query: 171 LEKVCLLGCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDIN 230
           L+   L+     T +  A+K +  +KG +  V GAG IGL  +   K   A KI+V ++ 
Sbjct: 166 LDVAALVEPLSVTWH--AVKISGFKKGSSALVLGAGPIGLCTILVLKGMGAGKIVVSEVA 223

Query: 231 DTKKKFAFDFGATDFVNPKTDLKDGQTIVEKL 262
           + + + A + G   F NP    K GQ  +E L
Sbjct: 224 ERRIEMAKNLGVEVF-NPS---KHGQKSIEVL 251

>KLLA0F00506g Chr6 complement(36518..37675) [1158 bp, 385 aa] {ON}
           similar to uniprot|P39714 Saccharomyces cerevisiae
           YAL060W BDH1 NAD-dependent (2R 3R)-2 3-butanediol
           dehydrogenase
          Length = 385

 Score = 73.9 bits (180), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 60/208 (28%), Positives = 91/208 (43%), Gaps = 38/208 (18%)

Query: 69  FGARGAGVVESVGPDVTSVKVGDHVIALYTAEC--------------KECKMCKSGKTNL 114
            G   +G+V  VGP VT++K GDHV+   T  C               EC  C+ G  N 
Sbjct: 71  MGHEMSGIVSKVGPKVTNIKAGDHVVVEATGTCLDHYTWPNAAHAKDAECAACQRGFYNC 130

Query: 115 CSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKV 174
           C+ +    G GV   G                    FAE  VV++  VV I    PL+  
Sbjct: 131 CAHL-GFMGLGVHSGG--------------------FAEKVVVSEKHVVKIPNTLPLDVA 169

Query: 175 CLLGCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKK 234
            L+     + +  A++ + +QKG +  V GAG IGL+ +   +   ASKI+V +  + ++
Sbjct: 170 ALVEPISVSWH--AVRISKLQKGQSALVLGAGPIGLATILALQGHGASKIVVSEPAEIRR 227

Query: 235 KFAFDFGATDFVNPKTDLKDGQTIVEKL 262
             A   G   F +P    +D   I++KL
Sbjct: 228 NQAAKLGVETF-DPSEHKEDAVNILKKL 254

>Skud_1.3 Chr1 (11174..12322) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 73.9 bits (180), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 59/198 (29%), Positives = 87/198 (43%), Gaps = 38/198 (19%)

Query: 65  VSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAEC--------------KECKMCKSG 110
           + L  G   +G++  VGP VT VKVGDHV+    + C              K C+ CK G
Sbjct: 67  LPLAMGHEMSGIIAKVGPRVTKVKVGDHVVVDAGSSCADLHCWPHSKYYNSKPCEACKKG 126

Query: 111 KTNLCSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAP 170
             NLC A     G GV+  G                    FAE  VV++  ++ + ++ P
Sbjct: 127 SENLC-AHSGFVGLGVISGG--------------------FAEQVVVSEHHIIPVPKEIP 165

Query: 171 LEKVCLLGCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDIN 230
           L+   L+     T +  A+K +  +KG +  V GAG IGL  +   K   A KI+V ++ 
Sbjct: 166 LDVAALVEPLSVTWH--AVKLSGFKKGSSALVLGAGPIGLCTILVLKGMGAGKIVVSEVA 223

Query: 231 DTKKKFAFDFGATDFVNP 248
           + + K A       F NP
Sbjct: 224 ERRLKMAKSLDVEVF-NP 240

>Suva_1.7 Chr1 (12310..13458) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 71.6 bits (174), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 59/208 (28%), Positives = 92/208 (44%), Gaps = 41/208 (19%)

Query: 69  FGARGAGVVESVGPDVTSVKVGDHVIALYTAEC--------------KECKMCKSGKTNL 114
            G   +G++  VGP VT VKVGDHV+    + C              K C  CK G  NL
Sbjct: 71  MGHEMSGIIAKVGPKVTKVKVGDHVVVQAGSSCADLHCWPHSKHYNSKPCDACKKGCENL 130

Query: 115 CSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKV 174
           C+      G GV+  G                    FAE  VV++  ++ + ++ PL+  
Sbjct: 131 CTHA-GFIGLGVISGG--------------------FAEQVVVSEHHIIPVPKEIPLDVA 169

Query: 175 CLLGCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKK 234
            L+     T +  A++ +  +KG +  V GAG IGL  +   K   A +I+V ++ + + 
Sbjct: 170 ALVEPLSVTWH--AVRLSGFKKGSSALVLGAGPIGLCTILVLKGMGAGQIVVSEVAERRM 227

Query: 235 KFAFDFGATDFVNPKTDLKDGQTIVEKL 262
           + A   G   F +P+   K G+  VE L
Sbjct: 228 ELARRLGVEIF-DPR---KHGEKSVESL 251

>KLTH0D00616g Chr4 (59883..61031) [1149 bp, 382 aa] {ON} similar to
           uniprot|P39713 Saccharomyces cerevisiae YAL061W putative
           polyol dehydrogenase
          Length = 382

 Score = 70.9 bits (172), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 62/215 (28%), Positives = 96/215 (44%), Gaps = 49/215 (22%)

Query: 69  FGARGAGVVESVGPDVTSVKVGDHVIALYTAECKE--------------CKMCKSGKTNL 114
            G   +G+V  VG DV+ VKVGDHV+      C++              C  CK+G  N 
Sbjct: 71  MGHEMSGIVSKVGSDVSKVKVGDHVVVGACCTCEDRARWPDVKHEREGLCIACKTGNPNC 130

Query: 115 CSAVRATQGKGVMPDGTSRFRNSKGEPLLHF--MGCST--FAEYTVVADVSVVAIDRDAP 170
           C+                          L F  +GC +  FAE  V+++ +VV I    P
Sbjct: 131 CTD-------------------------LGFCGLGCQSGGFAEKIVLSERNVVKIPNSLP 165

Query: 171 LEKVCLLGCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDIN 230
           L+   L+     + +  A++ + +Q G T  V GAG IGL+ V   ++  A  IIV +  
Sbjct: 166 LDVAALVEPISVSWH--AVRISKLQPGQTALVLGAGPIGLAAVLALQSHGAGTIIVSEPA 223

Query: 231 DTKKKFAFDFGATDFVNPKTDLKDGQTIVEKLVEM 265
           DT+++ A   GA  F NP    + G  ++E L ++
Sbjct: 224 DTRRQKAEALGAQTF-NPT---EHGDNVIEALRKL 254

>SAKL0B00814g Chr2 (74565..75629) [1065 bp, 354 aa] {ON} similar to
           uniprot|P35497 Saccharomyces cerevisiae YJR159W SOR1
           Sorbitol dehydrogenase expression is induced in the
           presence of sorbitol
          Length = 354

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 86/325 (26%), Positives = 143/325 (44%), Gaps = 46/325 (14%)

Query: 67  LCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAVRATQGKGV 126
           +  G   +GVV  VG  VTSVKVGD V        +  K  KSG  NLC ++       +
Sbjct: 63  MVLGHESSGVVVEVGSKVTSVKVGDRVAIEPGVPSRYSKATKSGHYNLCPSMAFAATPPI 122

Query: 127 MPDGTS-RFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTTGY 185
             DGT  ++  S  + L+      +F E   V  +SV                 GV    
Sbjct: 123 --DGTLLKYYLSPEDFLVKLPDSVSFEEGACVEPLSV-----------------GV---- 159

Query: 186 GAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGATDF 245
             A K A+V+ G  V VFGAG +GL     ++A  A+ ++ VD+ D K +   +FGAT  
Sbjct: 160 -HANKLADVRFGSKVVVFGAGPVGLLAGAVSRAFGATDVVFVDVFDHKLERTNEFGATQT 218

Query: 246 VNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQV-MRDALEACHKGWGQSIIIGVAA 304
           VN  +  K    +V+++  +               +V +R  ++AC  G G+ + +G+  
Sbjct: 219 VN-SSKFKSEDDLVKEIQRVLSGEQPEVVFECSGAEVCIRAGIKACKAG-GRYVQVGMGK 276

Query: 305 AG-----KEISTRPFQLV-TGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKR 358
                   E+ ++  Q++ T R   G     VK  SE          G + +   IT++ 
Sbjct: 277 DNVNFPISEVVSKELQVLGTFRYCFGDYNDSVKLISE----------GKVNVKPLITHRF 326

Query: 359 PFKEINEGFE-DLHHG-DCLRTVLN 381
            F++  + +E ++ HG D ++T+++
Sbjct: 327 KFQDAIKAYEFNIEHGEDVVKTIID 351

>TBLA0A04290 Chr1 (1063289..1064476) [1188 bp, 395 aa] {ON} Anc_7.3
           YAL060W
          Length = 395

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 78/191 (40%), Gaps = 37/191 (19%)

Query: 69  FGARGAGVVESVGPDVTSVKVGDHVIALYTAECKE--------------CKMCKSGKTNL 114
            G   AGVV  VGP V   KVGDHV+   T  CK+              C  CK G  N+
Sbjct: 71  MGHEMAGVVSRVGPGVKKFKVGDHVVVEPTGTCKDRYRWKNSPSKNDDMCNACKKGYYNI 130

Query: 115 CSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKV 174
           CS +    G GV   G                    FAE  V+ +     +  D PL+  
Sbjct: 131 CSKL-GLCGAGVQSGG--------------------FAERVVMNESHCHKVPDDLPLDIA 169

Query: 175 CLLGCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKK 234
            L+       +  AL+  N +KG +  V G+G IGL ++        + I+V +    ++
Sbjct: 170 ALIQPIAVCWH--ALRICNFKKGSSALVVGSGPIGLGIILALHGHGCTDIVVSEPAKIRR 227

Query: 235 KFAFDFGATDF 245
            FA + GAT F
Sbjct: 228 DFAKELGATVF 238

>Kwal_55.19574 s55 complement(32260..33330) [1071 bp, 356 aa] {ON}
           YJR159W (SOR1) - sorbitol-induced sorbitol dehydrogenase
           [contig 159] FULL
          Length = 356

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 69/212 (32%), Positives = 92/212 (43%), Gaps = 31/212 (14%)

Query: 58  FGSEVRCVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSA 117
            G  +    +  G   +GVV  VGP V  +KVGD V        +     K+GK NLC  
Sbjct: 54  IGKYILNSPMVLGHESSGVVVEVGPKVEKIKVGDRVAIEPGVPDRYSDETKAGKYNLCPH 113

Query: 118 VRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCL- 176
           +       +  DGT          L+ +        Y   AD  V   D  +  E  C+ 
Sbjct: 114 MAFAATPPI--DGT----------LVKY--------YLSPADFLVKLPDHVSFEEGACIE 153

Query: 177 -LGCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKK 235
            L  GV +      K A V+ G TV VFGAG +GL     AKA  AS ++ VD+ D K +
Sbjct: 154 PLSVGVHSN-----KLAKVRFGQTVVVFGAGPVGLLTGAVAKAFGASDVVFVDVFDQKLE 208

Query: 236 FAFDFGATDFVN----PKTDLKDGQTIVEKLV 263
            A +FGAT  +N    PK D +     VEKL+
Sbjct: 209 RAKNFGATHVINSTKLPKNDPQALADEVEKLL 240

>TDEL0H04460 Chr8 complement(769988..771136) [1149 bp, 382 aa] {ON}
           Anc_7.2 YAL061W
          Length = 382

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 63/210 (30%), Positives = 86/210 (40%), Gaps = 39/210 (18%)

Query: 69  FGARGAGVVESVGPDVTSVKVGDHVIALYTAEC--------------KECKMCKSGKTNL 114
            G   +G+V  +G  VT VKVGDHV+      C              K C  C+ G  N+
Sbjct: 71  MGHEMSGIVSKIGSKVTKVKVGDHVVVEAGCSCMDVKRWKESPLKGGKTCSACEKGLVNI 130

Query: 115 CSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKV 174
           C+    T G G    G                    FAE   V+    + I +D PL+  
Sbjct: 131 CAHACFT-GLGTSGGG--------------------FAERLTVSQDHCIPIPKDLPLDVA 169

Query: 175 CLLGCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKK 234
            L+     T + A  K A  QKG T  V GAG IGL+ +   K   ASKI+V ++   ++
Sbjct: 170 ALVEPLSVTWHAA--KVAGFQKGQTACVLGAGPIGLATILTLKGLGASKIVVSELAQIRR 227

Query: 235 KFAFDFGATDFVNPKTDLKDGQTIVEKLVE 264
             A   G   F NP  + KD    + K+ E
Sbjct: 228 DMAASMGVEVF-NP-AEHKDAIAELRKIPE 255

>Kwal_26.6739 s26 (46044..47192) [1149 bp, 382 aa] {ON} YAL060W
           (BDH1) - (2R,3R)-2,3-butanediol dehydrogenase [contig
           44] FULL
          Length = 382

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 87/198 (43%), Gaps = 46/198 (23%)

Query: 69  FGARGAGVVESVGPDVTSVKVGDHVIALYTAECK--------------ECKMCKSGKTNL 114
            G   +GVV  +GP V ++KVGDHV+   T  CK              EC  CK    N 
Sbjct: 71  MGHEMSGVVAKIGPGVKNIKVGDHVVVETTGTCKDRYRWPDVKHASDEECAACKKDFYNC 130

Query: 115 CSAVRATQGKGVMPDGTSRFRNSKGEPLLHF--MGCST--FAEYTVVADVSVVAIDRDAP 170
           CS                          L F  +GC +  FAE  V+++  VV + +D P
Sbjct: 131 CSE-------------------------LGFCGLGCHSGGFAEKVVISEKHVVKVPKDIP 165

Query: 171 LEKVCLLGCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDIN 230
           L+   L+     + +  A++ + ++ G +  + GAG IGL+ V   +   A  I+V + +
Sbjct: 166 LDVAALVEPLAVSWH--AVRISQLKAGQSALILGAGPIGLATVLALQGHGAGTIVVSEPS 223

Query: 231 DTKKKFAFDFGATDFVNP 248
            +++K A   GA  F NP
Sbjct: 224 ASRRKQAEALGALTF-NP 240

>TBLA0I01140 Chr9 (233777..234910) [1134 bp, 377 aa] {ON} Anc_2.480
           YMR083W
          Length = 377

 Score = 65.1 bits (157), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 73/256 (28%), Positives = 107/256 (41%), Gaps = 33/256 (12%)

Query: 10  TCTAAVAYAAGKPLTVEQITVEAPTGARGAYQDHQHCYLPHGCVHSVWFGSEVRCVSLCF 69
           T  A V Y  G PL    I V  P        + ++  + H  +H+ W G     V L  
Sbjct: 35  TQKAVVFYENGGPLKYTTIPVPKPK-PNEILINVKYSGVCHTDLHA-WKGDWPLAVKLPL 92

Query: 70  --GARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQGKGV 126
             G  GAGVV + G +V + ++GD+  I      C  C++C+ G  + C     +   G 
Sbjct: 93  VGGHEGAGVVVAKGSEVKNFEIGDYAGIKWLNGSCMSCELCEKGFESNCEQADLS---GY 149

Query: 127 MPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTTGYG 186
             DG                   +F +Y     V    I ++  L +V  + C   T Y 
Sbjct: 150 THDG-------------------SFQQYATADAVQAAHIPKNVDLAEVAPILCAGVTVY- 189

Query: 187 AALKTANVQKGDTVAVFGA-GTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGA--- 242
            ALKTA+V+ G  VA+ GA G +G   VQ AKA    +++ +D  D KKK     G    
Sbjct: 190 KALKTADVKPGQWVAISGACGGLGSLAVQYAKAM-GLRVVGIDGGDEKKKLFHSLGGDIF 248

Query: 243 TDFVNPKTDLKDGQTI 258
            DF    + +KD Q +
Sbjct: 249 VDFTKTHSIVKDIQDV 264

>KLTH0D05588g Chr4 complement(502176..503345) [1170 bp, 389 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3 Alcohol dehydrogenase isoenzyme III
          Length = 389

 Score = 65.1 bits (157), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 90/205 (43%), Gaps = 29/205 (14%)

Query: 50  HGCVHSVWFGSEVRCVSLCF--GARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKM 106
           H  +H+ W G     V L    G  GAGVV + G +VT+ ++GD+  I      C  C++
Sbjct: 86  HTDLHA-WKGDWPLAVKLPLVGGHEGAGVVVAKGENVTNFEIGDYAGIKWLNGSCMSCEL 144

Query: 107 CKSGKTNLCSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAID 166
           C+ G    C     +   G   DG                   +F +Y     V    I 
Sbjct: 145 CEQGNEPNCEHADLS---GYTHDG-------------------SFQQYATADAVQAAQIP 182

Query: 167 RDAPLEKVCLLGCGVTTGYGAALKTANVQKGDTVAVFG-AGTIGLSVVQGAKAREASKII 225
           +   L ++  + C   T Y  ALKTA+V+ G  VA+ G AG +G   VQ AKA    +++
Sbjct: 183 KGTDLAQIAPILCAGVTVY-KALKTADVRPGQWVAISGAAGGLGSLAVQYAKAM-GLRVL 240

Query: 226 VVDINDTKKKFAFDFGATDFVNPKT 250
            +D  + KKK   D G   F++ +T
Sbjct: 241 GIDGGEDKKKLFHDLGGETFIDFRT 265

>KAFR0I00160 Chr9 (33043..34200) [1158 bp, 385 aa] {ON} Anc_7.2
           YAL061W
          Length = 385

 Score = 62.0 bits (149), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 76/191 (39%), Gaps = 37/191 (19%)

Query: 69  FGARGAGVVESVGPDVTSVKVGDHVIALYTAECKE--------------CKMCKSGKTNL 114
            G   AG V  +GP VT  KVGDHV+      CK+              C  CK G  N+
Sbjct: 71  MGHEIAGTVVKIGPKVTKFKVGDHVVVQPNGTCKDRYRWPHSPHVNKPWCSACKKGHYNV 130

Query: 115 CSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKV 174
           CS +    G GV   G                     AE   + +     + +D P++  
Sbjct: 131 CSNL-GLIGNGVQSGGC--------------------AERMCINESHCFKVPKDMPMDIA 169

Query: 175 CLLGCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKK 234
            L+     + +  A+K A  ++G +V V G G IGL  +   +    S I+V +    ++
Sbjct: 170 ALIQPIAVSWH--AIKVARFKRGGSVLVIGGGPIGLCTLLALQGHGCSDIVVSEPAKVRR 227

Query: 235 KFAFDFGATDF 245
           + A   GAT +
Sbjct: 228 ELAERMGATTY 238

>SAKL0D14894g Chr4 complement(1230497..1231654) [1158 bp, 385 aa]
           {ON} similar to uniprot|P39713 Saccharomyces cerevisiae
           YAL061W putative polyol dehydrogenase
          Length = 385

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 79/191 (41%), Gaps = 37/191 (19%)

Query: 69  FGARGAGVVESVGPDVTSVKVGDHVIALYTAEC--------------KECKMCKSGKTNL 114
            G   AGVV  +GP V   +VGDHV+   T+ C              + C  CK G  N+
Sbjct: 71  MGHEMAGVVSKIGPGVQGFEVGDHVVVEPTSTCLDRYRFPNSKHSGEEPCAACKRGLYNI 130

Query: 115 CSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKV 174
           CS +    G GV   G                    F+E  V+    V+ I +  PL+  
Sbjct: 131 CSHL-GLCGVGVQSGG--------------------FSERVVMNQKHVIKIPKHIPLDVA 169

Query: 175 CLLGCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKK 234
            L+     + +  A++ + +  G +  V G G IGL  +   +A  ASKI+V +    ++
Sbjct: 170 ALVQPLAVSWH--AIRISGLTAGKSALVVGGGPIGLGTILALQAYGASKIVVSEPAKNRR 227

Query: 235 KFAFDFGATDF 245
           + A   GA  F
Sbjct: 228 ELAKLMGAEVF 238

>KLTH0G18986g Chr7 complement(1639254..1640318) [1065 bp, 354 aa]
           {ON} similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase expression is
           induced in the presence of sorbitol
          Length = 354

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 72/324 (22%), Positives = 143/324 (44%), Gaps = 44/324 (13%)

Query: 67  LCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAVRATQGKGV 126
           +  G   +G+V  VG +V+ V+VGD V        +     K+G+ NLC  ++      +
Sbjct: 63  MILGHESSGLVVEVGSEVSRVRVGDRVAIEPGVPSRYSDETKAGRYNLCPHMQFAATPPI 122

Query: 127 MPDGT-SRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTTGY 185
             DGT  ++  +  + L+      ++ E  +V  +SV                 GV    
Sbjct: 123 --DGTLVKYYLAPEDFLVKLPDHVSYEEGALVEPLSV-----------------GVH--- 160

Query: 186 GAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGATDF 245
             A K A V     VAVFGAG +GL     A+A  AS+++ +D+ + K   + +FG T F
Sbjct: 161 --ANKLAGVAFNQRVAVFGAGPVGLLTGAVARAFGASEVVYIDVFEHKLSLSSNFGGTQF 218

Query: 246 VNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQV-MRDALEACHKGWGQSIIIGVAA 304
           VN   ++KD   +V+++  +               ++ +R  ++ C+ G G  + +G+  
Sbjct: 219 VN-SANIKDEDDLVKEIERVLGGARPDVVFDCTGAEICIRTGIKVCNSG-GTYVQVGM-- 274

Query: 305 AGKEISTRPFQLVTGRVWK-----GSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRP 359
            G +    P   +  +  K       AFG  +   ++ +       G++ +   +T++  
Sbjct: 275 -GHDDVNFPIGAIGAKELKVLGCFRYAFGDYRDAVQLIA------SGDVNVKPLVTHRFK 327

Query: 360 FKEINEGFE-DLHHG-DCLRTVLN 381
           F++    +E ++ HG + ++T+++
Sbjct: 328 FEDAEAAYEFNIKHGSEVIKTIIS 351

>CAGL0J01441g Chr10 complement(134383..135501) [1119 bp, 372 aa]
           {ON} highly similar to uniprot|P07246 Saccharomyces
           cerevisiae YMR083w ADH3 or uniprot|P00330 Saccharomyces
           cerevisiae YOL086c ADH1 or uniprot|P00331 Saccharomyces
           cerevisiae YMR303c ADH2
          Length = 372

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 56/202 (27%), Positives = 89/202 (44%), Gaps = 27/202 (13%)

Query: 65  VSLCFGARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQG 123
           + L  G  GAGVV + G  VT+ ++GD+  I      C  C+ C+ G  + C+    +  
Sbjct: 85  LPLVGGHEGAGVVVAKGSSVTNFEIGDYAGIKWLNGSCMSCEFCEQGNESNCAKADLS-- 142

Query: 124 KGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTT 183
            G   DG                   +F +Y     +    I +   L +V  + C   T
Sbjct: 143 -GYTHDG-------------------SFQQYATADAIQAAQIPKGTDLAQVAPILCAGVT 182

Query: 184 GYGAALKTANVQKGDTVAVFG-AGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGA 242
            Y  ALK ++V+ G  VA+ G AG +G   VQ AKA    +++ +D  D K+K     G 
Sbjct: 183 VY-KALKDSDVKPGQWVAISGAAGGLGSLAVQYAKAM-GMRVLGIDAGDEKRKLFESLGG 240

Query: 243 TDFVNPKTDLKDGQTIVEKLVE 264
             FV+  T  KD  + ++++ E
Sbjct: 241 NHFVD-FTKTKDLVSEIQEITE 261

>KNAG0K01040 Chr11 complement(204636..205811) [1176 bp, 391 aa] {ON}
           
          Length = 391

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 75/322 (23%), Positives = 119/322 (36%), Gaps = 55/322 (17%)

Query: 69  FGARGAGVVESVGPDVTSVKVGDHVIALYTAECKE--------------CKMCKSGKTNL 114
            G   AG+V  VG  VT  KVGDHV    T  C++              C  CK G  N+
Sbjct: 71  MGHEMAGIVREVGSGVTQFKVGDHVSVEPTGTCRDRYRWPEAPGVNKEKCAACKRGMYNV 130

Query: 115 CSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKV 174
           CS +    G GV   G                    FAE  V+ +     +    P+E V
Sbjct: 131 CSHL-GLIGNGVQSGG--------------------FAERVVINESHCYKLPNHIPMEVV 169

Query: 175 CLLGCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKK 234
            L+     + +  A++ +  + G +V + G G IGLS +        ++I+V +    ++
Sbjct: 170 ALVQPIAVSWH--AVRVSKFKPGSSVLILGGGPIGLSTILALNGHGCTEIVVSEPAKIRR 227

Query: 235 KFAFDFGATDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACHKGW 294
             A   GA  + +P     +      + +                   +R ++E C    
Sbjct: 228 DLAEKMGAVVY-DPMQHSYEENIKYLRALAPDKDGFDYCFDCSGTPATLRSSIE-CLTFR 285

Query: 295 GQSIIIGVAAAGKEISTRPFQLVTG-RVWKGSA------FGGVKGRSEMGSLIEDYNKGN 347
           G ++ + + A GK I   P  +    + + GS       F GV    E G++  +     
Sbjct: 286 GTAVNVAMWATGKPIDFFPMDITQQEKSYTGSMCYTHHDFEGVIDALEKGTIDPE----- 340

Query: 348 LKIDEFITNKRPFKEINEGFED 369
            K    IT K P   +  GFED
Sbjct: 341 -KAQHMITAKVP---LERGFED 358

>KAFR0A00790 Chr1 complement(140666..141799) [1134 bp, 377 aa] {ON}
           Anc_2.480 YMR083W
          Length = 377

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 88/362 (24%), Positives = 148/362 (40%), Gaps = 43/362 (11%)

Query: 15  VAYAAGKPLTVEQITVEAPTGARGAYQDHQHCYLPHGCVHSVWFGSEVRCVSLCF--GAR 72
           + Y  G PLT + + V  P        + ++  + H  +H+ W G     V L    G  
Sbjct: 37  IFYENGGPLTYKDMPVPVPK-PNEILINVKYSGVCHTDLHA-WKGDWPLPVKLPLVGGHE 94

Query: 73  GAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQGKGVMPDGT 131
           GAG+V + G +V + ++GD   I      C  C++C+ G  + C     +   G   DG+
Sbjct: 95  GAGIVVAKGSNVKNFEIGDLAGIKWLNGSCMACELCEKGYESNCEHADLS---GYTHDGS 151

Query: 132 SRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTTGYGAALKT 191
                              F +Y          I R   L +V  + C   T Y  ALKT
Sbjct: 152 -------------------FQQYATADATQAAQIPRGTDLAEVAPILCAGVTVY-KALKT 191

