Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0C037707.348ON22320210041e-139
KAFR0B008607.348ON2281977109e-95
NCAS0A141407.348ON2241977011e-93
NDAI0A019107.348ON2141836922e-92
ZYRO0F11660g7.348ON1981826871e-91
SAKL0F11330g7.348ON2081826843e-91
Kpol_530.337.348ON1951816763e-90
ACL150W7.348ON2191856776e-90
TDEL0C020007.348ON2131826767e-90
TPHA0F029507.348ON2161826681e-88
Kwal_56.246357.348ON2261836663e-88
KLLA0D12386g7.348ON2111826645e-88
KLTH0H01298g7.348ON2141996515e-86
TBLA0E005207.348ON2091826481e-85
Ecym_47257.348ON2341966458e-85
Smik_4.727.348ON1971816341e-83
YDL166C (FAP7)7.348ON1971816304e-83
Suva_4.807.348ON2061876305e-83
Skud_4.917.348ON1941966165e-81
CAGL0I03366g7.348ON2121846151e-80
YKL024C (URA6)2.667ON20431740.36
Ecym_41075.572ON19262740.36
TBLA0E042608.242ON1202114750.46
Smik_11.2292.667ON20431710.73
TPHA0K017504.84ON15528700.89
Skud_11.2042.667ON27931710.93
KLTH0C00528g2.667ON28253711.1
ZYRO0A13310gsingletonOFF51525711.3
Zrou_YGOB_A13310g8.558ON55825711.3
Kpol_1026.64.84ON15528681.5
NCAS0A017904.84ON15528681.7
NCAS0C055704.84ON15528681.7
Kwal_47.184305.572ON21531681.9
Kwal_27.121138.558ON50625692.0
TBLA0C004808.101ON36023692.0
SAKL0H09658gsingletonOFF51025692.1
Ecym_70518.558ON54332692.1
ZYRO0A02750g8.478ON18024672.2
NDAI0D037204.84ON15628672.4
Smik_7.256singletonON12628662.4
KNAG0C027905.572ON18531672.5
Sklu_YGOB_09658g8.558ON54025682.5
YBR186W (PCH2)8.558ON56425682.6
NDAI0H005304.84ON15528662.6
CAGL0A01562g4.84ON15528662.6
ABR139W5.34ON127040692.7
Skud_2.3128.558ON53425682.7
Smik_2.3268.558ON56425682.7
TBLA0A089304.84ON15528662.7
Ecym_14214.84ON15328662.8
Suva_4.4378.558ON55225682.8
Kpol_1048.538.558ON55225682.9
KLTH0E12936g8.558ON54425683.0
NDAI0C051708.478ON19022663.0
Suva_7.4394.84ON15528663.3
Cgla_YGOB_M064358.558ON54925683.3
CAGL0M06435gsingletonOFF52125673.4
Suva_7.2474.84ON15528653.4
Kwal_14.22994.84ON15528653.5
Smik_7.2554.84ON15528653.6
TPHA0I018208.558ON55936673.7
KLTH0H09328g4.84ON15528653.7
Skud_7.2554.84ON15528653.7
YGL031C (RPL24A)4.84ON15528653.7
YGR148C (RPL24B)4.84ON15528653.7
Smik_6.2524.84ON15528653.7
NDAI0E027308.558ON54425673.7
KAFR0F035704.84ON15528653.7
YNL290W (RFC3)3.69ON34032673.8
Skud_7.4714.84ON15528653.8
Skud_14.473.69ON34032673.9
SAKL0H21164g4.84ON14928653.9
Suva_14.493.69ON34032664.0
KAFR0I009404.84ON15528654.1
YKL197C (PEX1)1.506ON104381674.2
TDEL0B028708.558ON57325674.3
TDEL0E007803.69ON33632664.3
AFR477C4.84ON15528654.3
SAKL0C12144g3.69ON32932664.4
TBLA0B084503.69ON33332664.4
Kpol_1057.162.667ON29353664.5
Smik_14.413.69ON34032664.7
KLLA0E13201g3.69ON32932665.0
NCAS0A098903.69ON33632665.2