Query: 192 ANVQKGDTVAVFGA-GTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGATDFVNPKT 250
           A +Q G+ VA+ GA G +G   +Q AKA    +++ +D  + K K   + G   F++  T
Sbjct: 192 AALQPGEWVAISGACGGLGSLAIQYAKAM-GLRVLGIDGGEAKAKMFKELGGETFID-FT 249

Query: 251 DLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACH---KGWGQSIIIGVAAAGK 307
             K+ + +++ + E              NV V   A+ A     +  G  +I+G+  AG 
Sbjct: 250 KYKNNEAMIKDIQE----ATKGGPQGVINVSVSEAAISASTQYVRPTGTVVIVGM-PAGA 304

Query: 308 EISTRPFQLVTGRV-WKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRPFKEINEG 366
            + +  F  V   +  KGS  G    R++    I+ +++G +K    +       +I E 
Sbjct: 305 YVKSDVFSHVVKSISIKGSYVG---NRADTREAIDFFSRGLVKSPITVVGLSELPKIYEL 361

Query: 367 FE 368
            E
Sbjct: 362 ME 363

>SAKL0D14872g Chr4 complement(1226093..1227244) [1152 bp, 383 aa]
           {ON} highly similar to gnl|GLV|KLLA0F00506g
           Kluyveromyces lactis KLLA0F00506g and similar to YAL060W
           uniprot|P39714 Saccharomyces cerevisiae YAL060W BDH1
           NAD- dependent (2R 3R)-2 3-butanediol dehydrogenase a
           zinc- containing medium-chain alcohol dehydrogenase
           produces 2 3- butanediol from acetoin during
           fermentation and allows using 2 3-butanediol as a carbon
           source during aerobic growth
          Length = 383

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 56/209 (26%), Positives = 89/209 (42%), Gaps = 42/209 (20%)

Query: 69  FGARGAGVVESVGPDVT-SVKVGDHVIALYTAECKE--------------CKMCKSGKTN 113
            G   +G+V  VGP V    KVGDHV+   T  C +              C  CK G  N
Sbjct: 71  MGHEMSGIVSKVGPGVKGDYKVGDHVVVEATCTCLDRYRWPKIESSKLPPCSACKRGIYN 130

Query: 114 LCSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEK 173
            C+ +    G G    G                    F+E  V+++  V+ I ++ PL+ 
Sbjct: 131 CCTHL-GFCGLGAHGGG--------------------FSEKVVISEQHVIKIPKEIPLDI 169

Query: 174 VCLLGCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTK 233
             L+     + +  A+K +N++ G +  V GAG IGL+ +   +   A KI+V +    +
Sbjct: 170 AALVEPISVSWH--AVKISNLKPGQSALVLGAGPIGLATILALQGHGAGKIVVSEPAQIR 227

Query: 234 KKFAFDFGATDFVNPKTDLKDGQTIVEKL 262
           ++ A   G   F NP    + G+  VE+L
Sbjct: 228 REQAAKLGVETF-NP---FEHGEKAVEEL 252

>Kpol_1058.11 s1058 (41165..42226) [1062 bp, 353 aa] {ON}
           (41165..42226) [1062 nt, 354 aa]
          Length = 353

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 87/200 (43%), Gaps = 24/200 (12%)

Query: 50  HGCVHSVWFGSEVRCVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKS 109
           H C H    GS +    +  G   +G+V  VG +VT V VGD V        +  +   S
Sbjct: 48  HFCTHG-AIGSFIVKEPMVLGHESSGIVVEVGSEVTKVAVGDRVAIEPGYPSRYSEETVS 106

Query: 110 GKTNLCSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDA 169
           G  NLC  ++      V  DGT          LL +        Y +  DV+    +  A
Sbjct: 107 GHYNLCPGMKFAATPPV--DGT----------LLKYFQVPEDFVYKLPDDVT---FEEGA 151

Query: 170 PLEKVCLLGCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDI 229
            +E    L   V      A+K A V+ GD V VFGAG +GL V    KA  A++++ +D+
Sbjct: 152 LVEP---LAVAVH-----AVKLAGVKFGDKVVVFGAGPVGLLVGSVCKAFGATEVVSIDV 203

Query: 230 NDTKKKFAFDFGATDFVNPK 249
            D K   + + G+T  +N K
Sbjct: 204 VDKKLDKSLEMGSTIAINSK 223

>Skud_20.2 Chr20 (1588..2661) [1074 bp, 357 aa] {ON} YJR159W (REAL)
          Length = 357

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 81/331 (24%), Positives = 134/331 (40%), Gaps = 42/331 (12%)

Query: 59  GSEVRCVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAV 118
           G  +    +  G   +G V  VG  VT VK+GD V        +     K G+ NLC  +
Sbjct: 56  GKYILKAPMVLGHESSGQVVEVGDAVTRVKIGDRVAIEPGVPGRYSDETKEGRYNLCPHM 115

Query: 119 RATQGKGVMPDGT-SRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLL 177
                  +  DGT  R+  S  + L+      ++ E   V  +SV               
Sbjct: 116 AFAATPPI--DGTLVRYYLSPEDFLVKLPDGVSYEEGACVEPLSV--------------- 158

Query: 178 GCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFA 237
             GV +      K A V+ G  V VFGAG +GL     A A  AS +I VD+ D + + A
Sbjct: 159 --GVHSN-----KLAGVRFGTRVVVFGAGPVGLLTGAVAHAFGASDVIFVDVFDNRLQRA 211

Query: 238 FDFGAT-DFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACHKGWGQ 296
            DFGA+  F + K  + + Q + +++ ++                V  DA     K  G 
Sbjct: 212 KDFGASGTFNSSKFSVDEAQQLADEVEKLLGGHHADVVFECSGADVCIDAGVKTTKVGGT 271

Query: 297 SIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGVKG--RSEMGSLIEDYN---KGNLKID 351
            + +G+   GK  +  P   V+G+  +      + G  R   G   +  N    G + + 
Sbjct: 272 MVQVGM---GKNYTNFPIAEVSGKEMR------LIGCFRYSFGDYRDAVNLVASGKVNVK 322

Query: 352 EFITNKRPFKEINEGFED--LHHGDCLRTVL 380
             IT++  F++  + ++    H GD ++T++
Sbjct: 323 PLITHRFKFEDAAKAYDYNIAHGGDVVKTII 353

>Skud_4.2 Chr4 complement(6287..7360) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 81/331 (24%), Positives = 134/331 (40%), Gaps = 42/331 (12%)

Query: 59  GSEVRCVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAV 118
           G  +    +  G   +G V  VG  VT VK+GD V        +     K G+ NLC  +
Sbjct: 56  GKYILKAPMVLGHESSGQVVEVGDAVTRVKIGDRVAIEPGVPGRYSDETKEGRYNLCPHM 115

Query: 119 RATQGKGVMPDGT-SRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLL 177
                  +  DGT  R+  S  + L+      ++ E   V  +SV               
Sbjct: 116 AFAATPPI--DGTLVRYYLSPEDFLVKLPDGVSYEEGACVEPLSV--------------- 158

Query: 178 GCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFA 237
             GV +      K A V+ G  V VFGAG +GL     A A  AS +I VD+ D + + A
Sbjct: 159 --GVHSN-----KLAGVRFGTRVVVFGAGPVGLLTGAVAHAFGASDVIFVDVFDNRLQRA 211

Query: 238 FDFGAT-DFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACHKGWGQ 296
            DFGA+  F + K  + + Q + +++ ++                V  DA     K  G 
Sbjct: 212 KDFGASGTFNSSKFSVDEAQQLADEVEKLLGGHHADVVFECSGADVCIDAGVKTTKVGGT 271

Query: 297 SIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGVKG--RSEMGSLIEDYN---KGNLKID 351
            + +G+   GK  +  P   V+G+  +      + G  R   G   +  N    G + + 
Sbjct: 272 MVQVGM---GKNYTNFPIAEVSGKEMR------LIGCFRYSFGDYRDAVNLVASGKVNVK 322

Query: 352 EFITNKRPFKEINEGFED--LHHGDCLRTVL 380
             IT++  F++  + ++    H GD ++T++
Sbjct: 323 PLITHRFKFEDAAKAYDYNIAHGGDVVKTII 353

>Kwal_26.6684 s26 (21910..22980) [1071 bp, 356 aa] {ON} YJR159W
           (SOR1) - sorbitol-induced sorbitol dehydrogenase [contig
           381] FULL
          Length = 356

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 61/186 (32%), Positives = 79/186 (42%), Gaps = 27/186 (14%)

Query: 67  LCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAVRATQGKGV 126
           +  G   +G V  VG  V S+KVGD V        +     K G+ NLC  +       +
Sbjct: 63  MVLGHESSGEVVEVGSAVRSIKVGDRVAIEPGVPDRYSDETKQGRYNLCPDMAFAATPPI 122

Query: 127 MPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCL--LGCGVTTG 184
             DGT          L+ +        Y   AD  V   D  +  E  C+  L  GV   
Sbjct: 123 --DGT----------LVKY--------YVSPADFLVKLPDHVSFEEGACIEPLSVGVH-- 160

Query: 185 YGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGATD 244
              A K A V  G  V VFGAG +GL     AKA  AS++I VD+ D K + A  FGAT 
Sbjct: 161 ---ANKLAKVHFGSVVVVFGAGPVGLLTGAVAKAFGASEVIYVDVFDNKLERAKGFGATH 217

Query: 245 FVNPKT 250
            +N K+
Sbjct: 218 TINSKS 223

>NCAS0I02350 Chr9 (444097..445152) [1056 bp, 351 aa] {ON} Anc_3.118
          Length = 351

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 72/306 (23%), Positives = 126/306 (41%), Gaps = 34/306 (11%)

Query: 65  VSLCFGARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQG 123
           + L  G  GAGVV ++G  V   K+GD+  I      C  C+ C+ G  + C     +  
Sbjct: 64  LPLVGGHEGAGVVVAMGDAVKGWKIGDYAGIKWLNGSCMSCEYCELGNESNCPHADLS-- 121

Query: 124 KGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTT 183
            G   DG                   +F +Y     V    I   + L +V  + C   T
Sbjct: 122 -GYTHDG-------------------SFQQYATADAVQAARIAPGSDLAEVAPVLCAGIT 161

Query: 184 GYGAALKTANVQKGDTVAVFGA-GTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGA 242
            Y  ALK+AN++ G+ VA+ GA G +G   +Q AKA    +++ +D  D K K   D G 
Sbjct: 162 VY-KALKSANLRAGEWVAISGACGGLGSLAIQFAKAM-GYRVVGIDGGDEKAKMFKDLGG 219

Query: 243 TDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACHKGWGQSIIIGV 302
             F+    D    + IV  +++              + Q +  +++ C    G ++++G+
Sbjct: 220 EVFI----DFTKTKDIVGDIIKATNGGAHGVINVSVSEQAIDASVKYCRAN-GTAVLVGM 274

Query: 303 AAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRPFKE 362
              G ++ +  F  V   +    ++  V  R++    ++ +++G +K    I       E
Sbjct: 275 -PGGAQVKSDVFNQVVKSISIVGSY--VGNRADTREALDFFSRGLVKSPIHIAKLSDVPE 331

Query: 363 INEGFE 368
           I E  E
Sbjct: 332 IFEKME 337

>YJR159W Chr10 (736044..737117) [1074 bp, 357 aa] {ON}  SOR1Sorbitol
           dehydrogenase; expression is induced in the presence of
           sorbitol or xylose
          Length = 357

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 83/331 (25%), Positives = 132/331 (39%), Gaps = 42/331 (12%)

Query: 59  GSEVRCVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAV 118
           G  +    +  G   +G V  VG  VT VKVGD V        +     K G+ NLC  +
Sbjct: 56  GKYILKAPMVLGHESSGQVVEVGDAVTRVKVGDRVAIEPGVPSRYSDETKEGRYNLCPHM 115

Query: 119 RATQGKGVMPDGT-SRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLL 177
                  +  DGT  ++  S  + L+      ++ E   V  +SV               
Sbjct: 116 AFAATPPI--DGTLVKYYLSPEDFLVKLPEGVSYEEGACVEPLSV--------------- 158

Query: 178 GCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFA 237
             GV +      K A V+ G  V VFGAG +GL     A+A  A+ +I VD+ D K + A
Sbjct: 159 --GVHSN-----KLAGVRFGTKVVVFGAGPVGLLTGAVARAFGATDVIFVDVFDNKLQRA 211

Query: 238 FDFGATDFVNPKTDLKD-GQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACHKGWGQ 296
            DFGAT+  N      D  Q + + + ++                V  DA     K  G 
Sbjct: 212 KDFGATNTFNSSQFSTDKAQDLADGVQKLLGGNHADVVFECSGADVCIDAAVKTTKVGGT 271

Query: 297 SIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGVKG--RSEMGSLIEDYN---KGNLKID 351
            + +G+   GK  +  P   V+G+  K      + G  R   G   +  N    G + + 
Sbjct: 272 MVQVGM---GKNYTNFPIAEVSGKEMK------LIGCFRYSFGDYRDAVNLVATGKVNVK 322

Query: 352 EFITNKRPFKEINEGFED--LHHGDCLRTVL 380
             IT+K  F++  + ++    H G+ ++T++
Sbjct: 323 PLITHKFKFEDAAKAYDYNIAHGGEVVKTII 353

>CAGL0D00198g Chr4 (27559..28710) [1152 bp, 383 aa] {ON} similar to
           uniprot|P39714 Saccharomyces cerevisiae YAL060w FUN49 or
           uniprot|P39713 Saccharomyces cerevisiae YAL061w FUN50
          Length = 383

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 81/326 (24%), Positives = 131/326 (40%), Gaps = 50/326 (15%)

Query: 65  VSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKE--------------CKMCKSG 110
           + L  G   +G+V+ VG  VT  K GD V+   T  C +              C  C+ G
Sbjct: 67  LPLPMGHEMSGIVKEVGKGVTRFKPGDRVVIEATTSCGDTHRWPKSKVAKGELCPACEMG 126

Query: 111 KTNLCSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAP 170
             N C+   + QG G +  G                    FAE  VV +  VV I    P
Sbjct: 127 LPNCCTH-GSFQGLGSVGGG--------------------FAEQVVVGEKHVVKIPDKLP 165

Query: 171 LEKVCLLGCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDIN 230
           L+   L+   ++  + AA + A  ++G    V G+G IGL+++   K  +A KI+V +  
Sbjct: 166 LDVAALVE-PLSVAWHAA-RLAEFKEGSNALVLGSGPIGLAMILALKGMKAGKIVVSEPA 223

Query: 231 DTKKKFAFDFGATDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEAC 290
             +++ A       F NP       Q  +EKL E+             +   ++D   A 
Sbjct: 224 KLRRELAEKLNVVVF-NPTH--TRAQNAIEKLKEL--SPKDHGFDYTFDCSGVQDTFNAA 278

Query: 291 HKGWG-QSIIIGVAAAG-KEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNL 348
            K    Q  I+ VA  G K ++  P  +  G        G V    E   +++  +KG +
Sbjct: 279 VKAACIQGHIVNVAIWGPKPVAFHPMDMTYGEKKLTGTMGYVTRDFE--EVVDAIDKGYI 336

Query: 349 KIDE---FITNKRPFKE-INEGFEDL 370
            I+E    IT +   ++ + +GF +L
Sbjct: 337 SIEECKLLITGRVKLEDGMEKGFHEL 362

>KLLA0F21010g Chr6 (1962951..1964003) [1053 bp, 350 aa] {ON}
           uniprot|P20369 Kluyveromyces lactis KLLA0F21010g ADH1
           Alcohol dehydrogenase 1
          Length = 350

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 85/202 (42%), Gaps = 30/202 (14%)

Query: 65  VSLCFGARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQG 123
           + L  G  GAGVV ++G +V   K+GD   I      C  C+ C+    + C     +  
Sbjct: 63  LPLVGGHEGAGVVVAMGENVKGWKIGDFAGIKWLNGSCMSCEYCELSNESNCPEADLS-- 120

Query: 124 KGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTT 183
            G   DG                   +F +Y     V    I     L +V  + C   T
Sbjct: 121 -GYTHDG-------------------SFQQYATADAVQAAKIPVGTDLAEVAPVLCAGVT 160

Query: 184 GYGAALKTANVQKGDTVAVFG-AGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGA 242
            Y  ALK+AN++ GD VA+ G AG +G   VQ AKA    +++ +D  + K K   D G 
Sbjct: 161 VY-KALKSANLKAGDWVAISGAAGGLGSLAVQYAKAM-GYRVLGIDAGEEKAKLFKDLGG 218

Query: 243 TDFVNPKTDLKDGQTIVEKLVE 264
             F+    D    + I E+++E
Sbjct: 219 EYFI----DFTKSKNIPEEVIE 236

>KLTH0G15686g Chr7 complement(1367997..1369052) [1056 bp, 351 aa]
           {ON} highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086C ADH1 Alcohol dehydrogenase involved
           in the production of certain carboxylate esters
          Length = 351

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 82/188 (43%), Gaps = 26/188 (13%)

Query: 65  VSLCFGARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQG 123
           + L  G  GAGVV ++G +V   KVGD   I      C  C+ C+ G  + C     +  
Sbjct: 64  LPLVGGHEGAGVVVAMGENVKGWKVGDLAGIKWLNGSCMSCESCELGNESNCPEADLS-- 121

Query: 124 KGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTT 183
            G   DG+                   F +Y     V    I   A L ++  + C   T
Sbjct: 122 -GYTHDGS-------------------FQQYATADAVQAAKIPAGADLAEIAPILCAGIT 161

Query: 184 GYGAALKTANVQKGDTVAVFG-AGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGA 242
            Y  ALK+AN+Q GD VA+ G AG +G   VQ AKA    +++ +D  + K++     G 
Sbjct: 162 VY-KALKSANLQAGDWVAISGAAGGLGSLAVQYAKAM-GYRVLGIDGGEEKEQLFRQLGG 219

Query: 243 TDFVNPKT 250
             F++ +T
Sbjct: 220 EVFIDFRT 227

>TDEL0C00390 Chr3 (53995..55056) [1062 bp, 353 aa] {ON} Anc_8.16
           YLR070C
          Length = 353

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 65/200 (32%), Positives = 84/200 (42%), Gaps = 31/200 (15%)

Query: 67  LCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCS--AVRATQGK 124
           L  G   AGVV  VG  V+SVKVGD V        +  K   SG  NLC   A  AT   
Sbjct: 62  LVLGHESAGVVVEVGDAVSSVKVGDRVAVEPGVPSRYSKETMSGHYNLCPHMAFAATPPY 121

Query: 125 GVMPDGT-SRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTT 183
               DGT  ++  S  + +       +F E  VV  +SV                     
Sbjct: 122 ----DGTLVKYYLSPEDFVYKLADHISFEEGAVVEPLSVAV------------------- 158

Query: 184 GYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGAT 243
               A + AN   G  V V GAG +GL     AKA  A+ ++ VDI ++K + A  FGAT
Sbjct: 159 ---HANRLANTAFGQAVLVLGAGPVGLLAGAVAKAFGATDVVFVDIFESKLEKAKQFGAT 215

Query: 244 DFV--NPKTDLKDGQTIVEK 261
             V   P +D  D  ++V K
Sbjct: 216 RTVLFKPDSDENDLVSLVTK 235

>Kwal_47.17532 s47 (444594..445715) [1122 bp, 373 aa] {ON} YMR318C
           (ADH6) - NADPH-dependent alcohol dehydrogenase [contig
           207] FULL
          Length = 373

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 76/334 (22%), Positives = 122/334 (36%), Gaps = 51/334 (15%)

Query: 57  WFGSEVRCVSLCFGARG-------AGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCK 108
           W  + + C+S  +G +         G V +VGP V+   VGD V +    + C +C  C 
Sbjct: 57  WGHAPLACLSSKYGPKTQVVGHEVVGKVVAVGPQVSLCNVGDRVGLGAQASACMQCSRCN 116

Query: 109 SGKTNLCSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRD 168
           SG    C    +T  K   PDG              ++    +A +    +     I  +
Sbjct: 117 SGNEQYCPNAISTYCK-PYPDG--------------YVSQGGYASHVRAHEQFCFPIPPE 161

Query: 169 APLEKVCLLGCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVD 228
            P E V  L CG  T +    +    +    VAV G G +G   +  A+A  A ++    
Sbjct: 162 IPSELVAPLQCGGLTVFSPIKRNLQGKHDPKVAVIGIGGLGHMAIMIARALGA-EVYAFS 220

Query: 229 INDTKKKFAFDFGATDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALE 288
              +K+  A   GA  FV   T   D    ++   ++             N      A+ 
Sbjct: 221 RGHSKRDDALKMGAHHFV--ATGDADWNAGLDDTFDLILNCASSTSSLDLN------AML 272

Query: 289 ACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNL 348
            C K     + +G+    +E+S +PF             G   G S++GS  E      L
Sbjct: 273 PCLKVNCNFVSVGLPHIDEELSVKPFSFFKN--------GCNIGSSKLGSRSEAIELMQL 324

Query: 349 KIDEFITNKRPFKE--------INEGFEDLHHGD 374
            ++    N RP+ E        ++EG   L+ GD
Sbjct: 325 AVEH---NFRPWVETIKVSEAGVSEGLTRLNKGD 355

>YDL246C Chr4 complement(8683..9756) [1074 bp, 357 aa] {ON}
           SOR2Protein of unknown function; protein sequence is 99%
           identical to the Sor1p sorbitol dehydrogenase;
           computational analysis of large-scale protein-protein
           interaction data also suggests a role in fructose or
           mannose metabolism
          Length = 357

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 83/331 (25%), Positives = 131/331 (39%), Gaps = 42/331 (12%)

Query: 59  GSEVRCVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAV 118
           G  +    +  G   +G V  VG  VT VKVGD V        +     K G  NLC  +
Sbjct: 56  GKYILKAPMVLGHESSGQVVEVGDAVTRVKVGDRVAIEPGVPSRYSDETKEGSYNLCPHM 115

Query: 119 RATQGKGVMPDGT-SRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLL 177
                  +  DGT  ++  S  + L+      ++ E   V  +SV               
Sbjct: 116 AFAATPPI--DGTLVKYYLSPEDFLVKLPEGVSYEEGACVEPLSV--------------- 158

Query: 178 GCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFA 237
             GV +      K A V+ G  V VFGAG +GL     A+A  A+ +I VD+ D K + A
Sbjct: 159 --GVHSN-----KLAGVRFGTKVVVFGAGPVGLLTGAVARAFGATDVIFVDVFDNKLQRA 211

Query: 238 FDFGATDFVNPKTDLKD-GQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACHKGWGQ 296
            DFGAT+  N      D  Q + + + ++                V  DA     K  G 
Sbjct: 212 KDFGATNTFNSSQFSTDKAQDLADGVQKLLGGNHADVVFECSGADVCIDAAVKTTKVGGT 271

Query: 297 SIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGVKG--RSEMGSLIEDYN---KGNLKID 351
            + +G+   GK  +  P   V+G+  K      + G  R   G   +  N    G + + 
Sbjct: 272 MVQVGM---GKNYTNFPIAEVSGKEMK------LIGCFRYSFGDYRDAVNLVATGKVNVK 322

Query: 352 EFITNKRPFKEINEGFED--LHHGDCLRTVL 380
             IT+K  F++  + ++    H G+ ++T++
Sbjct: 323 PLITHKFKFEDAAKAYDYNIAHGGEVVKTII 353

>CAGL0I07843g Chr9 complement(756345..757403) [1059 bp, 352 aa] {ON}
           highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086c ADH1 alcohol dehydrogenase I or
           uniprot|P00331 Saccharomyces cerevisiae YMR303c ADH2
          Length = 352

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 78/185 (42%), Gaps = 26/185 (14%)

Query: 65  VSLCFGARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQG 123
           + L  G  GAGVV  +G +V   K+GD+  I      C  C+ C+    + C     +  
Sbjct: 65  LPLVGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCEKSNESNCPEADLS-- 122

Query: 124 KGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTT 183
            G   DG                   +F +Y     V    I +   L +V  + C   T
Sbjct: 123 -GYTHDG-------------------SFQQYATADYVQAARIPQGTDLAQVAPILCAGIT 162

Query: 184 GYGAALKTANVQKGDTVAVFG-AGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGA 242
            Y  ALK+AN+  G+ VA+ G AG +G   VQ AKA    +I+ +D  D KK    + G 
Sbjct: 163 VY-KALKSANLNAGEWVAISGAAGGLGSLAVQYAKAM-GYRILGIDGGDEKKALFHELGG 220

Query: 243 TDFVN 247
             FV+
Sbjct: 221 EIFVD 225

>Smik_48.1 Chr48 complement(1..1074) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 80/332 (24%), Positives = 132/332 (39%), Gaps = 42/332 (12%)

Query: 58  FGSEVRCVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSA 117
            G  +    +  G   +G V  VG  VT VKVGD V        +     K G+ NLC  
Sbjct: 55  IGKYILKAPMVLGHESSGEVVEVGNAVTRVKVGDRVAIEPGVPSRYSDETKEGRYNLCPH 114

Query: 118 VRATQGKGVMPDGT-SRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCL 176
           +       +  DGT  ++  S  + L+      ++ E   V  +SV              
Sbjct: 115 MAFAATPPI--DGTLVKYYLSPEDFLVKLPEGVSYEEGACVEPLSV-------------- 158

Query: 177 LGCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKF 236
              GV +      K A V+    V VFGAG +GL     A+A  AS ++ VD+ D K + 
Sbjct: 159 ---GVHSN-----KLAGVRFSTRVVVFGAGPVGLLTGAVARAFGASDVVFVDVFDNKLQR 210

Query: 237 AFDFGATD-FVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACHKGWG 295
           A DFGAT+ F + K      Q +  ++ ++                V  DA     K  G
Sbjct: 211 AKDFGATNTFNSSKIPTDKAQELASEVEKLLGGNHADVVFECSGADVCIDAGVKVTKVGG 270

Query: 296 QSIIIGVAAAGKEISTRPFQLVTGRVWK-----GSAFGGVKGRSEMGSLIEDYNKGNLKI 350
             + +G+   GK  +  P   V+G+  K       +FG  +    + +       G + +
Sbjct: 271 TMVQVGM---GKNYTNFPIAEVSGKEMKLIGCFRYSFGDYRDAVNLVA------TGKVNV 321

Query: 351 DEFITNKRPFKEINEGFED--LHHGDCLRTVL 380
              IT++  F++  + ++    H GD ++T++
Sbjct: 322 KPLITHRFKFEDAAKAYDYNISHGGDVVKTII 353

>Kpol_431.8 s431 (21043..22185) [1143 bp, 380 aa] {ON}
           (21043..22185) [1143 nt, 381 aa]
          Length = 380

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 58/202 (28%), Positives = 86/202 (42%), Gaps = 29/202 (14%)

Query: 50  HGCVHSVWFGSEVRCVSLCF--GARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKM 106
           H  +H+ W G     V L    G  GAGVV  +G +V   K+GD   I      C  C++
Sbjct: 77  HTDLHA-WKGDWPLAVKLPLVGGHEGAGVVVGIGENVKGWKLGDLAGIKWLNGSCMSCEL 135

Query: 107 CKSGKTNLCSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAID 166
           C++G    C     +   G   DG+                   F +Y     V    I 
Sbjct: 136 CETGHEANCEHADLS---GYTHDGS-------------------FQQYATADAVQAARIP 173

Query: 167 RDAPLEKVCLLGCGVTTGYGAALKTANVQKGDTVAVFG-AGTIGLSVVQGAKAREASKII 225
             + L ++  + C   T Y  ALKTAN++ G+ VA+ G AG +G   VQ AKA    +++
Sbjct: 174 EGSDLAQIAPILCAGITVY-KALKTANLKPGEWVAISGAAGGLGSLAVQYAKAM-GYRVV 231

Query: 226 VVDINDTKKKFAFDFGATDFVN 247
            +D  + K+K     G   FV+
Sbjct: 232 GIDGGEEKEKLFRSLGGEVFVD 253

>Ecym_5331 Chr5 (676233..677279) [1047 bp, 348 aa] {ON} similar to
           Ashbya gossypii AER032W
          Length = 348

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 88/203 (43%), Gaps = 30/203 (14%)

Query: 65  VSLCFGARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQG 123
           + L  G  GAGVV ++G +V   K+GD   I      C  C+ C+    + C        
Sbjct: 61  LPLVGGHEGAGVVVAMGENVRGWKIGDFAGIKWLNGSCMTCEYCEKSNESNC-------- 112

Query: 124 KGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTT 183
               PD            L  +    +F +Y     V    I +   L +V  + C   T
Sbjct: 113 ----PDAD----------LSGYTHDGSFQQYATADAVHAAKIPQGTDLAQVAPVLCAGIT 158

Query: 184 GYGAALKTANVQKGDTVAVFGA-GTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGA 242
            Y  ALK+A +Q G+ VA+ GA G +G   VQ AKA    +I+ +D  + KKK   + G 
Sbjct: 159 VY-KALKSARLQAGEWVAISGASGGLGSLAVQYAKAM-GYRILGIDSGEEKKKLFKELGG 216

Query: 243 TDFVNPKTDLKDGQTIVEKLVEM 265
             F+    D  + + +V +++++
Sbjct: 217 EYFI----DFAESKDVVAEVIKV 235

>NDAI0H02050 Chr8 complement(500914..502071) [1158 bp, 385 aa] {ON} 
          Length = 385

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 50/194 (25%), Positives = 83/194 (42%), Gaps = 40/194 (20%)

Query: 69  FGARGAGVVESVGPDVTSVKVGDHVIALYTAECKE-----------------CKMCKSGK 111
            G   +G V+++G +VT V+VGD V+      CK+                 C  C++G 
Sbjct: 71  MGHEFSGFVKAIGSNVTKVEVGDKVVVEAGCGCKDVHRWPDSKLYEKRKDTFCSACENGI 130

Query: 112 TNLCSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPL 171
            N C     T G GV+                       FAE  VV +  +V +  + P 
Sbjct: 131 DNCCENYDFT-GLGVV--------------------GGAFAERVVVGERHIVKLPEEVPT 169

Query: 172 EKVCLLGCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDIND 231
           + V  L   ++  +  A++ +  +KG +  + GAG IGL+ +   KA  ASKI+V ++ +
Sbjct: 170 D-VGALVEPISVAW-HAVRVSKFEKGKSALILGAGPIGLAAILALKAHGASKIVVSELAE 227

Query: 232 TKKKFAFDFGATDF 245
            ++  A   G   F
Sbjct: 228 RRRILASKMGVEVF 241

>Kpol_1049.18 s1049 complement(35191..36351) [1161 bp, 386 aa] {ON}
           complement(35191..36351) [1161 nt, 387 aa]
          Length = 386

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 52/211 (24%), Positives = 84/211 (39%), Gaps = 40/211 (18%)

Query: 69  FGARGAGVVESVGPDVTSVKVGDHVIALYTAECKE--------------CKMCKSGKTNL 114
            G   +G++ SVGP     K+GDHV+   TA C +              C+ C++G  N+
Sbjct: 71  MGHEISGIISSVGPGCKKFKIGDHVVVEPTATCIDRYRWPNAPNRDTPMCEACRNGMPNI 130

Query: 115 CSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKV 174
           C  +  T G GV   G                    FAE  V+ +     I    PL+  
Sbjct: 131 CKYLGLT-GAGVEGGG--------------------FAEKMVINEHHCHKIPHHMPLDVA 169

Query: 175 CLLGCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKK 234
            L+       +  A+K ++ ++G +V + G G IGL  +   K      I+V +    ++
Sbjct: 170 SLIQPISVCWH--AVKVSHYKQGGSVLIVGGGPIGLGTILALKGFGCEDIVVSEPALIRR 227

Query: 235 KFAFDFGATDFVNPKTDLKDGQTIVEKLVEM 265
           + A   GA  F      L +    ++ L EM
Sbjct: 228 ELAEKMGARVFDPSNMSLDNS---IKTLTEM 255

>NDAI0H02160 Chr8 (528551..529696) [1146 bp, 381 aa] {ON} Anc_2.480
          Length = 381

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 71/254 (27%), Positives = 101/254 (39%), Gaps = 33/254 (12%)

Query: 10  TCTAAVAYAAGKPLTVEQITVEAPTGARGAYQDHQHCYLPHGCVHSVWFGSEVRCVSLCF 69
           T  A V Y  G PL  + I V  P  A     + ++  + H  +H+ W G       L  
Sbjct: 39  TQKAVVFYENGGPLHYKDIPVPKPK-ANEILINVKYSGVCHTDLHA-WKGDWPLPTKLPL 96

Query: 70  --GARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQGKGV 126
             G  G+GVV  VG +V   KVGD   I      C  C++C++G  + C     +   G 
Sbjct: 97  VGGHEGSGVVMQVGENVKGWKVGDLAGIKWLNGSCMACELCETGNESNCEHADLS---GY 153

Query: 127 MPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTTGYG 186
             DG                   +F +Y     V    I     L +V  + C   T Y 
Sbjct: 154 THDG-------------------SFQQYATADAVQAARIPEGTNLAEVAPILCAGITVY- 193

Query: 187 AALKTANVQKGDTVAVFG-AGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGA--- 242
            ALK A+++ G  V + G AG +G   VQ AKA    ++I +D    K++     G    
Sbjct: 194 KALKEADLKAGQWVCISGAAGGLGSLAVQYAKAM-GYRVIGIDGGKAKEELFKSMGGEVF 252

Query: 243 TDFVNPKTDLKDGQ 256
            DF   K  +KD Q
Sbjct: 253 IDFTKSKDMVKDIQ 266

>Skud_13.240 Chr13 (408909..410036) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 83/202 (41%), Gaps = 29/202 (14%)

Query: 50  HGCVHSVWFGSEVRCVSLCF--GARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKM 106
           H  +H+ W G     V L    G  GAGVV  +G +V   KVGD   I      C  C+ 
Sbjct: 72  HTDLHA-WHGDWPLAVKLPLVGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEF 130

Query: 107 CKSGKTNLCSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAID 166
           C+SG  + C     +   G   DG                   +F ++     +    I 
Sbjct: 131 CESGHESNCPEADLS---GYTHDG-------------------SFQQFATADAIQAAKIQ 168

Query: 167 RDAPLEKVCLLGCGVTTGYGAALKTANVQKGDTVAVFG-AGTIGLSVVQGAKAREASKII 225
               L +V  + C   T Y  ALK AN++ GD VA+ G AG +G   VQ A A    +++
Sbjct: 169 PGTDLAEVAPILCAGVTVY-KALKEANLKAGDWVAISGAAGGLGSLAVQYATAM-GYRVL 226

Query: 226 VVDINDTKKKFAFDFGATDFVN 247
            +D  + K+K     G   F++
Sbjct: 227 GIDAGEEKEKLFKQLGGEVFID 248

>TBLA0E03440 Chr5 (852767..853822) [1056 bp, 351 aa] {ON} Anc_3.118
           YBR145W
          Length = 351

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 88/366 (24%), Positives = 143/366 (39%), Gaps = 44/366 (12%)

Query: 10  TCTAAVAYAAGKPLTVEQITVEAPTGARGAYQDHQHCYLPHGCVHSVWFGSEVRCVSLCF 69
           T  A + Y  G PL  + + V  P        + ++  + H  +H+ W G       L  
Sbjct: 9   TQKAVIFYKNGGPLEYKDVPVPTPK-PNEILINIKYSGVCHTDLHA-WKGDWPLDTKLPL 66

Query: 70  --GARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQGKGV 126
             G  GAGVV  +G +V   K+GD+  +      C  C+ C+    + C     +   G 
Sbjct: 67  IGGHEGAGVVVGMGSNVKGWKIGDYAGVKWLNGSCMSCEECELSNESNCPEADLS---GY 123

Query: 127 MPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTTGYG 186
             DG                   +F EY     V    I +   L +V  L C   T Y 
Sbjct: 124 THDG-------------------SFQEYCTADAVQAARIPQGTDLAQVAPLLCAGVTVY- 163

Query: 187 AALKTANVQKGDTVAVFGA-GTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGATDF 245
            ALK+A++  G  VA+ GA G +G   +Q AKA    +++ +D  + KKK   + G   F
Sbjct: 164 KALKSADLAAGQWVAISGACGGLGSLAIQFAKAM-GLRVLGIDGGEEKKKMFHELGGEVF 222

Query: 246 VNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACH---KGWGQSIIIGV 302
           ++ + + KD +  + K                 NV V   A+E+     +  G  +++G+
Sbjct: 223 LDFRLE-KDMEAAIIK-------ATNGGAHGVINVSVSEAAIESSTRYVRSNGTVVLVGL 274

Query: 303 AAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRPFKE 362
            A     S    Q+V      GS  G    R++    ++ +++G +K    I       E
Sbjct: 275 PANAYCKSEVFAQVVKSYKIVGSYVG---NRADTREALDFFSRGLVKSPIHIVGLSTLPE 331

Query: 363 INEGFE 368
           I E  E
Sbjct: 332 IYEKME 337

>NCAS0A07670 Chr1 complement(1527273..1528592) [1320 bp, 439 aa]
           {ON} 
          Length = 439

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/211 (24%), Positives = 81/211 (38%), Gaps = 42/211 (19%)

Query: 47  YLPH-GCVHSVWFGSEVRCVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKE-- 103
           + PH GC H +        +    G   AG +   GP VT  KVGD V+   T  CK+  
Sbjct: 91  FFPHDGCCHEI----SGEGLPQAMGHEIAGTIIECGPGVTKFKVGDRVVVEPTGTCKDRY 146

Query: 104 ------------CKMCKSGKTNLCSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTF 151
                       C  CK G  N+CS +    G GV   G                    F
Sbjct: 147 RWPNSPNVDKEPCAACKKGLYNICSNL-GLVGAGVQSGG--------------------F 185

Query: 152 AEYTVVADVSVVAIDRDAPLEKVCLLGCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLS 211
           AE  V+ +     +     ++   L+     + +  A++ +  +KG +V + GAG IGL 
Sbjct: 186 AERLVMNERQCYKVPDHMSMDVAALIQPIAVSWH--AVRVSKFKKGASVLIVGAGPIGLG 243

Query: 212 VVQGAKAREASKIIVVDINDTKKKFAFDFGA 242
            +        S+++V +    ++ FA   GA
Sbjct: 244 TILALNGHGVSEVVVSEPAKIRRDFAEKMGA 274

>Suva_1.6 Chr1 (10591..11844) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/191 (26%), Positives = 71/191 (37%), Gaps = 37/191 (19%)

Query: 69  FGARGAGVVESVGPDVTSVKVGDHVIALYTAECKE--------------CKMCKSGKTNL 114
            G   AG V  VGP VT  KVGD V+   T  C++              C  CK G  N+
Sbjct: 71  MGHEMAGTVAKVGPGVTQFKVGDKVVVEPTGTCRDRYRWPTSPNVDKEWCAACKRGLYNI 130

Query: 115 CSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKV 174
           CS +    G GV   G                    FAE  V+ +     +    PL+  
Sbjct: 131 CSYL-GLCGAGVQSGG--------------------FAERVVINESHCYKVPEFVPLDVA 169

Query: 175 CLLGCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKK 234
            L+       +  A+   + + G T  + GAG IGL  +    A   S I V +    ++
Sbjct: 170 ALIQPLAVCWH--AISVCDFKAGSTALIIGAGPIGLGTILALNAAGCSDIAVSEPAKVRR 227

Query: 235 KFAFDFGATDF 245
           + A   GA  F
Sbjct: 228 ELAEKMGARVF 238

>NDAI0A06930 Chr1 (1585575..1586630) [1056 bp, 351 aa] {ON}
           Anc_3.118
          Length = 351

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 80/185 (43%), Gaps = 26/185 (14%)

Query: 65  VSLCFGARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQG 123
           + L  G  GAG+V  VG +V   KVGD   I      C  C+ C+ G  + C     +  
Sbjct: 64  LPLVGGHEGAGIVVQVGENVQGWKVGDLAGIKWLNGSCMACEYCELGNESNCPNADLS-- 121

Query: 124 KGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTT 183
            G   DG                   +F +Y     V    I +   L +V  + C   T
Sbjct: 122 -GYTHDG-------------------SFQQYATADAVQAARIPQGTDLAEVAPVLCAGIT 161

Query: 184 GYGAALKTANVQKGDTVAVFG-AGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGA 242
            Y  ALK+AN++ G+ VA+ G AG +G   VQ AKA    +I+ +D  + K+K   + G 
Sbjct: 162 VY-KALKSANLRAGEWVAISGAAGGLGSLAVQYAKAM-GYRILGIDGGEEKEKLFRELGG 219

Query: 243 TDFVN 247
             F++
Sbjct: 220 EIFID 224

>Smik_2.284 Chr2 (518341..519396) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/183 (29%), Positives = 75/183 (40%), Gaps = 26/183 (14%)

Query: 67  LCFGARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQGKG 125
           L  G  GAGVV  +G +V   KVGD   I      C  C+ C+ G  + C  +    G G
Sbjct: 66  LIGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGTCMSCEYCEVGNESQCPHL---DGTG 122

Query: 126 VMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTTGY 185
              DG                   TF EY     V    I ++  L +V  + C   T Y
Sbjct: 123 FTHDG-------------------TFQEYATADAVQAAHIPQNVNLAEVAPILCAGITVY 163

Query: 186 GAALKTANVQKGDTVAVFGA-GTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGATD 244
             ALK AN+  G  V + GA G +G   +Q A A    ++I +D  + K+K     G   
Sbjct: 164 -KALKRANLMPGQWVTISGACGGLGSLAIQYALAM-GFRVIGIDGGEAKRKLFEKLGGEI 221

Query: 245 FVN 247
           F++
Sbjct: 222 FID 224

>YBR145W Chr2 (533762..534817) [1056 bp, 351 aa] {ON}  ADH5Alcohol
           dehydrogenase isoenzyme V; involved in ethanol
           production
          Length = 351

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 74/183 (40%), Gaps = 26/183 (14%)

Query: 67  LCFGARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQGKG 125
           L  G  GAGVV  +G +V   KVGD   I      C  C+ C+ G  + C  +    G G
Sbjct: 66  LIGGHEGAGVVVKLGSNVKGWKVGDFAGIKWLNGTCMSCEYCEVGNESQCPYL---DGTG 122

Query: 126 VMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTTGY 185
              DG                   TF EY     V    I  +  L +V  + C   T Y
Sbjct: 123 FTHDG-------------------TFQEYATADAVQAAHIPPNVNLAEVAPILCAGITVY 163

Query: 186 GAALKTANVQKGDTVAVFGA-GTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGATD 244
             ALK ANV  G  V + GA G +G   +Q A A    ++I +D  + K+K     G   
Sbjct: 164 -KALKRANVIPGQWVTISGACGGLGSLAIQYALAM-GYRVIGIDGGNAKRKLFEQLGGEI 221

Query: 245 FVN 247
           F++
Sbjct: 222 FID 224

>Kwal_26.7799 s26 complement(515580..516743) [1164 bp, 387 aa] {ON}
           YMR083W (ADH3) - 1:1 [contig 55] FULL
          Length = 387

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 80/188 (42%), Gaps = 26/188 (13%)

Query: 65  VSLCFGARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQG 123
           + L  G  GAGVV + G +VT+ ++GD   I      C  C++C+ G    C     +  
Sbjct: 100 LPLVGGHEGAGVVVAKGENVTNFEIGDLAGIKWLNGSCMSCELCEQGHEPNCEHADLS-- 157

Query: 124 KGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTT 183
            G   DG                   +F +Y     V    + +   L +V  + C   T
Sbjct: 158 -GYTHDG-------------------SFQQYATADAVQAAQLPKGINLAEVAPILCAGVT 197

Query: 184 GYGAALKTANVQKGDTVAVFG-AGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGA 242
            Y  ALKTA++  G  VA+ G AG +G   VQ AKA    +++ +D  D KK+     G 
Sbjct: 198 VY-KALKTADLIPGQWVAISGAAGGLGSLAVQYAKAM-GLRVLGIDGGDEKKELFHKLGG 255

Query: 243 TDFVNPKT 250
             F++  T
Sbjct: 256 EIFIDYTT 263

>TPHA0G03210 Chr7 complement(688137..689270) [1134 bp, 377 aa] {ON}
           Anc_2.480 YMR083W
          Length = 377

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 71/254 (27%), Positives = 102/254 (40%), Gaps = 33/254 (12%)

Query: 10  TCTAAVAYAAGKPLTVEQITVEAPTGARGAYQDHQHCYLPHGCVHSVWFGSEVRCVSLCF 69
           T    + Y    PL  + I V  P  +     + ++  + H  +H+ W G     V L  
Sbjct: 35  TQKGVIFYENNGPLEYKDIPVPKPK-SNEILINVEYSGVCHTDLHA-WKGDWPLPVKLPL 92

Query: 70  --GARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQGKGV 126
             G  GAGVV  +G +V + K+GD   I      C  C++C++G    C     +   G 
Sbjct: 93  VGGHEGAGVVVGMGDNVKNWKIGDLAGIKWLNGSCMSCELCENGFEANCEHADLS---GY 149

Query: 127 MPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTTGYG 186
             DG                   +F +Y     V    I     L  V  + C   T Y 
Sbjct: 150 THDG-------------------SFQQYATADAVQAARIPAGTDLANVAPILCAGVTVY- 189

Query: 187 AALKTANVQKGDTVAVFG-AGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGA--- 242
            ALKTA+++ GD VA+ G AG +G   VQ A A    ++I +D  + KKK     G    
Sbjct: 190 KALKTADLKPGDWVAISGAAGGLGSLAVQYAAAM-GLRVIGIDGGEDKKKLFEKCGGEVF 248

Query: 243 TDFVNPKTDLKDGQ 256
            DF   K  +KD Q
Sbjct: 249 IDFTKSKDIVKDIQ 262

>KNAG0I00120 Chr9 (9352..10497) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/179 (27%), Positives = 77/179 (43%), Gaps = 17/179 (9%)

Query: 63  RCVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAVRATQ 122
           + +    G   +G V  VGP VT VKVGD V+   T  C +       K     A  A +
Sbjct: 65  KSIPQAMGHEFSGYVAKVGPKVTKVKVGDRVVVEATCSCVDLHRWPESKHYKTPACNACK 124

Query: 123 GKGVMPDGTSRFRNSKGEPLLHFMGCST----FAEYTVVADVSVVAIDRDAPLEKVCLLG 178
            +    D    +          FMG       FAE  V  +  VV +    P++   L+ 
Sbjct: 125 DRC---DNCCEYAG--------FMGLGVVGGAFAERIVTIEHHVVKLPDGFPMDVAALIE 173

Query: 179 CGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFA 237
             ++  + AA + +    G +  V GAG IGL+++   KA+ ASKIIV +    +++ A
Sbjct: 174 -PLSVAWHAA-RVSKFPPGKSALVLGAGPIGLAMILVLKAQGASKIIVSEPATMRRELA 230

>Suva_4.394 Chr4 (702935..703990) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/183 (29%), Positives = 75/183 (40%), Gaps = 26/183 (14%)

Query: 67  LCFGARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQGKG 125
           L  G  GAGVV  +G +V   KVGD   I      C  C+ C+ G  + C  +    G G
Sbjct: 66  LIGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGTCMSCEYCEVGNESQCPHL---DGTG 122

Query: 126 VMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTTGY 185
              DG                   TF EY     V    +  +  L +V  + C   T Y
Sbjct: 123 FTHDG-------------------TFQEYATADAVQAAHLPENVDLAEVAPILCAGVTVY 163

Query: 186 GAALKTANVQKGDTVAVFGA-GTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGATD 244
             ALK AN+  G  V + GA G +G   +Q A A    ++I +D  +TKK+     G   
Sbjct: 164 -KALKRANLIPGQWVTISGACGGLGSLAIQYATAM-GYRVIGIDEGETKKQLFEGLGGEV 221

Query: 245 FVN 247
           F++
Sbjct: 222 FID 224

>YOL086C Chr15 complement(159548..160594) [1047 bp, 348 aa] {ON}
           ADH1Alcohol dehydrogenase, fermentative isozyme active
           as homo- or heterotetramers; required for the reduction
           of acetaldehyde to ethanol, the last step in the
           glycolytic pathway
          Length = 348

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 82/326 (25%), Positives = 129/326 (39%), Gaps = 43/326 (13%)

Query: 50  HGCVHSVWFGSEVRCVSLCF--GARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKM 106
           H  +H+ W G     V L    G  GAGVV  +G +V   K+GD+  I      C  C+ 
Sbjct: 45  HTDLHA-WHGDWPLPVKLPLVGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEY 103

Query: 107 CKSGKTNLCSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAID 166
           C+ G  + C     +   G   DG                   +F +Y     V    I 
Sbjct: 104 CELGNESNCPHADLS---GYTHDG-------------------SFQQYATADAVQAAHIP 141

Query: 167 RDAPLEKVCLLGCGVTTGYGAALKTANVQKGDTVAVFG-AGTIGLSVVQGAKAREASKII 225
           +   L +V  + C   T Y  ALK+AN+  G  VA+ G AG +G   VQ AKA    +++
Sbjct: 142 QGTDLAQVAPILCAGITVY-KALKSANLMAGHWVAISGAAGGLGSLAVQYAKAM-GYRVL 199

Query: 226 VVDINDTKKKFAFDFGATDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRD 285
            +D  + K++     G   F+    D    + IV  +++              NV V   
Sbjct: 200 GIDGGEGKEELFRSIGGEVFI----DFTKEKDIVGAVLK----ATDGGAHGVINVSVSEA 251

Query: 286 ALEACH---KGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIED 342
           A+EA     +  G ++++G+ A  K  S    Q+V      GS  G    R++    ++ 
Sbjct: 252 AIEASTRYVRANGTTVLVGMPAGAKCCSDVFNQVVKSISIVGSYVG---NRADTREALDF 308

Query: 343 YNKGNLKIDEFITNKRPFKEINEGFE 368
           + +G +K    +       EI E  E
Sbjct: 309 FARGLVKSPIKVVGLSTLPEIYEKME 334

>Suva_13.261 Chr13 (416378..417505) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 83/202 (41%), Gaps = 29/202 (14%)

Query: 50  HGCVHSVWFGSEVRCVSLCF--GARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKM 106
           H  +H+ W G     V L    G  GAGVV  +G +V   KVGD   I      C  C+ 
Sbjct: 72  HTDLHA-WHGDWPLPVKLPLVGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEF 130

Query: 107 CKSGKTNLCSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAID 166
           C+SG  + C            PD            L  +    +F ++     +    I 
Sbjct: 131 CESGHESNC------------PDAD----------LSGYTHDGSFQQFATADAIQAAKIQ 168

Query: 167 RDAPLEKVCLLGCGVTTGYGAALKTANVQKGDTVAVFG-AGTIGLSVVQGAKAREASKII 225
           +   L +V  + C   T Y  ALK AN++ GD VA+ G AG +G   VQ A A    +++
Sbjct: 169 QGTDLAEVAPILCAGVTVY-KALKEANLKAGDWVAISGAAGGLGSLAVQYATAM-GYRVL 226

Query: 226 VVDINDTKKKFAFDFGATDFVN 247
            +D    K+K     G   F++
Sbjct: 227 GIDAGAEKEKLFKQLGGEVFID 248

>TBLA0E03430 Chr5 (850493..851548) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 79/309 (25%), Positives = 124/309 (40%), Gaps = 40/309 (12%)

Query: 65  VSLCFGARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQG 123
           + L  G  GAGVV  +G +V   K+GD+  +      C  C+ C+    + C     +  
Sbjct: 64  LPLIGGHEGAGVVVGMGANVRGWKIGDYAGVKWLNGSCMSCEECELSNESNCPEADLS-- 121

Query: 124 KGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTT 183
            G   DG                   +F EY     V    I + A L +V  + C   T
Sbjct: 122 -GYTHDG-------------------SFQEYCTADAVQAARIPQGADLAEVAPILCAGVT 161

Query: 184 GYGAALKTANVQKGDTVAVFGA-GTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGA 242
            Y  ALK+A++  G+ VA+ GA G +G   VQ AKA    +++ +D  + KKK   + G 
Sbjct: 162 VY-KALKSADLAAGEWVAISGACGGLGSLAVQFAKAM-GLRVLGIDGGEEKKKMFHEMGG 219

Query: 243 TDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACH---KGWGQSII 299
             F++ + + KD +  V K                 NV V   A+EA     +  G  ++
Sbjct: 220 EVFLDFRLE-KDMEAAVIK-------ATNGGAHGVINVSVSEAAIEASTRYVRSNGTVVL 271

Query: 300 IGVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRP 359
           +G+ A     S    Q+V      GS  G    R++    ++ + +G +K    I     
Sbjct: 272 VGLPANAYCKSEVFSQVVKSYKIVGSYVG---NRADTREALDFFVRGLVKSPIHIVGLST 328

Query: 360 FKEINEGFE 368
             EI E  E
Sbjct: 329 LPEIYEKME 337

>Suva_10.154 Chr10 complement(275737..276807) [1071 bp, 356 aa] {ON}
           YLR070C (REAL)
          Length = 356

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 77/323 (23%), Positives = 134/323 (41%), Gaps = 42/323 (13%)

Query: 67  LCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAVRATQGKGV 126
           +  G   +GVV  +G +V ++KVGD V        +     K G+ NL   ++       
Sbjct: 65  MVLGHESSGVVVLIGDNVKTLKVGDRVALEPGFPNRFSSELKEGRYNLDPDLKFAATPPY 124

Query: 127 MPDGT-SRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTTGY 185
             DGT +++  +  + +       +F E  ++  +SV                       
Sbjct: 125 --DGTLTKYYRAPKDFVYKIPDHVSFEEGALMEPLSVAV--------------------- 161

Query: 186 GAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGATDF 245
             A + A ++ G    VFGAG +GL   + A    A+ ++ VD+++TK + A  FGAT  
Sbjct: 162 -HANRLAKMRFGARCVVFGAGPVGLLTGKVASVFGATDVVFVDLSETKLERAKQFGATHM 220

Query: 246 VNPKTDLKDG---QTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACHKGWGQSIIIGV 302
           VN   DL  G   +T++ K +                   +R  +E C  G G  + +G+
Sbjct: 221 VN-SGDLPQGVSAETVIRKAIGKKGADVVFECSGAQ--PCIRTGIEVCKAG-GTYVQVGM 276

Query: 303 AAAGKEISTRPFQLVTGR--VWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRPF 360
              G+E    P   +  +   ++GS F   +G  +    IE  + G L +   IT +  F
Sbjct: 277 ---GQEEIQFPISKIPAKEITFQGS-FRYCQG--DYSDSIELVSSGKLSLKPLITRRYQF 330

Query: 361 KEINEGFEDL--HHGDCLRTVLN 381
           KE  E F++   H  D ++T++ 
Sbjct: 331 KEAIEAFDENRDHPLDNVKTIIE 353

>KLTH0E05588g Chr5 complement(494815..495861) [1047 bp, 348 aa] {ON}
           highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086C ADH1 Alcohol dehydrogenase involved
           in the production of certain carboxylate esters
          Length = 348

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 86/203 (42%), Gaps = 30/203 (14%)

Query: 65  VSLCFGARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQG 123
           + L  G  GAGVV  +G +V   K+GD   I      C  C+ C+    + C     +  
Sbjct: 61  LPLVGGHEGAGVVVGIGENVKGWKLGDLAGIKWLNGSCMACESCELSNESNCPHADLS-- 118

Query: 124 KGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTT 183
            G   DG                   +F +Y     V    I     L +V  + C   T
Sbjct: 119 -GYTHDG-------------------SFQQYATADAVQAARIPEGTDLAEVAPILCAGIT 158

Query: 184 GYGAALKTANVQKGDTVAVFG-AGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGA 242
            Y  ALK+AN++ G+ VA+ G AG +G   VQ AKA    ++I +D  D K++     G 
Sbjct: 159 VY-KALKSANLRAGNWVAISGAAGGLGSLAVQYAKAM-GYRVIGIDGGDEKEQLFKKLGG 216

Query: 243 TDFVNPKTDLKDGQTIVEKLVEM 265
             FV    D +  + +V +++E+
Sbjct: 217 EYFV----DFRKSKDVVAEILEV 235

>KNAG0K02000 Chr11 (410263..411315) [1053 bp, 350 aa] {ON} Anc_3.118
           YBR145W
          Length = 350

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 84/361 (23%), Positives = 144/361 (39%), Gaps = 47/361 (13%)

Query: 20  GKPLTVEQITVEAPTGARGAYQDHQHCYLPHGCVHSVWFGSEVRCVSLCF--GARGAGVV 77
           G PL  ++I V  P  A     + ++  + H  +H+ W G     V L    G  GAG+V
Sbjct: 18  GGPLEYKEIPVPKPK-ANELLINVKYSGVCHTDLHA-WHGDWPLPVKLPLVGGHEGAGIV 75

Query: 78  ESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQGKGVMPDGTSRFRN 136
            ++G  V +  +GD+  I      C  C+ C+    + C     +   G   DG+     
Sbjct: 76  VAMGDSVKNWNIGDYAGIKWLNGSCMNCESCELANESNCPQADLS---GYTHDGS----- 127

Query: 137 SKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTTGYGAALKTANVQK 196
                         F +Y     V    I     L +V  + C   T Y  ALK+AN++ 
Sbjct: 128 --------------FQQYATADAVQAAKIPHGTDLAEVAPILCAGVTVY-KALKSANLKA 172

Query: 197 GDTVAVFGA-GTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGATDFVNPKTDLKDG 255
           GD VA+ GA G +G   +Q A A    +++ +D  + K +     G   F+    D    
Sbjct: 173 GDWVAISGACGGLGSLAIQYATAM-GYRVLGIDGGEEKAELFKKLGGEYFI----DFTKC 227

Query: 256 QTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACH---KGWGQSIIIGVAAAGKEISTR 312
           + ++ +++E+             NV V   A+EA     +  G  +++G+ A     S  
Sbjct: 228 KDVIAEILEV----TDGGAHGVINVSVSEAAIEASTRYCRANGTVVLVGLPANAYCKSEV 283

Query: 313 PFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRPFKEINEGFEDLHH 372
             Q+V      GS  G    R++    ++ + +G +K    I    P  ++ E F+ +  
Sbjct: 284 FSQVVKSISIVGSYVG---NRADTRQALDFFARGLVKSPIHIA---PLSDLPEIFDKMAK 337

Query: 373 G 373
           G
Sbjct: 338 G 338

>Suva_12.260 Chr12 (427406..428479) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 79/331 (23%), Positives = 131/331 (39%), Gaps = 42/331 (12%)

Query: 59  GSEVRCVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAV 118
           G  +    +  G   +G V  VG  VT VKVGD V        +     K G+ NLC  +
Sbjct: 56  GKYILKAPMVLGHESSGQVVEVGSAVTRVKVGDRVAIEPGVPSRYSDETKEGRYNLCPHM 115

Query: 119 RATQGKGVMPDGT-SRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLL 177
                  +  DGT  ++  S  + L+      ++ E   V  +SV               
Sbjct: 116 AFAATPPI--DGTLVKYYLSPEDFLVKLPEGVSYEEGACVEPLSV--------------- 158

Query: 178 GCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFA 237
             GV +      K A V+ G  V VFGAG +GL     A+A  AS ++ +D+ D K   A
Sbjct: 159 --GVHSN-----KLAGVRFGSRVVVFGAGPVGLLTGAVARAFGASDVVFIDVFDNKLDRA 211

Query: 238 FDFGATD-FVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACHKGWGQ 296
            +FGAT  F + K      Q + +++ ++                   DA     K  G 
Sbjct: 212 KEFGATHTFNSSKFPADKTQELADEVEKLLSGHHADIVFECSGADACIDAGVKITKVGGT 271

Query: 297 SIIIGVAAAGKEISTRPFQLVTGRVWK-----GSAFGGVKGRSEMGSLIEDYNKGNLKID 351
            + IG+   GK  +  P   V+G+  K       +FG  +   ++ +       G + + 
Sbjct: 272 MVQIGM---GKNYTNFPIAEVSGKEMKLIGCFRYSFGDYRDAVKLVA------SGKVNVK 322

Query: 352 EFITNKRPFKEINEG--FEDLHHGDCLRTVL 380
             IT++  F++  +   F   H G+ ++T++
Sbjct: 323 AMITHRFKFEDAAKAYDFNIAHGGEVVKTII 353

>KLLA0B09064g Chr2 complement(792849..793973) [1125 bp, 374 aa] {ON}
           uniprot|P49384 Kluyveromyces lactis KLLA0B09064g ADH3
           Alcohol dehydrogenase III mitochondrial precursor
          Length = 374

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 77/185 (41%), Gaps = 26/185 (14%)

Query: 65  VSLCFGARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQG 123
           + L  G  GAGVV ++G +V    +GD   I      C  C+ C+    + C        
Sbjct: 87  LPLVGGHEGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMSCEYCELSNESNC-------- 138

Query: 124 KGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTT 183
               PD            L  +    +F +Y     V    I +   L +V  + C   T
Sbjct: 139 ----PDAD----------LSGYTHDGSFQQYATADAVQAARIPKGTDLAEVAPILCAGVT 184

Query: 184 GYGAALKTANVQKGDTVAVFG-AGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGA 242
            Y  ALK+AN++ GD VA+ G AG +G   VQ AKA    +++ +D  + K K     G 
Sbjct: 185 VY-KALKSANLKAGDWVAISGAAGGLGSLAVQYAKAM-GYRVVGIDGGEEKGKLVKQLGG 242

Query: 243 TDFVN 247
             FV+
Sbjct: 243 EAFVD 247

>AER032W Chr5 (696807..697862) [1056 bp, 351 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL086C (ADH1) and
           YBR145W (ADH5)
          Length = 351

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 67/259 (25%), Positives = 104/259 (40%), Gaps = 34/259 (13%)

Query: 10  TCTAAVAYAAGKPLTVEQITVEAPTGARGAYQDHQHCYLPHGCVHSVWFGSEVRCVSLCF 69
           T  A + Y  G PL    I V  P  A     + ++  + H  +H+ W G       L  
Sbjct: 9   TQKAVIFYENGGPLQYTDIEVPKPK-ATELLINVKYSGVCHTDLHA-WKGDWPLPTKLPL 66

Query: 70  --GARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQGKGV 126
             G  GAGVV ++G +V   K+GD   I      C  C+ C+    + C     +   G 
Sbjct: 67  VGGHEGAGVVVAMGENVRGWKIGDLAGIKWLNGSCMACEYCEKSNESNCPEADLS---GY 123

Query: 127 MPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTTGYG 186
             DG                   +F +Y     V    I     L +V  + C   T Y 
Sbjct: 124 THDG-------------------SFQQYATADAVQAAHIPAGTDLAQVAPILCAGITVY- 163

Query: 187 AALKTANVQKGDTVAVFGA-GTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGATDF 245
            ALK+AN++ GD VA+ GA G +G   +Q A A    +++ +D  + K++     G   F
Sbjct: 164 KALKSANLRAGDWVAISGACGGLGSLAIQYATAM-GYRVLGIDGGEEKEQLFRQLGGEVF 222

Query: 246 VNPKTDLKDGQTIVEKLVE 264
           +    D +  + IV  +V+
Sbjct: 223 I----DFRKSKDIVADVVK 237

>Smik_13.520 Chr13 complement(856008..857054) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 78/309 (25%), Positives = 122/309 (39%), Gaps = 40/309 (12%)

Query: 65  VSLCFGARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQG 123
           + L  G  GAGVV ++G +V   KVGD   I    + C  C+ C+ G  + C     +  
Sbjct: 61  LPLVGGHEGAGVVVAIGDNVRGWKVGDLAGIKWLNSSCMACEYCELGNESNCPHADLS-- 118

Query: 124 KGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTT 183
            G   DG                   +F +Y     V    I     L +V  + C   T
Sbjct: 119 -GYTHDG-------------------SFQQYATADAVQAARIPEGTDLAQVAPILCAGIT 158

Query: 184 GYGAALKTANVQKGDTVAVFG-AGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGA 242
            Y  ALK+AN++ G  VA+ G AG +G   VQ AKA    +++ +D  + K++     G 
Sbjct: 159 VY-KALKSANLRAGHWVAISGAAGGLGSLAVQYAKAM-GYRVLGIDGGEGKEELFTSLGG 216

Query: 243 TDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACH---KGWGQSII 299
             F+    D    + IV  +V+              NV V   A+EA     +  G  ++
Sbjct: 217 EVFI----DFTKEKDIVSAVVK----ATDGGAHGIVNVSVSEAAIEASTRYCRANGTVVL 268

Query: 300 IGVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRP 359
           +G+ A  K  S     +V      GS  G    R++    ++ + +G +K    +     
Sbjct: 269 VGLPAGAKCCSDVFNHVVKSISIVGSYVG---NRADTREALDFFARGLVKSPIKVVGLST 325

Query: 360 FKEINEGFE 368
             EI E  E
Sbjct: 326 LPEIYEKME 334

>NCAS0A07660 Chr1 complement(1525755..1526915) [1161 bp, 386 aa]
           {ON} 
          Length = 386

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 60/214 (28%), Positives = 87/214 (40%), Gaps = 43/214 (20%)

Query: 69  FGARGAGVVESVGPDVTSVKVGDHVIALYTAECK--------------ECKMCKSGKTNL 114
            G    G V+++G  VT V VGD V+      CK              +C  C+ G  N 
Sbjct: 71  MGHEFCGFVKAIGNKVTKVAVGDKVVVEAGCGCKDVHRWPQSHVYGKEQCTACRKGFDNC 130

Query: 115 CSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKV 174
           C+    T G GV+                       FAE  VV +  VV +  + P +  
Sbjct: 131 CTHAGFT-GLGVV--------------------GGAFAEQVVVGERHVVKLPEEVPTDVG 169

Query: 175 CLLGCGVTTGYGAALKTANVQKGD--TVAVFGAGTIGLSVVQGAKAREASKIIVVDINDT 232
            L+       +  A+K A  +KG      V GAG IGL+ +   KA  ASKI+V ++   
Sbjct: 170 ALVEPLSVAWH--AVKVAGFEKGSGKNALVLGAGPIGLATILALKAHGASKIVVSELAAI 227

Query: 233 KKKFAFDFGATDFVNPKT-DLKDGQTIVEKLVEM 265
           +++ A   G   F   K  D K G   ++KL E+
Sbjct: 228 RRELALKMGVEVFDPSKHGDEKQG---IKKLREI 258

>YMR083W Chr13 (434788..435915) [1128 bp, 375 aa] {ON}
           ADH3Mitochondrial alcohol dehydrogenase isozyme III;
           involved in the shuttling of mitochondrial NADH to the
           cytosol under anaerobic conditions and ethanol
           production
          Length = 375

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 56/202 (27%), Positives = 84/202 (41%), Gaps = 29/202 (14%)

Query: 50  HGCVHSVWFGSEVRCVSLCF--GARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKM 106
           H  +H+ W G     V L    G  GAGVV  +G +V   KVGD   I      C  C+ 
Sbjct: 72  HTDLHA-WHGDWPLPVKLPLVGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEF 130

Query: 107 CKSGKTNLCSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAID 166
           C+SG  + C            PD            L  +    +F ++     +    I 
Sbjct: 131 CESGHESNC------------PDAD----------LSGYTHDGSFQQFATADAIQAAKIQ 168

Query: 167 RDAPLEKVCLLGCGVTTGYGAALKTANVQKGDTVAVFG-AGTIGLSVVQGAKAREASKII 225
           +   L +V  + C   T Y  ALK A+++ GD VA+ G AG +G   VQ A A    +++
Sbjct: 169 QGTDLAEVAPILCAGVTVY-KALKEADLKAGDWVAISGAAGGLGSLAVQYATAM-GYRVL 226

Query: 226 VVDINDTKKKFAFDFGATDFVN 247
            +D  + K+K     G   F++
Sbjct: 227 GIDAGEEKEKLFKKLGGEVFID 248

>KAFR0G01420 Chr7 complement(314119..315174) [1056 bp, 351 aa] {ON}
           Anc_3.118 YBR145W
          Length = 351

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 97/237 (40%), Gaps = 30/237 (12%)

Query: 15  VAYAAGKPLTVEQITVEAPTGARGAYQDHQHCYLPHGCVHSVWFGSEVRCVSLCF--GAR 72
           + Y  G  L  + I V  P  A     + ++  + H  +H+ W G     V L    G  
Sbjct: 14  IFYENGGKLEYKDIPVPTPK-ANELLINVKYSGVCHTDLHA-WKGDWPLDVKLPLVGGHE 71

Query: 73  GAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQGKGVMPDGT 131
           GAGVV ++G +V   K+GD+  I      C  C+ C+    + C     +   G   DG 
Sbjct: 72  GAGVVVAMGENVRGWKIGDYAGIKWLNGSCMSCEYCELSNESNCPEADLS---GYTHDG- 127

Query: 132 SRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTTGYGAALKT 191
                             +F +Y     V    I +   L +V  + C   T Y  ALK+
Sbjct: 128 ------------------SFQQYATADAVQAAKIPQGTDLAQVAPILCAGITVY-KALKS 168

Query: 192 ANVQKGDTVAVFGA-GTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGATDFVN 247
           AN+  G+ VA+ GA G +G   +Q AKA    +I+ +D  D K     + G   F++
Sbjct: 169 ANLSAGEWVAISGACGGLGSLAIQYAKAM-GYRILGIDGGDEKAALFKELGGEVFID 224

>Kpol_1036.19 s1036 (51276..52337) [1062 bp, 353 aa] {ON}
           (51276..52337) [1062 nt, 354 aa]
          Length = 353

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 78/185 (42%), Gaps = 26/185 (14%)

Query: 65  VSLCFGARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQG 123
           + L  G  GAGVV  +G  V   K+GD   I      C  C+ C+    + C     +  
Sbjct: 66  LPLVGGHEGAGVVVGMGSSVKGWKMGDLAGIKWLNGSCMNCEECELSNESNCPEADLS-- 123

Query: 124 KGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTT 183
            G   DG                   +F +Y     V    I + A + +V  + C   T
Sbjct: 124 -GYTHDG-------------------SFQQYATADAVQAAHIPQGADMAEVAPILCAGVT 163

Query: 184 GYGAALKTANVQKGDTVAVFG-AGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGA 242
            Y  ALK+A ++ GD VA+ G AG +G   VQ AKA    +++ +D  D K+KF    G 
Sbjct: 164 VY-KALKSAELKAGDWVAISGAAGGLGSLAVQYAKAM-GYRVLGIDGGDEKEKFFKSMGG 221

Query: 243 TDFVN 247
             FV+
Sbjct: 222 EVFVD 226

>ABR229C Chr2 complement(831895..832956) [1062 bp, 353 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR070C
           (XYL2)
          Length = 353

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 61/218 (27%), Positives = 85/218 (38%), Gaps = 30/218 (13%)

Query: 45  HCYLPHGCVHSVWFGSEVRCVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKEC 104
           H YL HG +     G  V    +  G   +G V  VG DVT V++GD V        +  
Sbjct: 48  HYYL-HGSI-----GPFVVRSPMVLGHESSGTVVEVGSDVTRVRIGDRVAIEPGVPSRYS 101

Query: 105 KMCKSGKTNLCSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVA 164
           +  KSG  NLC  +R         DG                   T  +Y +  +  +V 
Sbjct: 102 EETKSGHYNLCREMRFAATPPY--DG-------------------TLVKYYISPEDFLVK 140

Query: 165 IDRDAPLEKVCLLGCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKI 224
           +     LE+  L  C        A + A  Q    V VFGAG +GL     AKA  A+ +
Sbjct: 141 LPDSVSLEEGAL--CEPLAVAVHANRLAGTQFPSRVVVFGAGPVGLLTASVAKAFGATTV 198

Query: 225 IVVDINDTKKKFAFDFGATDFVNPKTDLKDGQTIVEKL 262
            +VDI+  K   A   G T  V+  +D    + +  KL
Sbjct: 199 AIVDISKHKLCVAPALGVTHPVD-SSDCSSPEALANKL 235

>YMR303C Chr13 complement(873291..874337) [1047 bp, 348 aa] {ON}
           ADH2Glucose-repressible alcohol dehydrogenase II,
           catalyzes the conversion of ethanol to acetaldehyde;
           involved in the production of certain carboxylate
           esters; regulated by ADR1
          Length = 348

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 76/309 (24%), Positives = 123/309 (39%), Gaps = 40/309 (12%)

Query: 65  VSLCFGARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQG 123
           + L  G  GAGVV  +G +V   K+GD+  I      C  C+ C+ G  + C     +  
Sbjct: 61  LPLVGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNCPHADLS-- 118

Query: 124 KGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTT 183
            G   DG                   +F EY     V    I +   L +V  + C   T
Sbjct: 119 -GYTHDG-------------------SFQEYATADAVQAAHIPQGTDLAEVAPILCAGIT 158

Query: 184 GYGAALKTANVQKGDTVAVFG-AGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGA 242
            Y  ALK+AN++ G   A+ G AG +G   VQ AKA    +++ +D    K++     G 
Sbjct: 159 VY-KALKSANLRAGHWAAISGAAGGLGSLAVQYAKAM-GYRVLGIDGGPGKEELFTSLGG 216

Query: 243 TDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACH---KGWGQSII 299
             F+    D    + IV  +V+              NV V   A+EA     +  G  ++
Sbjct: 217 EVFI----DFTKEKDIVSAVVK----ATNGGAHGIINVSVSEAAIEASTRYCRANGTVVL 268

Query: 300 IGVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRP 359
           +G+  AG + S+  F  V   +    ++  V  R++    ++ + +G +K    +     
Sbjct: 269 VGL-PAGAKCSSDVFNHVVKSISIVGSY--VGNRADTREALDFFARGLVKSPIKVVGLSS 325

Query: 360 FKEINEGFE 368
             EI E  E
Sbjct: 326 LPEIYEKME 334

>Smik_13.266 Chr13 (418869..419996) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 84/202 (41%), Gaps = 29/202 (14%)

Query: 50  HGCVHSVWFGSEVRCVSLCF--GARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKM 106
           H  +H+ W G     V L    G  GAGVV  +G +V   K+GD   I      C  C+ 
Sbjct: 72  HTDLHA-WHGDWPLPVKLPLVGGHEGAGVVVKLGSNVKGWKIGDLAGIKWLNGSCMTCEF 130

Query: 107 CKSGKTNLCSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAID 166
           C+SG  + C            PD            L  +    +F ++     +    I 
Sbjct: 131 CESGHESNC------------PDAD----------LSGYTHDGSFQQFATADAIQAAKIQ 168

Query: 167 RDAPLEKVCLLGCGVTTGYGAALKTANVQKGDTVAVFG-AGTIGLSVVQGAKAREASKII 225
           +   L +V  + C   T Y  ALK A+++ GD VA+ G AG +G   VQ A A    +++
Sbjct: 169 QGTDLAEVAPILCAGVTVY-KALKEADLKAGDWVAISGAAGGLGSLAVQYATAM-GYRVL 226

Query: 226 VVDINDTKKKFAFDFGATDFVN 247
            +D  + K+K     G   F++
Sbjct: 227 GIDAGEEKEKLFKKLGGEVFID 248

>Skud_2.272 Chr2 (501260..502315) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 54/183 (29%), Positives = 75/183 (40%), Gaps = 26/183 (14%)

Query: 67  LCFGARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQGKG 125
           L  G  GAGVV  +G +V   KVGD   I      C  C+ C+ G  + C  +    G G
Sbjct: 66  LIGGHEGAGVVVKLGSNVKGWKVGDIAGIKWLNGTCMSCEYCEVGNESQCPHL---DGTG 122

Query: 126 VMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTTGY 185
              DG                   TF EY     V    I ++  L +V  + C   T Y
Sbjct: 123 FTHDG-------------------TFQEYATADAVQAAHIPQNVDLAEVAPILCAGITVY 163

Query: 186 GAALKTANVQKGDTVAVFGA-GTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGATD 244
             ALK AN+  G  V + GA G +G   VQ A A    ++I +D  + K+K   +     
Sbjct: 164 -KALKRANLMPGQWVTISGACGGLGSLAVQYALAM-GYRVIGIDGGEAKQKLFEELHGEI 221

Query: 245 FVN 247
           F++
Sbjct: 222 FID 224

>AAR084W Chr1 (494021..495178) [1158 bp, 385 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR303C (ADH2)
          Length = 385

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 54/202 (26%), Positives = 85/202 (42%), Gaps = 30/202 (14%)

Query: 65  VSLCFGARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQG 123
           + L  G  GAGVV ++G +V   +VGD   I      C  C+ C+ G  + C     +  
Sbjct: 98  LPLVGGHEGAGVVVAMGENVRGWQVGDLAGIKWLNGSCMSCEACEQGHESNCPEADLS-- 155

Query: 124 KGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTT 183
            G   DG                   +F +Y     V    I     L +V  + C   T
Sbjct: 156 -GYTHDG-------------------SFQQYATADAVQAAHIPAGTDLAQVAPILCAGIT 195

Query: 184 GYGAALKTANVQKGDTVAVFGA-GTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGA 242
            Y  ALK+AN++ G+ VA+ GA G +G   +Q A+A    +++ +D  D K+      G 
Sbjct: 196 VY-KALKSANLRAGNWVAISGACGGLGSLAIQYARAM-GYRVLEIDGGDEKEALFRKLGG 253

Query: 243 TDFVNPKTDLKDGQTIVEKLVE 264
             FV    D +  + +V  +V+
Sbjct: 254 EVFV----DFRKSKDVVADVVK 271

>NCAS0J00300 Chr10 (43719..44792) [1074 bp, 357 aa] {ON} Anc_8.16
          Length = 357

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 79/188 (42%), Gaps = 37/188 (19%)

Query: 67  LCFGARGAGVVESVGPDVTSVKVGDHVIAL---YTAECKECKMCKSGKTNLCSAVRATQG 123
           +  G   +G++  VG  V ++KVGD V AL   Y +   E  M  SG  NLC        
Sbjct: 64  MVLGHESSGIIAEVGSAVKTLKVGDRV-ALEPGYPSRYTEATM--SGHYNLC-------- 112

Query: 124 KGVMPDGTSRFRNSKGEPLLHFMGCS----TFAEYTVVADVSVVAIDRDAPLEKVCLLGC 179
                            P +HF        T  +Y +     V  +  +   E+  LL  
Sbjct: 113 -----------------PFMHFAATPPCDGTLTKYYLTPFDFVYKLPDNVSYEEGALLE- 154

Query: 180 GVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFD 239
            ++ G  A  K A  + GD V VFGAG +GL     AK   A +++ +D+ D K + A  
Sbjct: 155 PLSVGVHAN-KQAGTRFGDKVVVFGAGPVGLLNGAVAKVFGALQVVFIDVVDEKLERAKH 213

Query: 240 FGATDFVN 247
           FGAT  +N
Sbjct: 214 FGATAVIN 221

>NCAS0I01720 Chr9 (318144..319199) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 88/371 (23%), Positives = 144/371 (38%), Gaps = 47/371 (12%)

Query: 10  TCTAAVAYAAGKPLTVEQITVEAPTGARGAYQDHQHCYLPHGCVHSVWFGSEVRCVSLCF 69
           T  A +  + G PL  + I V  P  +     + ++  + H  +H+ W G       L  
Sbjct: 9   TQKAIIFESNGGPLEYKDIPVPTPK-SNEILVNIKYSGVCHTDLHA-WKGDWPLDTKLPL 66

Query: 70  --GARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQGKGV 126
             G  GAG+V ++G +V   K+GD+  +      C  C+ C+ G  + C     +   G 
Sbjct: 67  VGGHEGAGIVVAIGDNVKGWKIGDYAGVKWLNGSCMACEYCELGNESNCPNADLS---GY 123

Query: 127 MPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTTGYG 186
             DG                   +F +Y     V    I     L +V  + C   T Y 
Sbjct: 124 THDG-------------------SFQQYATADAVQAARIPAGTNLSEVAPILCAGMTVY- 163

Query: 187 AALKTANVQKGDTVAVFGA-GTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGATDF 245
            ALK+AN++ G+ VA+ GA G +G   +Q A A    +++ +D  D K K         F
Sbjct: 164 KALKSANLRAGEWVAISGACGGLGSLCIQYANAM-GYRVLGIDGGDDKAKLFKQLHGEVF 222

Query: 246 VNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACHK---GWGQSIIIGV 302
           ++  T  KD  + V K+                NV V   A+EA  K     G  +++G+
Sbjct: 223 ID-FTKTKDVISEVNKVTN-------GGAHGVINVSVSEAAIEASTKYCRANGTVVLVGL 274

Query: 303 AAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRPFKE 362
               K  S    Q+V      GS  G    R++    ++ + +G +K    +    P   
Sbjct: 275 PGGAKCKSDVFNQVVKSMTIVGSYVG---NRADTREALDFFTRGLVKAPIHVA---PLST 328

Query: 363 INEGFEDLHHG 373
           +   FE +  G
Sbjct: 329 LPTIFEKMEKG 339

>Skud_13.477 Chr13 complement(846790..847836) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 76/309 (24%), Positives = 125/309 (40%), Gaps = 40/309 (12%)

Query: 65  VSLCFGARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQG 123
           + L  G  GAGVV ++G +V   KVGD   +    + C  C+ C+ G  + C     +  
Sbjct: 61  LPLVGGHEGAGVVVAIGDNVRGWKVGDLAGVKWLNSSCMACEYCELGNESNCPHADLS-- 118

Query: 124 KGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTT 183
            G   DG                   +F +Y     V    I     L +V  + C   T
Sbjct: 119 -GYTHDG-------------------SFQQYATADAVQAARIPEGTDLAEVAPILCAGIT 158

Query: 184 GYGAALKTANVQKGDTVAVFG-AGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGA 242
            Y  ALK+AN++ G+ VA+ G AG +G   VQ AKA    +++ +D    K++     G 
Sbjct: 159 VY-KALKSANLRAGNWVAISGAAGGLGSLAVQYAKAM-GYRVLGIDGGPGKQELFTSLGG 216

Query: 243 TDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACHK---GWGQSII 299
             F+    D    + I+  +V+              NV V   A+EA  K     G  ++
Sbjct: 217 EVFI----DFTKEKDIIGAVVK----ATDGGAHGIINVSVSEAAIEASTKYCRANGTVVL 268

Query: 300 IGVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRP 359
           +G+  AG + S+  F  V   +    ++  V  R++    ++ + +G +K    +     
Sbjct: 269 VGL-PAGAKCSSDVFNHVVKSISIVGSY--VGNRADTREALDFFARGLVKSPIKVVGLSS 325

Query: 360 FKEINEGFE 368
             EI E  E
Sbjct: 326 LPEIYEKME 334

>Kwal_55.20564 s55 complement(459253..459903) [651 bp, 216 aa] {ON}
           YOL086C (ADH1) - Alcohol dehydrogenase [contig 146] FULL
          Length = 216

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 75/174 (43%), Gaps = 26/174 (14%)

Query: 65  VSLCFGARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQG 123
           + L  G  GAGVV ++G +V   KVGD   I      C  C+ C+ G  + C     +  
Sbjct: 61  LPLVGGHEGAGVVVALGENVKGWKVGDLAGIKWLNGSCMACEYCELGNESNCPHADLS-- 118

Query: 124 KGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTT 183
            G   DG                   +F +Y     V    I +   L +V  + C   T
Sbjct: 119 -GYTHDG-------------------SFQQYATADAVQAAKIPQGTDLAQVAPILCAGIT 158

Query: 184 GYGAALKTANVQKGDTVAVFGA-GTIGLSVVQGAKAREASKIIVVDINDTKKKF 236
            Y  ALK+A+++ G  VA+ GA G +G   VQ A+A    +++ +D  D K+K 
Sbjct: 159 VY-KALKSADLKAGQWVAISGACGGLGSLAVQYARAM-GYRVLGIDGGDDKRKL 210

>YLR070C Chr12 complement(274141..275211) [1071 bp, 356 aa] {ON}
           XYL2Xylitol dehydrogenase, converts xylitol to
           D-xylulose; expression induced by xylose, even though
           this pentose sugar is not well utilized by S.
           cerevisiae; null mutant has cell wall defect
          Length = 356

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 73/309 (23%), Positives = 124/309 (40%), Gaps = 34/309 (11%)

Query: 67  LCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAVRATQGKGV 126
           +  G   +G+V  +G +V ++KVGD V        +     K G+ NL   ++       
Sbjct: 65  MVLGHESSGIVALIGENVKTLKVGDRVALEPGIPDRFSPEMKEGRYNLDPNLKFAATPPF 124

Query: 127 MPDGT-SRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTTGY 185
             DGT +++  +  + +       +F E  ++  +SV                       
Sbjct: 125 --DGTLTKYYKTMKDFVYKLPDDVSFEEGALIEPLSVAI--------------------- 161

Query: 186 GAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGATDF 245
             A K A ++ G    VFGAG IGL   + A    A+ ++ VD+ + K + A  FGAT  
Sbjct: 162 -HANKLAKIKFGARCVVFGAGPIGLLAGKVASVFGAADVVFVDLLENKLETARQFGATHI 220

Query: 246 VNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQV-MRDALEACHKGWGQSIIIGVAA 304
           VN   DL  G T+   + +                +  +R  +E C  G G  + +G+  
Sbjct: 221 VN-SGDLPHGVTVDSVIKKAIGKKGADVVFECSGAEPCVRAGIEVCKAG-GTIVQVGM-- 276

Query: 305 AGKEISTRPFQLV-TGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRPFKEI 363
            G+E    P  ++ T  +     F   +G  +    IE  +   L +  FIT++  FK+ 
Sbjct: 277 -GQEEIQFPISIIPTKELTFQGCFRYCQG--DYSDSIELVSSRKLSLKPFITHRYSFKDA 333

Query: 364 NEGFEDLHH 372
            E FE+  H
Sbjct: 334 VEAFEETSH 342

>YAL061W Chr1 (33448..34701) [1254 bp, 417 aa] {ON}  BDH2Putative
           medium-chain alcohol dehydrogenase with similarity to
           BDH1; transcription induced by constitutively active
           PDR1 and PDR3
          Length = 417

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 71/188 (37%), Gaps = 37/188 (19%)

Query: 69  FGARGAGVVESVGPDVTSVKVGDHVIALYTAECKE--------------CKMCKSGKTNL 114
            G   AG V  VGP V ++KVGD V+   T  C++              C  CK G  N+
Sbjct: 71  MGHEMAGTVLEVGPGVKNLKVGDKVVVEPTGTCRDRYRWPLSPNVDKEWCAACKKGYYNI 130

Query: 115 CSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKV 174
           CS +    G GV   G                    FAE  V+ +     +    PL+  
Sbjct: 131 CSYL-GLCGAGVQSGG--------------------FAERVVMNESHCYKVPDFVPLDVA 169

Query: 175 CLLGCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKK 234
            L+       +  A++    + G T  + GAG IGL  +    A     I+V +    ++
Sbjct: 170 ALIQPLAVCWH--AIRVCEFKAGSTALIIGAGPIGLGTILALNAAGCKDIVVSEPAKVRR 227

Query: 235 KFAFDFGA 242
           + A   GA
Sbjct: 228 ELAEKMGA 235

>Smik_15.71 Chr15 complement(122645..123691) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 76/309 (24%), Positives = 123/309 (39%), Gaps = 40/309 (12%)

Query: 65  VSLCFGARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQG 123
           + L  G  GAGVV ++G +V    +GD+  I      C  C+ C+ G  + C     +  
Sbjct: 61  LPLVGGHEGAGVVVAMGENVKGWNIGDYAGIKWLNGSCMACEYCELGNESNCPHADLS-- 118

Query: 124 KGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTT 183
            G   DG                   +F +Y     V    I +   L +V  + C   T
Sbjct: 119 -GYTHDG-------------------SFQQYATADAVQAAHIPQGTDLAEVAPVLCAGIT 158

Query: 184 GYGAALKTANVQKGDTVAVFG-AGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGA 242
            Y  ALK+AN+  G  VA+ G AG +G   VQ AKA    +++ +D  + K++     G 
Sbjct: 159 VY-KALKSANLMAGHWVAISGAAGGLGSLAVQYAKAM-GYRVLGIDGGEGKEELFRSIGG 216

Query: 243 TDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACH---KGWGQSII 299
             F+    D    + IV  +++              NV V   A+EA     +  G +++
Sbjct: 217 EVFI----DFTKEKDIVNAVLK----ATDGGAHGVINVSVSEAAIEASTRYVRANGTTVL 268

Query: 300 IGVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRP 359
           +G+ A  K  S    Q+V      GS  G    R++    ++ + +G +K    +     
Sbjct: 269 VGMPANAKCSSDVFNQVVKSISIVGSYVG---NRADTREALDFFARGLVKSPIKVVGLST 325

Query: 360 FKEINEGFE 368
             EI E  E
Sbjct: 326 LPEIYEKME 334

>Kwal_56.23198 s56 (443881..444936) [1056 bp, 351 aa] {ON} YOL086C
           (ADH1) - Alcohol dehydrogenase [contig 183] FULL
          Length = 351

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 98/242 (40%), Gaps = 30/242 (12%)

Query: 10  TCTAAVAYAAGKPLTVEQITVEAPTGARGAYQDHQHCYLPHGCVHSVWFGSEVRCVSLCF 69
           T  A + Y  G PL  + I V  P+ A     + ++  + H  +H+ W G       L  
Sbjct: 9   TQKAVIFYENGGPLEYKDIPVPKPS-ATELLINVKYSGVCHTDLHA-WKGDWPLPTKLPL 66

Query: 70  --GARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQGKGV 126
             G  GAGVV ++G +V   K+GD+  I      C  C+ C+    + C     +   G 
Sbjct: 67  VGGHEGAGVVVAMGENVKGWKIGDYAGIKWLNGSCMSCESCELSNESNCPEADLS---GY 123

Query: 127 MPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTTGYG 186
             DG                   +F +Y     V    I +   L +V  + C   T Y 
Sbjct: 124 THDG-------------------SFQQYATADAVQAAKIPQGTDLAEVAPVLCAGITVY- 163

Query: 187 AALKTANVQKGDTVAVFGA-GTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGATDF 245
            ALK+AN+  GD VA+ GA G +G   +Q A A    +++ +D    K +     G   F
Sbjct: 164 KALKSANLSAGDWVAISGACGGLGSLCIQYATAM-GYRVLGIDGGAEKAELFKQLGGEVF 222

Query: 246 VN 247
           ++
Sbjct: 223 ID 224

>KLTH0E07964g Chr5 (735214..736338) [1125 bp, 374 aa] {ON} similar
           to uniprot|P25377 Saccharomyces cerevisiae YCR105W ADH7
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis
          Length = 374

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 73/334 (21%), Positives = 120/334 (35%), Gaps = 51/334 (15%)

Query: 57  WFGSEVRCVSLCFGARG-------AGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCK 108
           W    + C+S  +G +         G V +VGP+V+  KVGD V +    + C +C  C+
Sbjct: 57  WTHEPLACLSSKYGPKTQVVGHEVVGKVVAVGPEVSLCKVGDRVGLGAQASACMQCSRCQ 116

Query: 109 SGKTNLCSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRD 168
           S     C+    T      PDG              ++    +A +    +     I  +
Sbjct: 117 SSNEQYCAQSIGTYCNP-YPDG--------------YVSQGGYASHVRAHEQFCFPIPPE 161

Query: 169 APLEKVCLLGCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVD 228
            P E V  L CG  T +    +    +K   VA+ G G +G   +  +KA  A ++  V 
Sbjct: 162 IPSELVAPLQCGGLTVFSPIKRNIQGKKNPRVAIIGIGGLGHMAIMISKALGA-EVSAVS 220

Query: 229 INDTKKKFAFDFGATDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALE 288
              +K+  A   GA  F+   T   +    ++   ++             N      AL 
Sbjct: 221 RGYSKRDDALKMGADHFI--ATSEPNWNAGLDDTFDLILNCASSTSSLDLN------ALL 272

Query: 289 ACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNL 348
            C K     + +G+    ++   +PF             G   G S++GS  E      L
Sbjct: 273 PCLKVNCNFVSVGLPHIDEDFKVKPFSFFHN--------GCNIGSSKLGSREEAIELMQL 324

Query: 349 KIDEFITNKRPFKE--------INEGFEDLHHGD 374
            +     N RP+ E        ++EG   L  GD
Sbjct: 325 AVKH---NFRPWVETIKVSEAGVSEGLTRLDKGD 355

>KLLA0F13530g Chr6 (1251162..1252289) [1128 bp, 375 aa] {ON}
           uniprot|P49385 Kluyveromyces lactis ADH4 Alcohol
           dehydrogenase IV, mitochondrial precursor
          Length = 375

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 61/242 (25%), Positives = 101/242 (41%), Gaps = 30/242 (12%)

Query: 10  TCTAAVAYAAGKPLTVEQITVEAPTGARGAYQDHQHCYLPHGCVHSVWFGSEVRCVSLCF 69
           T    + Y  G  L  + + V  P  A     + ++  + H  +H+ W G     V L  
Sbjct: 33  TQKGVIFYENGGKLEYKDLPVPKPK-ANEILINVKYSGVCHTDLHA-WKGDWPLPVKLPL 90

Query: 70  --GARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQGKGV 126
             G  GAG+V + G +V + ++GD+  I      C  C++C+ G  + C     +   G 
Sbjct: 91  VGGHEGAGIVVAKGENVKNFEIGDYAGIKWLNGSCMSCELCEQGYESNCLQADLS---GY 147

Query: 127 MPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTTGYG 186
             DG                   +F +Y     V    I +   L ++  + C   T Y 
Sbjct: 148 THDG-------------------SFQQYATADAVQAAQIPKGTDLAEIAPILCAGVTVY- 187

Query: 187 AALKTANVQKGDTVAVFG-AGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGATDF 245
            ALKTA+++ G  VA+ G AG +G   VQ AKA    +++ +D  D K++     G   F
Sbjct: 188 KALKTADLKPGQWVAISGAAGGLGSLAVQYAKAM-GLRVLGIDGGDGKEELFKQCGGEVF 246

Query: 246 VN 247
           ++
Sbjct: 247 ID 248

>TDEL0D05050 Chr4 (921065..922120) [1056 bp, 351 aa] {ON} Anc_3.118
           YBR145W
          Length = 351

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/185 (28%), Positives = 79/185 (42%), Gaps = 26/185 (14%)

Query: 65  VSLCFGARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQG 123
           + L  G  GAGVV ++G +V + KVGD+  I      C  C+ C+ G  + C     +  
Sbjct: 64  LPLVGGHEGAGVVVALGSNVKNWKVGDYAGIKWLNGCCMSCEDCELGNESNCPQADLS-- 121

Query: 124 KGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTT 183
            G   DG                   +F +Y     V    I     L +V  + C   T
Sbjct: 122 -GYTHDG-------------------SFQQYATTDAVQAAKISPGTDLAEVAPVLCAGLT 161

Query: 184 GYGAALKTANVQKGDTVAVFGA-GTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGA 242
            Y  ALK+A ++ G  VA+ GA G +G   VQ AKA    +++ +D  D K K   + G 
Sbjct: 162 VY-KALKSAELEAGQWVAISGACGGLGSLAVQYAKAM-GYRVLGIDGGDEKAKMFKELGG 219

Query: 243 TDFVN 247
             F++
Sbjct: 220 EYFID 224

>Suva_15.81 Chr15 complement(132739..133785) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 79/326 (24%), Positives = 126/326 (38%), Gaps = 43/326 (13%)

Query: 50  HGCVHSVWFGSEVRCVSLCF--GARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKM 106
           H  +H+ W G     V L    G  GAGVV ++G +V    +GD   I      C  C+ 
Sbjct: 45  HTDLHA-WHGDWPLPVKLPLVGGHEGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMACEY 103

Query: 107 CKSGKTNLCSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAID 166
           C+ G  + C     +   G   DG                   +F +Y     V    I 
Sbjct: 104 CELGNESNCPHADLS---GYTHDG-------------------SFQQYATADSVQAAHIP 141

Query: 167 RDAPLEKVCLLGCGVTTGYGAALKTANVQKGDTVAVFG-AGTIGLSVVQGAKAREASKII 225
           +   L +   + C   T Y  ALK+AN+  G  VA+ G AG +G   VQ AKA    +++
Sbjct: 142 KGTDLAECAPVLCAGITVY-KALKSANLSAGQWVAISGAAGGLGSLAVQYAKAM-GYRVV 199

Query: 226 VVDINDTKKKFAFDFGATDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRD 285
            +D  + K++     G   F++  T+        + +V               NV V   
Sbjct: 200 GIDGGEGKEELFRSIGGEVFIDFTTE--------KDIVGAVIKATDGGAHGIINVSVSEA 251

Query: 286 ALEACH---KGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIED 342
           A+EA     +  G ++++G+ A  K  S    Q+V      GS  G    R++    ++ 
Sbjct: 252 AIEASTRYCRANGTTVLVGMPAGAKCCSDVFNQVVKSISIVGSYVG---NRADTREALDF 308

Query: 343 YNKGNLKIDEFITNKRPFKEINEGFE 368
           + +G +K    +       EI E  E
Sbjct: 309 FARGLVKSPIKVVGLSTLPEIYEKME 334

>SAKL0C10164g Chr3 complement(914732..915787) [1056 bp, 351 aa] {ON}
           uniprot|Q6XQ74 Saccharomyces kluyveri ADH1 Alcohol
           dehydrogenase 1
          Length = 351

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 85/366 (23%), Positives = 141/366 (38%), Gaps = 44/366 (12%)

Query: 10  TCTAAVAYAAGKPLTVEQITVEAPTGARGAYQDHQHCYLPHGCVHSVWFGSEVRCVSLCF 69
           T  A + Y  G  L  + I V  P  +     + ++  + H  +H+ W G       L  
Sbjct: 9   TQKAVIFYENGGELQYKDIPVPKPK-SNEILINIKYSGVCHTDLHA-WKGDWPLPTKLPL 66

Query: 70  --GARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQGKGV 126
             G  GAG+V  +G +V   K+GD+  I      C  C+ C+    + C           
Sbjct: 67  VGGHEGAGIVVGMGENVKGWKIGDYAGIKWLNGSCMSCEYCELSNESNC----------- 115

Query: 127 MPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTTGYG 186
            PD            L  +    +F +Y     V    I     L +V  + C   T Y 
Sbjct: 116 -PDAD----------LSGYTHDGSFQQYATADAVQAARIAPGTDLAEVAPVLCAGITVY- 163

Query: 187 AALKTANVQKGDTVAVFGA-GTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGATDF 245
            ALK+AN++ G+ VA+ GA G +G   +Q AKA    +++ +D  D K     + G   F
Sbjct: 164 KALKSANLRAGEWVAISGACGGLGSLAIQYAKAM-GYRVLGIDGGDEKAALFKELGGEVF 222

Query: 246 VNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACH---KGWGQSIIIGV 302
           +    D    + +V+ +V+              NV V   A+EA     +  G  +++G+
Sbjct: 223 I----DFTKTKDVVKAVVD----ATNGGAHGVINVSVSEAAIEASTVYCRANGTVVLVGL 274

Query: 303 AAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRPFKE 362
               K  S    Q+V      GS  G    R++    ++ +++G +K    +        
Sbjct: 275 PGGAKCKSDVFNQVVKSISIVGSYVG---NRADTREALDFFSRGLVKSPIMVVGLSELPS 331

Query: 363 INEGFE 368
           I E  E
Sbjct: 332 IYEKME 337

>TDEL0A02560 Chr1 complement(462053..463174) [1122 bp, 373 aa] {ON}
           Anc_2.480 YMR083W
          Length = 373

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 86/202 (42%), Gaps = 29/202 (14%)

Query: 50  HGCVHSVWFGSEVRCVSLCF--GARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKM 106
           H  +H+ W G     V L    G  GAGVV + G DVT+ ++GD   +    + C  C+ 
Sbjct: 70  HTDLHA-WKGDWPLPVKLPLVGGHEGAGVVVAKGKDVTNFEIGDLAGVKWLNSSCMACEY 128

Query: 107 CKSGKTNLCSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAID 166
           C+ G  + C+    +   G   DG                   +F +Y     +    I 
Sbjct: 129 CELGHESNCAKADLS---GYTHDG-------------------SFQQYATADAIQAAPIP 166

Query: 167 RDAPLEKVCLLGCGVTTGYGAALKTANVQKGDTVAVFG-AGTIGLSVVQGAKAREASKII 225
           +D  L +V  + C   T Y  ALKT+  + G  VA+ G AG +G   VQ A A    +++
Sbjct: 167 KDTDLAEVAPILCAGVTVY-KALKTSGAKPGQWVAISGAAGGLGSLAVQYATAM-GLRVL 224

Query: 226 VVDINDTKKKFAFDFGATDFVN 247
            +D  + K++     G   FV+
Sbjct: 225 GIDGGEGKEELFKSLGGEVFVD 246

>Suva_13.494 Chr13 complement(856051..857097) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 77/309 (24%), Positives = 121/309 (39%), Gaps = 40/309 (12%)

Query: 65  VSLCFGARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQG 123
           + L  G  GAGVV ++G +V   KVGD   I    + C  C+ C+ G  + C     +  
Sbjct: 61  LPLVGGHEGAGVVVAMGENVRGWKVGDLAGIKWLNSSCMACEYCELGNESNCPHADLS-- 118

Query: 124 KGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTT 183
            G   DG                   +F +Y     V    I     L +V  + C   T
Sbjct: 119 -GYTHDG-------------------SFQQYATADAVQAAHIPEGTDLAEVAPILCAGIT 158

Query: 184 GYGAALKTANVQKGDTVAVFG-AGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGA 242
            Y  ALK+AN++ G  VA+ G AG +G   VQ AKA    +++ +D    K++     G 
Sbjct: 159 VY-KALKSANLRAGHWVAISGAAGGLGSLAVQYAKAM-GYRVVGIDGGPGKEELFTSLGG 216

Query: 243 TDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACH---KGWGQSII 299
             F+    D    + IV  +++              NV V   A+EA     +  G  ++
Sbjct: 217 EVFI----DFTKEKDIVGAVIK----ATDGGAHGIVNVSVSEAAIEASTRYCRANGTVVL 268

Query: 300 IGVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRP 359
           +G+ A  K  S     +V      GS  G    R++    ++ + +G +K    +     
Sbjct: 269 VGLPAGAKCTSDVFNHVVKSISIVGSYVG---NRADTREALDFFARGLVKSPIKVVGLSH 325

Query: 360 FKEINEGFE 368
             EI E  E
Sbjct: 326 LPEIYEKME 334

>KAFR0L02010 Chr12 (379623..380678) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 81/197 (41%), Gaps = 30/197 (15%)

Query: 70  GARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQGKGVMP 128
           G  GAGVV  +G +V   K+GD+  I      C  C+ C+      C     T   G + 
Sbjct: 69  GHEGAGVVVGMGSNVKGWKLGDYAGIKFLNGTCNACEFCEQSFEISCPHADFT---GTVH 125

Query: 129 DGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTTGYGAA 188
           DG                   +F +Y     V    I +   L  +  L C   T Y  A
Sbjct: 126 DG-------------------SFQQYATADAVQAARIPQGTDLAAIAPLLCAGLTAY-KA 165

Query: 189 LKTANVQKGDTVAVFGA-GTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGATDFVN 247
           LK+AN++ G  VA+ GA G +G   +Q A A    +++ +D  + K K+    G   F+ 
Sbjct: 166 LKSANMRPGQWVAISGACGGLGTYAIQYATAM-GYRVLGIDSGEEKAKYFKTLGGEVFI- 223

Query: 248 PKTDLKDGQTIVEKLVE 264
              D K  + +V  +++
Sbjct: 224 ---DYKKSKDVVADVIK 237

>SAKL0B08184g Chr2 (698686..699807) [1122 bp, 373 aa] {ON}
           uniprot|Q9P8S5 Saccharomyces kluyveri Alcohol
           dehydrogenase isozyme 3
          Length = 373

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 79/318 (24%), Positives = 125/318 (39%), Gaps = 45/318 (14%)

Query: 65  VSLCFGARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQG 123
           + L  G  GAGVV ++G +V   K+GD   I      C  C+ C+    + C     +  
Sbjct: 86  LPLVGGHEGAGVVVAMGENVKGWKIGDLAGIKWLNGSCLSCEYCEKSNESNCPHADLS-- 143

Query: 124 KGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTT 183
            G   DG                   +F +Y     V    I     L +V  + C   T
Sbjct: 144 -GYTHDG-------------------SFQQYATADYVQAARIPEGTDLAEVSPILCAGVT 183

Query: 184 GYGAALKTANVQKGDTVAVFG-AGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGA 242
            Y  ALK+AN++ GD VA+ G AG +G   VQ AKA    +++ +D    K +     G 
Sbjct: 184 VY-KALKSANLKAGDWVAISGAAGGLGSLAVQYAKAM-GYRVLGIDGGAEKGELVKKLGG 241

Query: 243 TDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACH---KGWGQSII 299
             F+    D    + +VE + E              NV V   A+ A     +  G  ++
Sbjct: 242 EVFI----DFTKHKNLVEAVQE----ATNGGPHGVINVSVSEAAMTASTQFVRPTGTVVL 293

Query: 300 IGVAAAGKEISTRPFQLVTGRV-WKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKR 358
           +G+  AG  I +  F  V   +  KGS  G    R++    I+ + +G +K    +    
Sbjct: 294 VGL-PAGAVIKSEVFSHVVKSINIKGSYVG---NRADTREAIDFFARGMVKSPIHVVG-- 347

Query: 359 PFKEINEGFEDLHHGDCL 376
              E+ + +E +  G  L
Sbjct: 348 -LSELPKVYELMEKGKIL 364

>KLLA0F18260g Chr6 complement(1683417..1684463) [1047 bp, 348 aa]
           {ON} uniprot|P49383 Kluyveromyces lactis KLLA0F18260g
           ADH2 Alcohol dehydrogenase 2
          Length = 348

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 77/185 (41%), Gaps = 26/185 (14%)

Query: 65  VSLCFGARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQG 123
           + L  G  GAGVV ++G +V    +GD   I      C  C+ C+    + C        
Sbjct: 61  LPLVGGHEGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMSCEYCELSNESNC-------- 112

Query: 124 KGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTT 183
               PD            L  +    +F +Y     V    I +   L +V  + C   T
Sbjct: 113 ----PDAD----------LSGYTHDGSFQQYATADAVQAARIPKGTDLAEVAPILCAGVT 158

Query: 184 GYGAALKTANVQKGDTVAVFGA-GTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGA 242
            Y  ALK+A+++ GD VA+ GA G +G   +Q AKA    +++ +D    K K   + G 
Sbjct: 159 VY-KALKSADLKAGDWVAISGACGGLGSLAIQYAKAM-GYRVLGIDTGAEKAKLFKELGG 216

Query: 243 TDFVN 247
             FV+
Sbjct: 217 EYFVD 221

>Smik_1.5 Chr1 (16385..17638) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 69/188 (36%), Gaps = 37/188 (19%)

Query: 69  FGARGAGVVESVGPDVTSVKVGDHVIALYTAECKE--------------CKMCKSGKTNL 114
            G   AG V  VGP V  +KVGD V+   T  C++              C  CK G  N+
Sbjct: 71  MGHEMAGTVLEVGPGVAHLKVGDKVVVEPTGTCRDRYRWPESPNVDKEWCAACKKGYYNI 130

Query: 115 CSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKV 174
           CS +    G GV   G                    FAE  V+ +     +    PL+  
Sbjct: 131 CSYL-GLCGAGVQSGG--------------------FAERVVMNESHCYKVPDFVPLDVA 169

Query: 175 CLLGCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKK 234
            L+       +  A+     + G T  + GAG IGL  +    A     I+V +    ++
Sbjct: 170 ALIQPLAVCWH--AISVCEFKAGSTALIIGAGPIGLGTILALNAAGCRDIVVSEPAKLRR 227

Query: 235 KFAFDFGA 242
           + A   GA
Sbjct: 228 ELAEKMGA 235

>Skud_1.2 Chr1 (9513..10766) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 69/188 (36%), Gaps = 37/188 (19%)

Query: 69  FGARGAGVVESVGPDVTSVKVGDHVIALYTAECKE--------------CKMCKSGKTNL 114
            G   AG V  VGP V  +KVGD V+   T  C++              C  CK G  N+
Sbjct: 71  MGHEMAGTVLEVGPGVAHLKVGDKVVVEPTGTCRDRYRWPNSPNVSKEWCAACKKGYYNI 130

Query: 115 CSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKV 174
           CS +    G GV   G                    FAE  V+ +     +    PL+  
Sbjct: 131 CSYL-GLCGAGVQSGG--------------------FAERVVMNESHCYKVPDFVPLDVA 169

Query: 175 CLLGCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKK 234
            L+       +  A+     + G T  + GAG IGL  +    A     I+V +    ++
Sbjct: 170 ALIQPLAVCWH--AISVCEFKAGSTALIIGAGPIGLGTILALDAAGCKDIVVSEPAKLRR 227

Query: 235 KFAFDFGA 242
           + A   GA
Sbjct: 228 ELAEKMGA 235

>Skud_15.68 Chr15 complement(118795..119841) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 77/309 (24%), Positives = 122/309 (39%), Gaps = 40/309 (12%)

Query: 65  VSLCFGARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQG 123
           + L  G  GAGVV ++G +V    +GD   I      C  C+ C+ G  + C     +  
Sbjct: 61  LPLVGGHEGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMACEYCELGNESNCPHADLS-- 118

Query: 124 KGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTT 183
            G   DG                   +F +Y     V    +     L +V  + C   T
Sbjct: 119 -GYTHDG-------------------SFQQYATADAVQAAHVAPGTDLAEVAPVLCAGIT 158

Query: 184 GYGAALKTANVQKGDTVAVFG-AGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGA 242
            Y  ALK+AN+  G  VA+ G AG +G   VQ AKA    ++I +D  + K++     G 
Sbjct: 159 VY-KALKSANLMAGHWVAISGAAGGLGSLAVQYAKAM-GYRVIGIDGGEGKEELFRSIGG 216

Query: 243 TDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACH---KGWGQSII 299
             FV    D    + IV  +++              NV V   A+EA     +  G +++
Sbjct: 217 EVFV----DFTKEKDIVGAVLK----ATNGGAHGVINVSVSEAAIEASTRYVRANGTTVL 268

Query: 300 IGVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRP 359
           +G+ A  K  S    Q+V      GS  G    R++    ++ +++G +K    +     
Sbjct: 269 VGMPANAKCCSDVFNQVVKSISIVGSYVG---NRADTREALDFFSRGLVKSPIKVVGLST 325

Query: 360 FKEINEGFE 368
             EI E  E
Sbjct: 326 LPEIYEKME 334

>KLLA0D05511g Chr4 complement(476363..477427) [1065 bp, 354 aa] {ON}
           similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase expression is
           induced in the presence of sorbitol
          Length = 354

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 65/205 (31%), Positives = 83/205 (40%), Gaps = 36/205 (17%)

Query: 47  YLPHGCVHSVWFGSEVRCVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKM 106
           Y  HG +     G  V    +  G   +GVV  VG DVT V+VGD V        +    
Sbjct: 48  YYTHGSI-----GEFVVKKPMVLGHESSGVVVEVGKDVTLVQVGDRVAIEPGVPSRYSDE 102

Query: 107 CKSGKTNLCS--AVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVA 164
            KSG  NLC   A  AT       DGT          L+ +        Y    D  V  
Sbjct: 103 TKSGHYNLCPHMAFAATPPY----DGT----------LVKY--------YLAPEDFLVKL 140

Query: 165 IDRDAPLEKVCL--LGCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREAS 222
            D  +  E  C   L  GV      A + A    G  V VFGAG +GL     A A  AS
Sbjct: 141 PDHVSFEEGACAEPLAVGV-----HANRLAETSFGKNVVVFGAGPVGLVTGAVAAAFGAS 195

Query: 223 KIIVVDINDTKKKFAFDFGATDFVN 247
            ++ VD+ + K + + DFGAT+ +N
Sbjct: 196 AVVYVDVFENKLERSKDFGATNTIN 220

>NCAS0A07780 Chr1 (1548197..1549318) [1122 bp, 373 aa] {ON}
           Anc_2.480
          Length = 373

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 96/237 (40%), Gaps = 30/237 (12%)

Query: 15  VAYAAGKPLTVEQITVEAPTGARGAYQDHQHCYLPHGCVHSVWFGSEVRCVSLCF--GAR 72
           + Y  G PL  + I V  P  A     + ++  + H  +H+ W G       L    G  
Sbjct: 36  IFYETGGPLHYKDIPVPKPK-ANEILINVKYSGVCHTDLHA-WKGDWPLATKLPLVGGHE 93

Query: 73  GAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQGKGVMPDGT 131
           G+G V ++G +V   K+GD   I      C  C++C+SG  + C     +   G   DG 
Sbjct: 94  GSGEVVAMGENVKGWKIGDLAGIKWLNGSCMSCELCESGHESNCEHADLS---GYTHDG- 149

Query: 132 SRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTTGYGAALKT 191
                             +F +Y     V    I +   + +V  + C   T Y  ALK 
Sbjct: 150 ------------------SFQQYATADAVQAARIPKGTNMAEVAPILCAGITVY-KALKE 190

Query: 192 ANVQKGDTVAVFG-AGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGATDFVN 247
           A+++ G  V + G AG +G   VQ AKA    ++I +D    K++     G   FV+
Sbjct: 191 ADMRAGQWVCISGAAGGLGSLAVQYAKAM-GYRVIGIDGGPGKEELFKSLGGEIFVD 246

>SAKL0F06270g Chr6 (472877..473932) [1056 bp, 351 aa] {ON} similar
           to uniprot|P00331 Saccharomyces cerevisiae YMR303C ADH2
           Glucose-repressible alcohol dehydrogenase II
          Length = 351

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 73/309 (23%), Positives = 121/309 (39%), Gaps = 40/309 (12%)

Query: 65  VSLCFGARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQG 123
           + L  G  GAGVV ++G +V   K+GD+  I      C  C+ C+    + C     +  
Sbjct: 64  LPLVGGHEGAGVVVAIGENVKGWKIGDYAGIKWLNGSCMACEYCELSNESNCPEADLS-- 121

Query: 124 KGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTT 183
            G   DG                   +F +Y     V    I     L +V  + C   T
Sbjct: 122 -GYTHDG-------------------SFQQYATADAVQAARIPAGTDLAEVAPVLCAGIT 161

Query: 184 GYGAALKTANVQKGDTVAVFGA-GTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGA 242
            Y  ALK+AN++ G+ VA+ GA G +G   +Q AKA    +++ +D  + K     + G 
Sbjct: 162 VY-KALKSANLRAGEWVAISGACGGLGSLAIQYAKAM-GYRVLGIDGGEEKAALFKELGG 219

Query: 243 TDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACH---KGWGQSII 299
             F+    D    + +V+ +V+              NV V   A+EA     +  G  ++
Sbjct: 220 EVFI----DFTKTKDVVKAVVD----ATNGGAHGVINVSVSEAAIEASTVYCRANGTVVL 271

Query: 300 IGVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRP 359
           +G+    K  S    Q+V      GS  G    R++    ++ + +G +K    +     
Sbjct: 272 VGLPGGAKCKSDVFNQVVKSTTIVGSYVG---NRADTREALDFFARGLVKSPIKVVGLSE 328

Query: 360 FKEINEGFE 368
              I E  E
Sbjct: 329 LPSIYEKME 337

>SAKL0E02838g Chr5 (226264..227397) [1134 bp, 377 aa] {ON}
           uniprot|Q6XQ71 Saccharomyces kluyveri ADH4 Alcohol
           dehydrogenase 4
          Length = 377

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/185 (27%), Positives = 79/185 (42%), Gaps = 26/185 (14%)

Query: 65  VSLCFGARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQG 123
           + L  G  GAGVV + G +V + ++GD   I      C  C++C+ G  + C     +  
Sbjct: 90  LPLVGGHEGAGVVVAKGENVMNFEIGDLAGIKWLNGSCMACELCEQGHESNCLHADLS-- 147

Query: 124 KGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTT 183
            G   DG                   +F +Y     V    I +   L +V  + C   T
Sbjct: 148 -GYTHDG-------------------SFQQYATADAVQAAQIPKGTDLAEVAPILCAGVT 187

Query: 184 GYGAALKTANVQKGDTVAVFG-AGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGA 242
            Y  ALKTA+++ G  VA+ G AG +G   VQ AKA    +I+ +D    K++     G 
Sbjct: 188 VY-KALKTADLKPGQWVAISGAAGGLGSLAVQYAKAM-GLRILGIDGGPGKEELFKSLGG 245

Query: 243 TDFVN 247
             F++
Sbjct: 246 EVFID 250

>ZYRO0G03388g Chr7 complement(265952..267064) [1113 bp, 370 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W
          Length = 370

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 69/306 (22%), Positives = 120/306 (39%), Gaps = 34/306 (11%)

Query: 65  VSLCFGARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQG 123
           + L  G  GAGVV + G +V + ++GD   I      C+ C+MC+ G  + C+    +  
Sbjct: 83  LPLVGGHEGAGVVVAKGENVKNFEIGDLAGIKWLNGSCQSCEMCEMGHESNCAHADLS-- 140

Query: 124 KGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTT 183
            G   DG                   TF +Y     +    I +   L  V  + C   T
Sbjct: 141 -GYTHDG-------------------TFQQYATADAIQAAHIPKGTDLAGVAPILCAGVT 180

Query: 184 GYGAALKTANVQKGDTVAVFG-AGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGA 242
            Y  AL+++  + G+ VA+ G AG +G    Q A+A    +++ +D  + K K     G 
Sbjct: 181 VY-KALRSSGARPGEWVAISGAAGGLGSLATQYARAM-GLRVVGIDGGEDKAKLFKSLGG 238

Query: 243 TDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACHKGWGQSIIIGV 302
             F+    D    + I   ++E              + + M  ++E   +  G  +++G+
Sbjct: 239 EIFI----DFTKEKDIPAAILEATQGGAHGVINVSVSEKAMSQSVEYV-RPQGTVVLVGL 293

Query: 303 AAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRPFKE 362
            A     S     +V     KGS  G    R++    +E +++G +K    I       +
Sbjct: 294 PANAVIKSNVFNHVVKSFSIKGSYVG---NRADSREAVEFFSRGLVKSPIKIVGLSELPK 350

Query: 363 INEGFE 368
           I E  E
Sbjct: 351 IYELME 356

>TPHA0M00730 Chr13 complement(137798..138850) [1053 bp, 350 aa] {ON}
           Anc_3.118 YBR145W
          Length = 350

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 64/245 (26%), Positives = 93/245 (37%), Gaps = 36/245 (14%)

Query: 10  TCTAAVAYAAGKPLTVEQITVEAPTGARGAYQDHQHCYLPHGCVHS---VWFGSEVRCVS 66
           T    + Y    PL  + I V  PT        H    L  G  H+    W G     V 
Sbjct: 8   TQKGVIFYENNGPLEYKDIPV--PTPLPNELLIH---VLYSGVCHTDLHAWHGDWPLPVK 62

Query: 67  LCF--GARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQG 123
           L    G  GAGVV  +G  V   KVGD+  I      C  C+ C+    + C     +  
Sbjct: 63  LPLVGGHEGAGVVVGMGSSVKGWKVGDYAGIKWLNGSCMSCEECELSNESNCPEADLS-- 120

Query: 124 KGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTT 183
            G   DG                   +F +Y     V    I   A L+ +  + C   T
Sbjct: 121 -GYTHDG-------------------SFQQYATADAVQAAKIPAGADLKNIAPILCAGVT 160

Query: 184 GYGAALKTANVQKGDTVAVFGA-GTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGA 242
            Y  A+K+AN++ GD +A+ GA G +G   +Q  KA    +I+ +D    K++     G 
Sbjct: 161 VY-KAIKSANLKAGDWLAISGACGGLGSLAIQYGKAM-GFRILGIDGGAEKEELFKKLGG 218

Query: 243 TDFVN 247
             F++
Sbjct: 219 EYFID 223

>SAKL0H22088g Chr8 (1934171..1935301) [1131 bp, 376 aa] {ON} similar
           to uniprot|Q04894 Saccharomyces cerevisiae YMR318C ADH6
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis or in aldehyde tolerance
          Length = 376

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 73/326 (22%), Positives = 115/326 (35%), Gaps = 35/326 (10%)

Query: 57  WFGSEVRCVSLCFGARG-------AGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCK 108
           W    + C+S  +G +         G V +VG +VT   +GD V +      C +C  C 
Sbjct: 59  WKHEPLACLSSSYGPKSQVVGHEVVGKVVAVGSNVTLCNIGDRVGLGAQAFSCMKCSRCN 118

Query: 109 SGKTNLCSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRD 168
           SG    C     T          SR+ +        ++    +A +    +     I  D
Sbjct: 119 SGNEQYCPQAVGTY--------CSRYADG-------YISQGGYASHVRAHEQFCFPIPDD 163

Query: 169 APLEKVCLLGCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVD 228
            P E V  L CG  T Y    +     K   VA+ G G +G   +  +KA  A ++    
Sbjct: 164 IPSELVAPLQCGGLTVYSPIKRNIEGVKDPKVAIIGIGGLGHMAIMISKALGA-EVTAFS 222

Query: 229 INDTKKKFAFDFGATDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALE 288
              +KK+ A   GA  F+   T  +  ++ +    ++             N       L 
Sbjct: 223 RGYSKKEDALKMGAHHFI--ATGEEGWESGLNDTFDLILNCASSTTSLDLN------KLL 274

Query: 289 ACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNL 348
            C K     I +G+    ++   +PF   +     GS+  G   R E   L+E   K N 
Sbjct: 275 PCLKINRNFISVGLPHVDEDFKVKPFSFFSNGCCIGSSKLG--SREEAIELMELATKHNF 332

Query: 349 KIDEFITNKRPFKEINEGFEDLHHGD 374
                 T K     ++EG   L  GD
Sbjct: 333 S-PWVETIKVSEAGVSEGLTRLDQGD 357

>ZYRO0G03410g Chr7 complement(269170..270291) [1122 bp, 373 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3
          Length = 373

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 77/324 (23%), Positives = 122/324 (37%), Gaps = 44/324 (13%)

Query: 65  VSLCFGARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQG 123
           + L  G  GAGVV + G DV + ++GD   +    + C  C+ C+ G    C     +  
Sbjct: 84  LPLVGGHEGAGVVVAKGKDVKTFEIGDLAGVKQLVSSCMGCESCEIGHEFGCEQAEMS-- 141

Query: 124 KGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTT 183
            G   DG                   TF +Y  +  +    +  +  L  V  + C   +
Sbjct: 142 -GSSHDG-------------------TFQQYVAIDALQAPPLPANVDLAAVAPIFCAGVS 181

Query: 184 GYGAALKTANVQKGDTVAVFGA-GTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGA 242
            Y  ALK  N+Q    VA+FGA G +G   VQ AKA     + +    + +K+     G 
Sbjct: 182 VY-KALKNGNLQTNQWVAIFGATGGLGSIAVQYAKAMGYRVLGIDGPGEERKQLFHSLGG 240

Query: 243 TDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEA---CHKGWGQSII 299
             F++         T V+ +                NV     A +    C +  G  + 
Sbjct: 241 EVFLD--------YTQVDNIPAAVKQATQGGAHCVLNVTASLAAYDQTIKCVRPLGTVVP 292

Query: 300 IGVAAAGKEISTRPFQLVT-GRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKR 358
           +GV      + T  F +V  G   KGSA G    R++    ++ + +G +K    I    
Sbjct: 293 VGVPPDSGLLKTDIFTIVQHGFSIKGSASG---SRADTREAVDFFTRGLIKSPIKILG-- 347

Query: 359 PFKEINEGFEDLHHGDCL-RTVLN 381
              E+ + FE L  G    R VL+
Sbjct: 348 -LSELPKAFELLESGQTTGRLVLD 370

>Ecym_7391 Chr7 (801773..802900) [1128 bp, 375 aa] {ON} similar to
           Ashbya gossypii ABL033C
          Length = 375

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 50/204 (24%), Positives = 82/204 (40%), Gaps = 28/204 (13%)

Query: 2   ANTEGQTITCTAAVAYAAGKPLTVEQITVEAPTGARGAYQDHQHCYLPHGCVHSVWFGSE 61
           + + G  +T  A + Y  G  L  + I V  P        + ++  + H  +H+ W G  
Sbjct: 25  STSSGIPLTQKAVIFYEHGDKLHYKDIPVPKPK-PNEILVNVKYSGVCHTDIHA-WKGDW 82

Query: 62  VRCVSLCF--GARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAV 118
                L    G  GAG+V + G +VT+ ++GD+  +      C  C+ C++G  + C+  
Sbjct: 83  PLATKLPLVGGHEGAGIVVAKGSNVTNFEIGDYAGVKWLNKSCMSCEYCETGHESNCAEA 142

Query: 119 RATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLG 178
             +   G   DG                   +F +Y     V    I +   L +V  + 
Sbjct: 143 DLS---GYTRDG-------------------SFQQYATADAVQAAKIPQGTDLAQVAPIL 180

Query: 179 CGVTTGYGAALKTANVQKGDTVAV 202
           C   T Y  ALKTAN+  G  VA+
Sbjct: 181 CAGVTVY-KALKTANLDPGQWVAI 203

>KAFR0I00170 Chr9 (34519..35664) [1146 bp, 381 aa] {ON} Anc_7.3
           YAL060W
          Length = 381

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 46/87 (52%), Gaps = 2/87 (2%)

Query: 151 FAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTTGYGAALKTANVQKGDTVAVFGAGTIGL 210
           FAE  +V +  +V I  + PL+   L+     T + A  K     KG T  + G+G IGL
Sbjct: 146 FAEQILVGEQHIVRIPDEIPLDVAALVEPLSVTWHAA--KVGKFVKGSTALILGSGPIGL 203

Query: 211 SVVQGAKAREASKIIVVDINDTKKKFA 237
           +++   KA  ASKI+V ++   ++K A
Sbjct: 204 AMILVLKALGASKIVVSEVAQVRRKLA 230

>NDAI0H02950 Chr8 complement(718762..719853) [1092 bp, 363 aa] {ON} 
          Length = 363

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 82/311 (26%), Positives = 119/311 (38%), Gaps = 34/311 (10%)

Query: 67  LCFGARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQGKG 125
           L  G    G V  +G     +KVGD V I      C EC  CKS     C     T  K 
Sbjct: 68  LVVGHEIIGTVTQIGSQCNELKVGDRVGIGAQVFSCLECDRCKSDNEPYCPKTVNTYRK- 126

Query: 126 VMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTTGY 185
              D T  + NSKG           +A+Y  + +   V I  + P      L CG  T +
Sbjct: 127 ---DYTDGY-NSKG----------GYADYIRLHEHFAVPIPENIPSHLAAPLMCGGVTAF 172

Query: 186 GAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGATDF 245
              L+      G  V + G G IG   +  AKA  A +   +  +  KK+ A   GA  F
Sbjct: 173 SPLLRNG-CGPGKKVGIMGIGGIGHMGLIFAKAMGA-ETFAISRSSAKKEDAIKMGADHF 230

Query: 246 VNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACHKGWGQSIIIGVAAA 305
           +  K +  D  T      ++             NV      +    K  G+ + I V   
Sbjct: 231 IATKEE-PDWATKYFDTFDLIVVCSNSLTDIDFNV------VPRTMKVGGKIVSICVPEQ 283

Query: 306 GKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRPFKE--I 363
            + ++ +PF L+ G     SA GG+   +E+  +++  +K NLKI        P  E  +
Sbjct: 284 HEVMNLKPFGLI-GVSISNSALGGI---NEIKQMLDLVSKKNLKI---WVETIPISEKGV 336

Query: 364 NEGFEDLHHGD 374
            E FE +  GD
Sbjct: 337 KEVFERMEKGD 347

>ZYRO0C12562g Chr3 (993434..994480) [1047 bp, 348 aa] {ON} highly
           similar to uniprot|P00331 Saccharomyces cerevisiae
           YMR303C ADH2 Glucose-repressible alcohol dehydrogenase
           II involved in the production of certain carboxylate
           esters
          Length = 348

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 76/309 (24%), Positives = 117/309 (37%), Gaps = 40/309 (12%)

Query: 65  VSLCFGARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQG 123
           + L  G  GAG V ++G DV + K+GD   I      C  C+ C+    + C        
Sbjct: 61  LPLVGGHEGAGEVVALGSDVKNWKIGDLAGIKWLNGSCMSCEACEQSHESNC-------- 112

Query: 124 KGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTT 183
               PD         G          +F +Y     V    I     L +V  + C   T
Sbjct: 113 ----PDADLSGYTHDG----------SFQQYATADAVQAAHIPAGTNLAEVAPVLCAGIT 158

Query: 184 GYGAALKTANVQKGDTVAVFG-AGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGA 242
            Y  ALK+AN++ G  VA+ G AG +G   VQ A+A    +++ +D    K++     G 
Sbjct: 159 VY-KALKSANLKAGQWVAISGAAGGLGSLAVQYARAM-GLRVLGIDGGPGKEELFKTLGG 216

Query: 243 TDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACHK---GWGQSII 299
             F+    D      I E +++              NV V   A+ A  K     G S++
Sbjct: 217 ECFI----DFTKEHDIAEAVIK----ATNGGAHGVINVSVSEGAISASTKYVRSCGTSVL 268

Query: 300 IGVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRP 359
           +G+ A     S    Q+V      GS  G    R++    ++ + +G +K    I     
Sbjct: 269 VGMPAGAICKSEVFDQVVRSTKIVGSYVG---NRADTREALDFFARGLVKAPIKIVGLST 325

Query: 360 FKEINEGFE 368
             EI E  E
Sbjct: 326 LPEIFEKME 334

>KLTH0A00418g Chr1 complement(34685..35755) [1071 bp, 356 aa] {ON}
           similar to uniprot|P00331 Saccharomyces cerevisiae
           YMR303C ADH2 Glucose-repressible alcohol dehydrogenase
           II involved in the production of certain carboxylate
           esters
          Length = 356

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 83/201 (41%), Gaps = 30/201 (14%)

Query: 65  VSLCFGARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQG 123
           + L  G  GAG+V ++G  V   K+GD+  I    + C  C+ C+      C+    +  
Sbjct: 67  LPLVGGHEGAGIVVAMGASVRGWKIGDYAGIKWLNSCCMSCEQCELSNEPNCAYADIS-- 124

Query: 124 KGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTT 183
            G   DG                   +F +Y     V    I     L +V  + C   T
Sbjct: 125 -GFTRDG-------------------SFQQYATADAVQAARIPPGTNLAEVSPVLCAGIT 164

Query: 184 GYGAALKTANVQKGDTVAVFGA-GTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGA 242
            +  ALKTAN+  G+ VA+ GA G +G   +Q AKA   S ++ +D    K+    D G 
Sbjct: 165 VF-KALKTANLTAGNWVAISGACGGLGSMAIQYAKAMGYS-VVGIDSGAEKEHLFNDLGG 222

Query: 243 TDFVNPKTDLKDGQTIVEKLV 263
             F+    D    + +V ++V
Sbjct: 223 DVFL----DFSKSENLVPEVV 239

>KNAG0E02590 Chr5 complement(513565..514689) [1125 bp, 374 aa] {ON}
           Anc_2.480 YMR083W
          Length = 374

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 58/209 (27%), Positives = 83/209 (39%), Gaps = 32/209 (15%)

Query: 50  HGCVHSVWFGSEVRCVSLCF--GARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKM 106
           H  +H+ W G     V L    G  GAGVV + G +V + ++GD   I      C  C++
Sbjct: 68  HTDLHA-WKGDWPLSVKLPLVGGHEGAGVVVAKGSNVNNFEIGDLAGIKWLNGSCMSCEL 126

Query: 107 CKSGKTNLCSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAID 166
           C+SG  + C     +   G   DG                   +F +Y     V    I 
Sbjct: 127 CESGHESNCEHADLS---GYTHDG-------------------SFQQYATADAVQAAKIP 164

Query: 167 RDAPLEKVCLLGCGVTTGYGAALKTANVQKGDTVAVFG-AGTIGLSVVQGAKAREASKII 225
               L +V  + C   T Y  ALK A++  G  V + G AG +G   VQ  KA    ++I
Sbjct: 165 EGTNLAEVAPVLCAGITVY-KALKEASLSPGQWVCISGAAGGLGSLAVQYGKAM-GLRVI 222

Query: 226 VVDINDTKKKFAFDFGA---TDFVNPKTD 251
            +D    K++     G     DF   KTD
Sbjct: 223 GIDGGPGKEELFKSLGGEVFIDFTKQKTD 251

>ZYRO0B05940g Chr2 (480279..481418) [1140 bp, 379 aa] {ON} highly
           similar to uniprot|P00330 Saccharomyces cerevisiae
           YOL086C ADH1 Alcohol dehydrogenase involved in the
           production of certain carboxylate esters
          Length = 379

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 78/317 (24%), Positives = 121/317 (38%), Gaps = 43/317 (13%)

Query: 65  VSLCFGARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQG 123
           + L  G  GAG V ++G +V + KVGD   I      C  C+ C+    + C        
Sbjct: 92  LPLVGGHEGAGEVIALGSNVKNWKVGDLAGIKWLNGSCMSCESCEQSNESNC-------- 143

Query: 124 KGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTT 183
               PD            L  +    +F +Y     V    I     L +V  + C   T
Sbjct: 144 ----PDAD----------LSGYTHDGSFQQYATADAVQAAHIPPGTDLAEVAPVLCAGIT 189

Query: 184 GYGAALKTANVQKGDTVAVFG-AGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGA 242
            Y  ALK+AN++ G  VA+ G AG +G   VQ AKA    +++ +D    K++     G 
Sbjct: 190 VY-KALKSANLKAGQWVAISGAAGGLGSLAVQFAKAM-GLRVVGIDGGPGKEELFKTLGG 247

Query: 243 TDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACHK---GWGQSII 299
             F+    D +    IV  +V               NV V   A+ A  K     G S++
Sbjct: 248 EVFI----DFQKESDIVGAVVN----ATNGGAHGVVNVSVSEGAISASTKYVRACGTSVL 299

Query: 300 IGVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRP 359
           +G+ A     S    Q+V      GS  G    R++    ++ + +G +       N  P
Sbjct: 300 VGMPAGAVCKSEVFDQVVRSTKIVGSYVG---NRADTREALDFFARGLVHAP---INVVP 353

Query: 360 FKEINEGFEDLHHGDCL 376
              + E FE +  G  +
Sbjct: 354 LSTLPEIFEKMEKGQII 370

>CAGL0M14047g Chr13 complement(1386775..1387854) [1080 bp, 359 aa]
           {ON} highly similar to uniprot|Q04894 Saccharomyces
           cerevisiae YMR318c or uniprot|P25377 Saccharomyces
           cerevisiae YCR105w
          Length = 359

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 78/330 (23%), Positives = 126/330 (38%), Gaps = 46/330 (13%)

Query: 59  GSEVRCVS---------LCFGARGAGVVESVGPDV-TSVKVGDHV-IALYTAECKECKMC 107
           GS++ C +         L  G    G V  VGP   T +K+GD V +      C EC+ C
Sbjct: 46  GSDIHCAAGNWGQKQTPLVVGHEIIGKVVKVGPKCKTGLKIGDRVGVGAQVFSCLECERC 105

Query: 108 KSGKTNLCSAVRATQGKGVMPDGTSRFRNSKGEPLLH-FMGCSTFAEYTVVADVSVVAID 166
           K+     C+                RF  +  +P    ++    +A Y  V +   V I 
Sbjct: 106 KNDNEPYCA----------------RFVTTYSQPYEDGYVSQGGYANYVRVHEHFAVPIP 149

Query: 167 RDAPLEKVCLLGCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIV 226
            + P E    L CG  T Y   L+      G  V + G G IG   +  AKA  A ++  
Sbjct: 150 ENIPSEYAAPLLCGGLTVYSPLLRNG-CGPGKKVGILGIGGIGHMGILFAKAMGA-EVYA 207

Query: 227 VDINDTKKKFAFDFGATDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDA 286
           +  ++ KK+ +   GA  ++  K +   G    +    +                V  D 
Sbjct: 208 ISRSNAKKEDSLKLGADHYIATKEEPDWGTKYFDTFDLIVVCASSL-------TDVDFDV 260

Query: 287 LEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKG 346
           +    K  G+ + I V    + ++ +PF L+ G     S  G +   +EM  L++  ++ 
Sbjct: 261 MPKAMKVGGRIVSISVPEQDEVLTMKPFGLI-GVSIANSILGSI---AEMKQLLKLVSEN 316

Query: 347 NLKIDEFITNKRPFKE--INEGFEDLHHGD 374
           N+KI        P  E  + E FE +  GD
Sbjct: 317 NIKI---WVETLPVGEAGVKEAFERMDKGD 343

>ZYRO0F02552g Chr6 (203037..204092) [1056 bp, 351 aa] {ON} similar
           to uniprot|Q07786 Saccharomyces cerevisiae YDL246C SOR2
           Protein of unknown function computational analysis of
           large-scale protein-protein interaction data suggests a
           possible role in fructose or mannose metabolism
          Length = 351

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 75/192 (39%), Gaps = 37/192 (19%)

Query: 67  LCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAVRATQGKGV 126
           +  G   +G+V  VG  VT+VKVGD V        +      SG  NLC           
Sbjct: 62  MVLGHESSGIVAEVGSAVTNVKVGDRVAIEPGIPSRYSDETMSGNYNLC----------- 110

Query: 127 MPDGTSRFRNSKGEPLLHFMGCS----TFAEYTVVADVSVVAIDRDAPLEKVCL---LGC 179
                         P + F        T  +Y +  +  V  +      E+  L   +  
Sbjct: 111 --------------PHMVFAATPPYDGTLTKYYLAPEDFVYKMPDHLSFEEGALAEPMSV 156

Query: 180 GVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFD 239
           GV      A K A  + G  V V GAG +GL     A+A  A++++ VDI + K + +  
Sbjct: 157 GVH-----ANKLAGTRFGSKVLVSGAGPVGLLAGAVARAFGATEVVFVDIAEEKLERSKQ 211

Query: 240 FGATDFVNPKTD 251
           FGAT  V+  +D
Sbjct: 212 FGATHTVSSSSD 223

>KLLA0A10549g Chr1 (921022..922083) [1062 bp, 353 aa] {ON} highly
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046C
          Length = 353

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 97/242 (40%), Gaps = 29/242 (11%)

Query: 145 FMGCSTFAEYT-VVADVSVVAIDRDAPLEKVCLLGCGVTTGYGAAL---KTANVQKGDTV 200
           ++  STFA++T    +  ++ + +D   EK  ++   +  G        +  NVQKGD +
Sbjct: 112 YLSASTFAQFTKYPQNGHLIKLPKDISAEKEKIIAGSLVQGLTPLTFIDEAYNVQKGDFI 171

Query: 201 AVF-GAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGATDFVNPKTDLKDGQTIV 259
            V+  AG +GL   Q  KAR A + I V   D K + A ++GA   +N   D      IV
Sbjct: 172 LVYAAAGGVGLIFDQLLKARGA-RTIAVASTDEKLQLAKEYGAEFLINSTKD-----DIV 225

Query: 260 EKLVEMXXXXXXXXXXXXXNVQVMRDALEACHKGWGQSIIIGVAAAG------KEISTRP 313
           EK+ E                      L+   +  G  +  G A+          +S + 
Sbjct: 226 EKVKEFTNGEGVAAAFDSIGKDTFETTLQVVKRK-GTIVSFGNASGAVPPFSINRLSPKN 284

Query: 314 FQLVTGRVWKGSAFGGVKGRSEM----GSLIEDYNKGNLKIDEFITNKRPFKEINEGFED 369
            +LV  ++     F  V   SE       LI   + G LKI   I+   P K+  E  ED
Sbjct: 285 LKLVRPQL-----FAYVADPSEWEHYSSELIRLIDSGELKIT--ISKVYPLKDYKEATED 337

Query: 370 LH 371
           L 
Sbjct: 338 LE 339

>TPHA0J00170 Chr10 (40911..41996) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 74/304 (24%), Positives = 114/304 (37%), Gaps = 34/304 (11%)

Query: 75  GVVESVGPDVTS-VKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQGKGVMPDGTS 132
           G V  VGP  T+ VKVGD V +   +  C EC+ C +G    C          + PDG  
Sbjct: 72  GEVVKVGPKCTAGVKVGDRVGVGAQSLSCLECESCIAGNEQYCKKNTVYTIASIYPDG-- 129

Query: 133 RFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTTGYGAALKTA 192
               SK +          F  +    +  V  I ++        L CG  T +   L+  
Sbjct: 130 ----SKAQ--------GGFGSHVRTHEYFVHPIPKELDTVNAAPLLCGGITAFSPLLR-G 176

Query: 193 NVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGATDFVNPKTDL 252
            V  G TV + G G IG   +  AKA  A K+I +  + +KK+     GA +++      
Sbjct: 177 QVGPGKTVGIVGIGGIGHIAILFAKAMGA-KVIAISRSASKKEDCLKLGADEYIASAEGD 235

Query: 253 KDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACHKGWGQSIIIGVAAAGKEISTR 312
              Q     +  M                   D+L +  K  G+   IG+      +S  
Sbjct: 236 DWKQKFAGSIDFMLLCNSSFSKSNF-------DSLFSLIKLGGEVCSIGIPDMSYRLSIS 288

Query: 313 PFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRPFKE--INEGFEDL 370
           P  L+  +      F  +  R+E   + E   K N+K+        P  E  ++E FE +
Sbjct: 289 PLSLLGIKF----GFSALGSRNEFQKMFELVKKNNIKL---WVETLPIGEKGLHEAFERV 341

Query: 371 HHGD 374
            +GD
Sbjct: 342 ENGD 345

>NCAS0C03020 Chr3 complement(593785..594873) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 77/315 (24%), Positives = 118/315 (37%), Gaps = 39/315 (12%)

Query: 67  LCFGARGAGVVESVGPDVTS-VKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQGK 124
           L  G    G V  +G +  S +K+GD V +      C +C+ CK+     C     T G+
Sbjct: 66  LVVGHEIIGTVVRLGENCNSGLKLGDRVGVGAQVFSCLDCERCKNDNEPYCEGFVTTYGQ 125

Query: 125 GVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTTG 184
              PDG S    SKG           +A+Y  V +   V I  + P      L CG  T 
Sbjct: 126 D-YPDGYS----SKG----------GYADYFRVHEHFAVPIPENIPSHLAAPLMCGGLTV 170

Query: 185 YGAALKT--ANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGA 242
           Y   ++      +K   V + G G  GL   +   A    ++  +     KK+ A   GA
Sbjct: 171 YSPLVRNGCGPNKKVGIVGIGGIGHQGLLFAKAMGA----EVYAISRTSAKKEDAMKLGA 226

Query: 243 TDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACHKGWGQSIIIGV 302
             F+  K +   G    +    +                V  + +    K  G  + I V
Sbjct: 227 DHFIATKEEPDWGTKYFDTFDLIVVCASSL-------TDVDFNTVPNTMKIGGSIVSISV 279

Query: 303 AAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRPFKE 362
               + +S +PF L  G     SA G +   SEM  L++  ++ N+K+        P  E
Sbjct: 280 PEQNETLSLKPFGL-KGVSISNSALGSI---SEMRDLLKLVSENNIKL---WVETIPIGE 332

Query: 363 --INEGFEDLHHGDC 375
             + E FE +  GDC
Sbjct: 333 KGVKEAFERMDKGDC 347

>Ecym_1093 Chr1 complement(195854..197005) [1152 bp, 383 aa] {ON}
           similar to Saccharomyces cerevisiae YMR318C ADH6 /
           YCR105W ADH7
          Length = 383

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 79/331 (23%), Positives = 130/331 (39%), Gaps = 48/331 (14%)

Query: 59  GSEVRCVSLCFGARGAGVV---ESVGPDV-------TSVKVGDHV-IALYTAECKECKMC 107
           GS++ C +  +G R   +V   E +G  +         +KVGD V +      C EC  C
Sbjct: 70  GSDIHCAAGHWGPRNNPLVVGHEIIGRVIEVGSGCKEGLKVGDRVGVGAQALSCLECSRC 129

Query: 108 KSGKTNLCSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDR 167
           +S     CS +  T      PDG              ++    +A + +V +   + I  
Sbjct: 130 ESENEQYCSNMTGTYNFP-YPDG--------------YISQGGYASHVIVHEHFAIPIPD 174

Query: 168 DAPLEKVCLLGCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVV 227
           + P      L CG  T +   L++ NV  G +V V G G IG   V  AKA  A+ +  +
Sbjct: 175 NIPSHLAAPLMCGGITAFSPLLRS-NVGPGTSVGVVGIGGIGHMAVIFAKALGAN-VTAI 232

Query: 228 DINDTKKKFAFDFGATDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDAL 287
                KK  A   GA  ++    D KD        +++               ++  D +
Sbjct: 233 SRRSNKKDDALKLGADVYIAAVED-KDWHKTYANTLDLIVVCSSSL------TELDFDRI 285

Query: 288 EACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGG--VKGRSEMGSLIEDYNK 345
            +  K  G+ + I +  A + +  RP  L      KG + G   +   +E+  L++  +K
Sbjct: 286 PSLLKVGGKVLSIAIPEASERLVLRPLLL------KGISIGTSVIGSPAEIKKLLDFVSK 339

Query: 346 GNLKIDEFITNKRPFKE--INEGFEDLHHGD 374
            NLKI      + P  E  + E F  ++ GD
Sbjct: 340 KNLKI---WVEEVPISEAGVAEVFRRMNSGD 367

>NDAI0A08470 Chr1 (1954035..1955126) [1092 bp, 363 aa] {ON} 
          Length = 363

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 78/312 (25%), Positives = 119/312 (38%), Gaps = 35/312 (11%)

Query: 67  LCFGARGAGVVESVGPDVTS-VKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQGK 124
           L  G    G V  +G +  S +K+GD V +      C +C+ CKS     C +   T G+
Sbjct: 67  LVVGHEVIGTVVRLGENCNSGLKLGDRVGVGAQVFSCLDCERCKSNNEPYCPSFVTTYGQ 126

Query: 125 GVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTTG 184
               DG S    SKG           +A+Y  V +   V I  + P      L CG  T 
Sbjct: 127 SYK-DGYS----SKG----------GYADYIRVHEHFAVPIPENIPSHLAAPLMCGGITV 171

Query: 185 YGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGATD 244
           +   L+           V   G   + ++  AKA  A ++  +     KK+ A   GA  
Sbjct: 172 FSPLLRNGCGPGKKVGIVGIGGIGHMGLIF-AKAMGA-EVYAISRTSAKKEDAMKLGADH 229

Query: 245 FVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACHKGWGQSIIIGVAA 304
           F+  K +   G    +   ++             NV      +    K  G  + I V  
Sbjct: 230 FIATKEEPDWGTKYFDTF-DLIVVCANSLTDVDFNV------VPKAMKVGGNIVSICVPE 282

Query: 305 AGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRPFKE-- 362
             + ++ +PF L+ G     SA GGVK   E+  L++  +K NLKI        P  E  
Sbjct: 283 QNEVLNLKPFGLL-GVSISNSALGGVK---EIKELLDLVSKNNLKI---WVETLPIGEEG 335

Query: 363 INEGFEDLHHGD 374
           + + FE +  GD
Sbjct: 336 VKQAFERMDKGD 347

>TDEL0F03190 Chr6 (583849..584904) [1056 bp, 351 aa] {ON}  possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 351

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 76/186 (40%), Gaps = 27/186 (14%)

Query: 65  VSLCFGARGAGVVESVGPDVTS-VKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQ 122
           + L  G  GAG+V + G  V    ++GD   I      C  C+ C+    + C     + 
Sbjct: 63  LPLVGGHEGAGIVVAKGSMVXXGWEIGDLAGIKWLNGSCMSCEYCEKANESNCPQADLS- 121

Query: 123 GKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVT 182
             G   DG+                   F +Y     V    + +   L +V  + C   
Sbjct: 122 --GYTHDGS-------------------FQQYATADAVQAARVPKGTDLAEVAPILCAGI 160

Query: 183 TGYGAALKTANVQKGDTVAVFGA-GTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFG 241
           T Y  ALK+AN++ G+ VA+ GA G +G   VQ AKA    +++ +D  D K K     G
Sbjct: 161 TVY-KALKSANLRAGEWVAISGASGGLGSLAVQYAKAM-GYRVLGIDGGDEKAKLFKQLG 218

Query: 242 ATDFVN 247
              F++
Sbjct: 219 GEYFID 224

>SAKL0D14938g Chr4 complement(1235542..1236678) [1137 bp, 378 aa]
           {ON} similar to uniprot|Q04894 Saccharomyces cerevisiae
           YMR318C ADH6 NADPH-dependent cinnamyl alcohol
           dehydrogenase family member with broad substrate
           specificity may be involved in fusel alcohol synthesis
           or in aldehyde tolerance
          Length = 378

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 73/332 (21%), Positives = 126/332 (37%), Gaps = 45/332 (13%)

Query: 57  WFGSEVRCVSLCFGARG-------AGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCK 108
           W    + C+S   G +         G V +VG  VT    G+ V +      C +C  C 
Sbjct: 61  WSDEPLACLSAKIGPKSQVVGHEIVGHVVNVGNKVTKFHKGERVAMGAQCGSCMKCNRCI 120

Query: 109 SGKTNLCSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRD 168
           +G    C+    T      PDG              ++    +A +    +  +V +   
Sbjct: 121 NGYEQFCTGCIETYCSE-YPDG--------------YVSQGGYASHVRAHEHYIVHVPPQ 165

Query: 169 APLEKVCLLGCGVTTGYGA---ALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKII 225
              + V  L CG  T Y     ALK     K   VA+ G G +G   +  +KA +  ++ 
Sbjct: 166 LDSKHVAPLQCGGLTVYSPIKRALKDVT-DKKPRVAIIGIGGLGHMAIMISKALDC-EVW 223

Query: 226 VVDINDTKKKFAFDFGATDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRD 285
            +  +D+KK+ A   GA  FVN  T  KD    ++    +               ++  +
Sbjct: 224 ALSTSDSKKEDAKKMGADHFVN--TTEKDVWGGLQDTFHLILSCTISY------TKLPFE 275

Query: 286 ALEACHKGWGQSIIIGVAAAGKEISTRPFQLVT-GRVWKGSAFGGVKGRSEMGSLIEDYN 344
           +L       G+ I +G+ +  + +   P QL   G  +  S  G +K   E+ +L   ++
Sbjct: 276 SLLGTLVATGKFISVGLPSKDQPLEIHPMQLAAHGVSFSASHLGSIKELEELLALSVKHD 335

Query: 345 KGNLKIDEFITNKRPFKE--INEGFEDLHHGD 374
                I  ++  + P  E  ++EG   L+ GD
Sbjct: 336 -----IKPWV-EELPISEDSLHEGLTRLNKGD 361

>KAFR0L02000 Chr12 (378013..379098) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 78/185 (42%), Gaps = 26/185 (14%)

Query: 65  VSLCFGARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQG 123
           + L  G  GAGVV  +G +V + K+GD   +    + C  C+ C+ G    C     ++ 
Sbjct: 74  LPLVGGHEGAGVVVGMGSNVKNWKIGDKAGVKWLNSTCMTCEHCELGNEPSC---LKSEY 130

Query: 124 KGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTT 183
            G   +G                   +F +Y  V  +    +  +  L ++    C   T
Sbjct: 131 NGFTRNG-------------------SFQQYVAVDAIHAPRLPDNCDLAELAPASCAGVT 171

Query: 184 GYGAALKTANVQKGDTVAVFGA-GTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGA 242
            Y  A+K+AN++ G  +A+ GA G +G   +Q  KA    +++ +D  + K     + G 
Sbjct: 172 VY-KAIKSANIRAGQWMAITGACGGLGSVAIQYCKAM-GYRVVGIDAGEAKANLFKELGG 229

Query: 243 TDFVN 247
             F++
Sbjct: 230 EVFID 234

>NDAI0H02060 Chr8 complement(502872..504071) [1200 bp, 399 aa] {ON} 
          Length = 399

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 38/93 (40%), Gaps = 18/93 (19%)

Query: 40  YQDHQHCYLPHGCVHSVWFGSEVRCVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTA 99
           +QD    +  +GC H +        +    G   AG+V  +GP V   +VGD V+   T 
Sbjct: 46  FQDGPIFFPENGCCHEI----SGEGLPQAMGHEIAGIVSEIGPKVKKFQVGDRVVVEPTG 101

Query: 100 ECK--------------ECKMCKSGKTNLCSAV 118
            CK              EC  CK G  N+CS +
Sbjct: 102 TCKDRYRWPDAPNANQEECAACKKGLYNICSNL 134

>KAFR0A08730 Chr1 complement(1747657..1748739) [1083 bp, 360 aa]
           {ON} 
          Length = 360

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 58/198 (29%), Positives = 77/198 (38%), Gaps = 19/198 (9%)

Query: 67  LCFGARGAGVVESVGPDVTS-VKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQGK 124
           L  G    G V  VG   TS +KVGD V +      C  C  C +     C  V  T G 
Sbjct: 64  LVVGHEIVGTVVKVGSKCTSGMKVGDRVGVGAQVHSCLTCDRCNNDNEQYCPNVVFTYGF 123

Query: 125 GVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTTG 184
              PDG     N KG           +A Y  V +   V I  + P      L CG  T 
Sbjct: 124 D-YPDGY----NGKG----------GYANYIRVHEHFAVPIPENIPTHLAAPLLCGGITV 168

Query: 185 YGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGATD 244
           Y   L+      G  V + G G IG   +  AK+  A ++  +  +D KK+ AF  GA  
Sbjct: 169 YSPLLRNG-CGPGKKVGILGIGGIGHMGIIFAKSMGA-EVYAISRSDAKKEDAFKLGADH 226

Query: 245 FVNPKTDLKDGQTIVEKL 262
           F+  K +   G+   + L
Sbjct: 227 FIATKDEPDWGKKYFDTL 244

>NCAS0D01220 Chr4 (223821..224909) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 65/295 (22%), Positives = 107/295 (36%), Gaps = 42/295 (14%)

Query: 87  VKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQGKGVMPDGTSRFRNSKGEPLLHF 145
           +KVGD V +      C EC  CK+   + C    AT G G  PDG              +
Sbjct: 85  LKVGDRVGVGAQVFSCLECNRCKTDNESYCPKWVATYG-GEYPDG--------------Y 129

Query: 146 MGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTTGYGAALKTA----NVQKGDTVA 201
           +    +A++  V +  VV I  + P E    L CG  T +   L+             + 
Sbjct: 130 ISKGGYADFVRVHEHFVVPIPENIPSEYAAPLLCGGLTVFSPLLRNGCGPGKKVGIVGIG 189

Query: 202 VFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGATDFVNPKTDLKDGQTIVEK 261
             G   +  +   GA+    S+         KK  AF  GA  F+  K +   G    + 
Sbjct: 190 GIGHQGVIFANAMGAEVYAISR------TSKKKDDAFKLGAHHFIATKEEPDWGTKYYDT 243

Query: 262 LVEMXXXXXXXXXXXXXNVQVMRDALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRV 321
              +                +  D +    K  G+ + I +    + +  +PF L  G  
Sbjct: 244 FDLIVVCANSL-------TDIDFDVVPHTMKIGGRIVSISIPEMSQVLKLKPFGL-KGVS 295

Query: 322 WKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRPFKE--INEGFEDLHHGD 374
              S  G +K   E+ +L++  ++ NL+I        P  E  ++E F+ +  GD
Sbjct: 296 ISNSHLGSIK---ELKTLLKLVSEKNLRI---WIETIPIGEKGVHEAFDRMDKGD 344

>ABL033C Chr2 complement(337866..338987) [1122 bp, 373 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR083W
           (ADH3)
          Length = 373

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 72/184 (39%), Gaps = 24/184 (13%)

Query: 65  VSLCFGARGAGVVESVGPDVTSVKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQG 123
           + L  G  GAGVV + G +VT+ ++GD+  +      C EC+ C+ G    C     +  
Sbjct: 86  LPLVGGHEGAGVVVAKGANVTNFEIGDYAGVKWLGKTCMECEFCQKGFEPNCETPTLS-- 143

Query: 124 KGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTT 183
            G   DG                   TF +Y     +    I     L KV  + C   T
Sbjct: 144 -GYTHDG-------------------TFQQYATADAIHAAHIPPGTDLAKVAPILCAGIT 183

Query: 184 GYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGAT 243
            Y  ALKTA +  G  VA+ GAG    S+          +++ +D  + K+      G  
Sbjct: 184 VY-KALKTAALIPGQWVAISGAGGGLGSLAVQYAVAMGYRVVGIDGGNEKEALFRSLGGE 242

Query: 244 DFVN 247
            FV+
Sbjct: 243 TFVD 246

>Kwal_56.22985 s56 complement(357501..358541) [1041 bp, 346 aa] {ON}
           YBR046C (ZTA1) - 1:1 [contig 184] FULL
          Length = 346

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 50/108 (46%), Gaps = 6/108 (5%)

Query: 145 FMGCSTFAEYTVVADVSVVAI----DRDAPLEKVCLLGCGVTTGYGAALKTANVQKGDTV 200
           ++   TFA+YT +A+   ++       D  LE        V T    A +   V+KGD V
Sbjct: 104 YLSAGTFAQYTKIAETGHISKLPENTTDKQLELYAASLVQVLTALTFAKEAYTVKKGDFV 163

Query: 201 AVF-GAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGATDFVN 247
            ++  AG +GL+  Q  K R  +  I V   D K + A +FGA   VN
Sbjct: 164 LLYAAAGGVGLAFNQILK-RLGAHTIAVASTDEKLQLAKEFGAEYLVN 210

>KLLA0F00528g Chr6 complement(40081..41226) [1146 bp, 381 aa] {ON}
           similar to uniprot|P39713 Saccharomyces cerevisiae
           YAL061W putative polyol dehydrogenase
          Length = 381

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 29/63 (46%), Gaps = 10/63 (15%)

Query: 63  RCVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKE----------CKMCKSGKT 112
           R +    G   AGVV  VG  VT  + GDHV+   T  C++          CK CK G  
Sbjct: 65  RGLPQAMGHEMAGVVSQVGSSVTKFQPGDHVVVEPTGTCQDRERYNTKGETCKACKRGMH 124

Query: 113 NLC 115
           N+C
Sbjct: 125 NVC 127

>TPHA0H03100 Chr8 complement(736924..738102) [1179 bp, 392 aa] {ON}
           Anc_7.3 YAL060W
          Length = 392

 Score = 37.0 bits (84), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 50/188 (26%), Positives = 76/188 (40%), Gaps = 37/188 (19%)

Query: 69  FGARGAGVVESVGPDVTSVKVGDHVIALYTAECKE--------------CKMCKSGKTNL 114
            G   +GVVE VG    + KVGDHV+   T  CK+              C  C  G TN+
Sbjct: 71  MGHEISGVVEKVGKGCKTFKVGDHVVVEPTGTCKDRYRWPESQNANKPMCSACSIGMTNI 130

Query: 115 CSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKV 174
           C+ + A  G G+   G                    FAE  V+ +  V  I    PL+  
Sbjct: 131 CAHL-ALCGAGLESGG--------------------FAERLVINEAHVHKIPDHMPLDIG 169

Query: 175 CLLGCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKK 234
            L+       +  A+K A+ +KG +  + G G IGL  +   K      I++ +    ++
Sbjct: 170 ALIQPISVCWH--AVKVAHYKKGGSALIIGGGPIGLGTILALKGFGCEYIVLSEPATIRR 227

Query: 235 KFAFDFGA 242
           ++A   GA
Sbjct: 228 EYAGKMGA 235

>NDAI0G04880 Chr7 complement(1175518..1176603) [1086 bp, 361 aa]
           {ON} 
          Length = 361

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 77/312 (24%), Positives = 119/312 (38%), Gaps = 35/312 (11%)

Query: 67  LCFGARGAGVVESVGPDVTS-VKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQGK 124
           L  G    G V  +G   TS +K+GD V +      C EC  CKS     C+    T   
Sbjct: 65  LVVGHEIIGTVVRLGDKCTSGLKLGDRVGVGAQAFSCLECGRCKSDNEPYCTKSVWTYST 124

Query: 125 GVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTTG 184
               DG     NSKG           +A+Y  + +   + I  + P      L CG  T 
Sbjct: 125 N-YEDG----YNSKG----------GYADYIRLHEHFAIPIPENIPSHLAAPLMCGGITA 169

Query: 185 YGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGATD 244
           +   L+     +G  V + G G IG   +  AKA  A ++  +     KK  +   GA  
Sbjct: 170 FSPLLRNG-CGRGKKVGIMGIGGIGHMALIFAKAMGA-EVYAISRTSAKKDDSIKMGADH 227

Query: 245 FVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACHKGWGQSIIIGVAA 304
           F+  K +  D  T      ++                +  D +    K  G+ + I    
Sbjct: 228 FIATKEE-PDWATKYFDTFDLIVVCSNSL------TDINFDVVPRTMKVGGKIVSICAPE 280

Query: 305 AGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRPFKE-- 362
             + I+ +PF L+ G     SA GG+   +E+  +++  +K +LKI        P  E  
Sbjct: 281 QNEVINLKPFGLL-GVSISNSALGGI---NEIKQMLDLVSKKDLKI---WVETVPISEKG 333

Query: 363 INEGFEDLHHGD 374
           + E FE +  GD
Sbjct: 334 VKEVFERMDMGD 345

>KLLA0F00638g Chr6 (51849..52997) [1149 bp, 382 aa] {ON} weakly
           similar to uniprot|P53912 Saccharomyces cerevisiae or
           YLR460C uniprot|P54007 Saccharomyces cerevisiae YLR460C
           Hypothetical ORFs
          Length = 382

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 53/114 (46%), Gaps = 6/114 (5%)

Query: 146 MGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTTGYGAALKTANV----QKGDTVA 201
           +  STF EYTV     V  +     L+    +G  + T   A     NV    ++  ++ 
Sbjct: 142 LRTSTFQEYTVFDSRLVWRVPERIGLDFASGIGVSLVTAGAALASKRNVKVQPEEKKSIV 201

Query: 202 VFGAGT-IGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGATDFVNPKTDLKD 254
           ++G  T +G+ VVQ AK+   +KII +  +   +++    GAT  ++ +   +D
Sbjct: 202 IWGGSTGVGIFVVQLAKSLGFTKIITIT-SKKHEQYLLSLGATHIIHREEKTED 254

>KLTH0C10538g Chr3 complement(873623..874444) [822 bp, 273 aa] {ON}
           conserved hypothetical protein
          Length = 273

 Score = 34.3 bits (77), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 39/68 (57%), Gaps = 2/68 (2%)

Query: 152 AEYTVVADVSVVAIDRDAPLEKVCLLGCGVTTGYGAALKTANVQKGDTVAVFGA-GTIGL 210
           AEY VV++ +V    ++    +   LG  +TT    AL+ A V+  D V+V GA G++G 
Sbjct: 51  AEYCVVSEDAVALKPKNVTFAQAACLGVPLTTA-SLALQRAAVEPSDCVSVIGASGSVGS 109

Query: 211 SVVQGAKA 218
            VVQ A++
Sbjct: 110 YVVQLAQS 117

>YMR318C Chr13 complement(911061..912143) [1083 bp, 360 aa] {ON}
           ADH6NADPH-dependent medium chain alcohol dehydrogenase
           with broad substrate specificity; member of the cinnamyl
           family of alcohol dehydrogenases; may be involved in
           fusel alcohol synthesis or in aldehyde tolerance
          Length = 360

 Score = 34.3 bits (77), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 70/332 (21%), Positives = 126/332 (37%), Gaps = 50/332 (15%)

Query: 59  GSEVRC---------VSLCFGARGAGVVESVGPDVTS-VKVGDHV-IALYTAECKECKMC 107
           GS++ C         + L  G    G V  +GP   S +KVG  V +      C EC  C
Sbjct: 47  GSDIHCAAGHWGNMKMPLVVGHEIVGKVVKLGPKSNSGLKVGQRVGVGAQVFSCLECDRC 106

Query: 108 KSGKTNLCSAVRATQGKGVMPDGTSRFRNSKGEPLLH-FMGCSTFAEYTVVADVSVVAID 166
           K+     C+                +F  +  +P    ++    +A Y  V +  VV I 
Sbjct: 107 KNDNEPYCT----------------KFVTTYSQPYEDGYVSQGGYANYVRVHEHFVVPIP 150

Query: 167 RDAPLEKVCLLGCGVTTGYGAALKT--ANVQKGDTVAVFGAGTIGLSVVQGAKAREASKI 224
            + P      L CG  T Y   ++      +K   V + G G++G  + +   A    + 
Sbjct: 151 ENIPSHLAAPLLCGGLTVYSPLVRNGCGPGKKVGIVGLGGIGSMGTLISKAMGA----ET 206

Query: 225 IVVDINDTKKKFAFDFGATDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMR 284
            V+  +  K++ A   GA  ++     L++G    +                  +  +M 
Sbjct: 207 YVISRSSRKREDAMKMGADHYI---ATLEEGDWGEKYFDTFDLIVVCASSLTDIDFNIMP 263

Query: 285 DALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYN 344
            A+    K  G+ + I +    + +S +P+ L    +   SA G +K   E+  L++  +
Sbjct: 264 KAM----KVGGRIVSISIPEQHEMLSLKPYGLKAVSI-SYSALGSIK---ELNQLLKLVS 315

Query: 345 KGNLKIDEFITNKRPFKE--INEGFEDLHHGD 374
           + ++KI        P  E  ++E FE +  GD
Sbjct: 316 EKDIKI---WVETLPVGEAGVHEAFERMEKGD 344

>Skud_13.494 Chr13 complement(884038..885120) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 33.5 bits (75), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 71/332 (21%), Positives = 125/332 (37%), Gaps = 50/332 (15%)

Query: 59  GSEVRC---------VSLCFGARGAGVVESVGPDVTS-VKVGDHV-IALYTAECKECKMC 107
           GS+V C         + L  G    G V  +GP   S +K+G  V +      C EC  C
Sbjct: 47  GSDVHCAAGHWGNKQLPLVVGHEIVGKVVKLGPKSNSGLKIGQRVGVGAQVFSCLECNRC 106

Query: 108 KSGKTNLCSAVRATQGKGVMPDGTSRFRNSKGEPLLH-FMGCSTFAEYTVVADVSVVAID 166
           KS     C                ++F  +  +P    ++    +A Y  V +  VV + 
Sbjct: 107 KSDNEPYC----------------TKFVTTYSQPYEDGYVSQGGYANYVRVHEHFVVPVP 150

Query: 167 RDAPLEKVCLLGCGVTTGYGAALKT--ANVQKGDTVAVFGAGTIGLSVVQGAKAREASKI 224
           ++ P      L CG  T Y   ++      +K   V   G G++G S++  A   E    
Sbjct: 151 KNIPSHLAAPLLCGGLTVYSPLIRNGCGPGKKVGIVGFGGIGSMG-SLIAKAMGAET--- 206

Query: 225 IVVDINDTKKKFAFDFGATDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMR 284
            V+  +  KK+ A   GA  ++    +   G+   +                  +  VM 
Sbjct: 207 YVISRSSKKKEDAMKMGADHYIATLEEEDWGEKYFDTF---DLIVVCASSLTGIDFNVMP 263

Query: 285 DALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYN 344
            A+    K  G+ + I +    + ++ +P+ L    +   SA G +K   E+  L++  +
Sbjct: 264 KAM----KVGGRIVSISIPEQHEMLTLKPYGLKAVSI-SYSALGSIK---ELKQLLKLVS 315

Query: 345 KGNLKIDEFITNKRPFKE--INEGFEDLHHGD 374
           + ++KI        P  E  ++E  E +  GD
Sbjct: 316 ENDIKI---WVETLPIGEAGVHEALERMEKGD 344

>TDEL0D03720 Chr4 (683833..684840) [1008 bp, 335 aa] {ON} Anc_3.253
           YBR046C
          Length = 335

 Score = 33.5 bits (75), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 54/108 (50%), Gaps = 6/108 (5%)

Query: 145 FMGCSTFAEYTVVADVSVVA-IDRDAPLEKVCLLGCGVTTGYGAAL---KTANVQKGDTV 200
           +M  STFA+YT  +   +++ +  +   +++ +    +  G  A     +   V++GD +
Sbjct: 94  YMSSSTFAQYTKYSSSGLISKLPSETTDDQLKVYAAALIQGLTALTFLDEAYKVKEGDYI 153

Query: 201 AVF-GAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGATDFVN 247
            ++  AG +GL + Q  K R A  I VV   + K++ A  FGA   +N
Sbjct: 154 LLYAAAGGVGLLMDQLLKERGAHAIAVVS-TEEKEELAKKFGAEYVIN 200

>Kpol_257.4 s257 complement(12348..13430) [1083 bp, 360 aa] {ON}
           complement(12348..13430) [1083 nt, 361 aa]
          Length = 360

 Score = 33.5 bits (75), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 37/83 (44%), Gaps = 12/83 (14%)

Query: 59  GSEVRCVSLCFGA---------RGAGVVESVGPDVTS-VKVGDHV-IALYTAECKECKMC 107
           GS++ C +  +G             G V  VGP  T+ +K+GD V +    A C +C  C
Sbjct: 47  GSDIHCAASHWGPVVKNQVVGHEIVGRVVKVGPKCTTGIKIGDRVGVGAQVASCLDCSRC 106

Query: 108 KSGKTNLCSAVRATQGKGVMPDG 130
           ++     C  V  T G+   PDG
Sbjct: 107 QNDNEPYCPRVVTTYGQA-YPDG 128

>TPHA0F02090 Chr6 (465913..466995) [1083 bp, 360 aa] {ON} 
          Length = 360

 Score = 33.5 bits (75), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 69/334 (20%), Positives = 113/334 (33%), Gaps = 55/334 (16%)

Query: 59  GSEVRCVSLCFGA---------RGAGVVESVGPDV-TSVKVGDHV-IALYTAECKECKMC 107
           GS+V C +  +G             G V  VGP   T +KVGD V +      C +C  C
Sbjct: 47  GSDVHCAASHWGPVKDNQVVGHEIIGKVVKVGPKCNTGIKVGDRVGVGAQALACLDCNRC 106

Query: 108 KSGKTNLCSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDR 167
           K    N C     T G     DG              ++    +A +  V +   + I  
Sbjct: 107 KEDHENYCFGNIWTYGGPTYADG--------------YIPQGGYASHIRVHEHFAIPIPE 152

Query: 168 DAPLEKVCLLGCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVV 227
           + P E    L CG  T +   L            V   G   + ++ G      +++  +
Sbjct: 153 NIPSELAAPLLCGGVTVFAPLLNGGAGPGKKVGIVGIGGIGHMGILFGKAM--GAEVYAL 210

Query: 228 DINDTKKKFAFDFGATDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDAL 287
               +KK  +   GA  ++    D    +T  +    +               Q+  D L
Sbjct: 211 SRTQSKKADSLKLGADHYIATVEDKNWSETYKDTFDLLVICSSSLS-------QLDIDEL 263

Query: 288 EACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGN 347
               +  G+ I I     G++I   P  L+   +       G+  R E+  L++  +K N
Sbjct: 264 IKTMRIGGRIISICAPEIGEKIVLNPLGLLGVSIEN----SGIGSRKEILQLLDLVSKKN 319

Query: 348 LKIDEFITNKRPFKE--------INEGFEDLHHG 373
           +K         P+ E        +NE FE +  G
Sbjct: 320 IK---------PWVETLQVGEAGVNEAFERMEKG 344

>Kpol_529.30 s529 (89344..90426) [1083 bp, 360 aa] {ON}
           (89344..90426) [1083 nt, 361 aa]
          Length = 360

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 36/83 (43%), Gaps = 12/83 (14%)

Query: 59  GSEVRCVSLCFGA---------RGAGVVESVGPDVTS-VKVGDHV-IALYTAECKECKMC 107
           GS++ C +  +G             G V  VGP  T+ +K+GD V +    A C EC  C
Sbjct: 47  GSDIHCAASHWGPVVKNQVVGHEIVGRVVKVGPKCTTGIKIGDRVGVGAQVASCLECSRC 106

Query: 108 KSGKTNLCSAVRATQGKGVMPDG 130
           ++     C     T G+   PDG
Sbjct: 107 QNDNEPYCPRFVTTYGQP-YPDG 128

>TPHA0A00140 Chr1 (14857..15945) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 75/305 (24%), Positives = 117/305 (38%), Gaps = 35/305 (11%)

Query: 75  GVVESVGPDVT-SVKVGDHV-IALYTAECKECKMCKSGKTNLC-SAVRATQGKGVMPDGT 131
           G V  +GP     +KVGD V +      C  CK CKS     C S  R     G   DG 
Sbjct: 72  GRVVKLGPKCKLGLKVGDRVGVGAQAKSCLNCKRCKSDNEPYCKSKDRVGTYSGTYSDG- 130

Query: 132 SRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTTGYGAALKT 191
                        ++    +A +    +  V  I  + P E    L CG  T +   L+ 
Sbjct: 131 -------------YVSQGGYASHVRTHEHFVFKIPDNIPTELAAPLLCGGVTVFSPLLRN 177

Query: 192 ANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGATDFVNPKTD 251
                G  V V G G IG   +  AKA  A ++  +  + +KK+ +   GA D+     +
Sbjct: 178 G-CGPGKKVGVVGIGGIGHMGILFAKAMGA-EVYAISRSSSKKEDSLKLGA-DYYIATQE 234

Query: 252 LKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMRDALEACHKGWGQSIIIGVAAAGKEIST 311
            KD  T     +++                +  D L A     G+ + I +  A ++++ 
Sbjct: 235 EKDWATTYADTLDLIVLCASSLS------DINIDDLVATMTIGGKIVSIAIPDASQQLTL 288

Query: 312 RPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRPFKE--INEGFED 369
           +PF L+ G     SA G  K   ++  L+ +      KI  ++    P  E  +NE FE 
Sbjct: 289 KPFGLL-GVYISNSALGSRKEIIQLLDLVSEK-----KIKPWVQT-VPISEAGVNEVFER 341

Query: 370 LHHGD 374
           +  GD
Sbjct: 342 MEKGD 346

>TDEL0A00140 Chr1 (23016..24233) [1218 bp, 405 aa] {ON} 
          Length = 405

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 56/119 (47%), Gaps = 23/119 (19%)

Query: 146 MGCSTFAEYTVVADVSVV-----------AIDRDAPLEKVCLLGCGVTTGYGAALKT--- 191
           +  STF EYTV  D  +V            + +   LE    +G G+ T  G+A+ +   
Sbjct: 141 LETSTFQEYTVF-DSRLVWKLPQYRLPNGRLHKRFDLEFAAGVGVGLVTA-GSAISSLVD 198

Query: 192 ------ANVQK-GDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGAT 243
                 A+ QK G+ V   G+ ++GL V+Q AKA +  + IVV      K++  + GA+
Sbjct: 199 LSLRDQADHQKLGNIVIWGGSSSVGLYVIQLAKASKMFEKIVVVSASKHKEYLLELGAS 257

>Suva_13.513 Chr13 complement(894394..895476) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 69/332 (20%), Positives = 124/332 (37%), Gaps = 50/332 (15%)

Query: 59  GSEVRC---------VSLCFGARGAGVVESVGPDVTS-VKVGDHV-IALYTAECKECKMC 107
           GS++ C         + L  G    G V  +G    S ++VG  V +      C EC  C
Sbjct: 47  GSDIHCAAGNWGKKKMPLVVGHEIVGTVVKLGSKSNSGLQVGQRVGMGAQVFSCLECDRC 106

Query: 108 KSGKTNLCSAVRATQGKGVMPDGTSRFRNSKGEPLLH-FMGCSTFAEYTVVADVSVVAID 166
           KS     C                ++F  + G+P    ++    +A+Y  V +  VV I 
Sbjct: 107 KSDNEPYC----------------TKFVTTYGQPYEDGYVSQGGYADYVRVHEHFVVPIP 150

Query: 167 RDAPLEKVCLLGCGVTTGYGAALKT--ANVQKGDTVAVFGAGTIGLSVVQGAKAREASKI 224
            + P      L CG  T Y   ++      +K   V   G G++G  + +   A    + 
Sbjct: 151 ENIPSHLAAPLLCGGLTAYSPLVRNGCGPGKKVGIVGFGGIGSMGTLIAKAMGA----ET 206

Query: 225 IVVDINDTKKKFAFDFGATDFVNPKTDLKDGQTIVEKLVEMXXXXXXXXXXXXXNVQVMR 284
            V+  +  K++ A   GA  ++    +   G+   +                  +  VM 
Sbjct: 207 YVISRSSKKREDAMKMGADHYIATLEEENWGEKYFDTF---DLIVVCASSLTGIDFDVMP 263

Query: 285 DALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYN 344
            A+    K  G+ + I +    + ++ +P+ L    +   SA G +K   E+  L++  +
Sbjct: 264 KAM----KVGGRIVSISIPEQHEVLTLKPYGLKAVSI-SYSALGSIK---ELKQLLKLVS 315

Query: 345 KGNLKIDEFITNKRPFKE--INEGFEDLHHGD 374
           + N+KI        P  E  ++E  E +  GD
Sbjct: 316 EKNVKI---WVETLPVGEAGVHEALERMEKGD 344

>TBLA0A06640 Chr1 (1621352..1622437) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 63/291 (21%), Positives = 111/291 (38%), Gaps = 35/291 (12%)

Query: 87  VKVGDHV-IALYTAECKECKMCKSGKTNLCSAVRATQGKGVMPDGTSRFRNSKGEPLLHF 145
           +K+G  V +      C EC+ CK+     C+    T   G+ P+G              +
Sbjct: 85  LKIGQRVGVGAQVFSCLECQRCKNNNEQYCTNFVTTY-TGIYPNG--------------Y 129

Query: 146 MGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTTGYGAALKTANVQKGDTVAVFGA 205
           +    +A +  V +  V+ I  + P E    L CG  T +   L+         V + G 
Sbjct: 130 IAQGGYASHIRVHEHFVIPIPDEIPTELAAPLMCGGATVFTPLLRNG-CGPNKKVGIIGI 188

Query: 206 GTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGATDFVNPKTDLKDGQTIVEKLVEM 265
           G IG   +  AKA  A ++      + K+  A D GA  +    T+  D        + +
Sbjct: 189 GGIGHMGILLAKAMGA-EVYAFSRGENKRADAMDLGADHYYATGTEGWDKDLFNTLDLAV 247

Query: 266 XXXXXXXXXXXXXNVQVMRDALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGS 325
                         +++M+          G    I V    ++++ RPFQLV   +  G+
Sbjct: 248 ICASSLTDINLDQYIKIMKIG--------GSIQSISVPDVTEKLTLRPFQLVGITI--GN 297

Query: 326 AFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRPFKE--INEGFEDLHHGD 374
           +  G     ++ ++++   K N+KI      K P  E  ++E +  L  GD
Sbjct: 298 SLIGTP--QDIKTMLDIVVKNNVKI---WIEKVPVGEKGVHEAWSRLEKGD 343

>TDEL0E00230 Chr5 (36310..37398) [1089 bp, 362 aa] {ON}   Added 3N
           and 2N to fix a STOP codon and a frameshift that cannot
           be fixed with the contigs.
          Length = 362

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 28/70 (40%), Gaps = 4/70 (5%)

Query: 57  WFGSEVRCVSLCFGARGAGVVESVGPDVTS-VKVGDHV-IALYTAECKECKMCKSGKTNL 114
           W G    C  L  G    G +  +GP   S VK+GD V I      C  C+ C +G    
Sbjct: 58  WMGYP--CQXLVVGHEIIGRIVKLGPKYHSGVKIGDRVGIGAQVFSCLNCRRCNNGDEPY 115

Query: 115 CSAVRATQGK 124
           CS    T  +
Sbjct: 116 CSKFVTTYSQ 125

>KLTH0C07854g Chr3 (673945..675021) [1077 bp, 358 aa] {ON} similar
           to uniprot|P38230 Saccharomyces cerevisiae YBR046C ZTA1
           Zeta-crystallin homolog
          Length = 358

 Score = 31.2 bits (69), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 45/238 (18%), Positives = 94/238 (39%), Gaps = 21/238 (8%)

Query: 145 FMGCSTFAEYTVVADVSVVA-IDRDAPLEKVCLLGCGVT---TGYGAALKTANVQKGDTV 200
           ++  +TFA+YT +++   V+ + +D+  E++ L    +    T      +   V+KGD +
Sbjct: 116 YLSSNTFAQYTKISEAGTVSKVPQDSTDEQLKLYAGSLVQALTSLAFVREAYPVKKGDYI 175

Query: 201 AVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGATDFVNPKTDLKDGQTIVE 260
            ++ A             +  +  I V   D K + A ++GA   +N   D      ++ 
Sbjct: 176 LLYAAAGGAGLAFNQFLKKAGAHTIAVASTDEKLQLAKEYGAEFLINSSKD-----DVLA 230

Query: 261 KLVEMXXXXXXXXXXXXXNVQVMRDALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTG- 319
           +++E+                    +L+A  +   +  ++    A   +      ++T  
Sbjct: 231 RVLEITNGQGVEAAFDSVGKDTFETSLKALKR---KGTLVSFGNASGPVPPVAINILTPK 287

Query: 320 --RVWKGSAFGGVKGRSEMGS----LIEDYNKGNLKIDEFITNKRPFKEINEGFEDLH 371
             ++ + S FG +    E  S    L +  + G LKI   I+   P +E N+  E L 
Sbjct: 288 NIKLLRPSLFGYIATHEEWESYSSELFDLLHSGALKI--LISKTYPLEEYNQAAEQLE 343

>Kpol_1057.24 s1057 (53467..54549) [1083 bp, 360 aa] {ON}
           (53467..54549) [1083 nt, 361 aa]
          Length = 360

 Score = 30.8 bits (68), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 30/68 (44%), Gaps = 11/68 (16%)

Query: 59  GSEVRCVSLCFGARGA---------GVVESVGPDVTS-VKVGDHV-IALYTAECKECKMC 107
           GS+V C +  +G             G V  VGP  T+ +KVGD V +      C EC  C
Sbjct: 47  GSDVHCAASHWGPVAEKQVVGHEIIGRVLKVGPKCTTGIKVGDRVGVGAQAWSCLECSRC 106

Query: 108 KSGKTNLC 115
           KS   + C
Sbjct: 107 KSDNESYC 114

>KNAG0E04200 Chr5 complement(837232..838389) [1158 bp, 385 aa] {ON} 
          Length = 385

 Score = 30.4 bits (67), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 68/188 (36%), Gaps = 37/188 (19%)

Query: 69  FGARGAGVVESVGPDVTSVKVGDHVIALYTAECKE--------------CKMCKSGKTNL 114
            G   AG+V +VG  V   +VGDHV    T  C++              C  C+ G  N 
Sbjct: 71  MGHEMAGIVTAVGSGVKKFQVGDHVAIEPTGTCRDRYRWPDAPDAKKPVCTSCQRGMYNC 130

Query: 115 CSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKV 174
           C  +    G GV   G                    FAE  VV +        + P E  
Sbjct: 131 CDYL-GLIGNGVQSGG--------------------FAERIVVNESHCYKCPDNLPWEVA 169

Query: 175 CLLGCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKK 234
            L+       +  A+  A  + G +V + G G IGL  +        ++IIV +    ++
Sbjct: 170 ALIQPIAVCWH--AINIAQFKPGSSVLILGGGPIGLGTILALNGHGCTEIIVSEPVKLRR 227

Query: 235 KFAFDFGA 242
            +A   GA
Sbjct: 228 DYAEKMGA 235

>Suva_6.13 Chr6 (21861..22031,22035..22067) [204 bp, 68 aa] {ON}
           YJR159W (REAL)
          Length = 68

 Score = 28.1 bits (61), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 188 ALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGATDFV 246
           A++   V+ GD V V     IGL V    +     K++++   D+KK+ +  FG T F+
Sbjct: 11  AVRLPQVKYGDCVVVISVRAIGLLVDAVFREFGVDKVVLMSTQDSKKQ-SEQFGGTGFI 68

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,960,771
Number of extensions: 1394338
Number of successful extensions: 3508
Number of sequences better than 10.0: 175
Number of HSP's gapped: 3408
Number of HSP's successfully gapped: 185
Length of query: 382
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 271
Effective length of database: 40,753,473
Effective search space: 11044191183
Effective search space used: 11044191183
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)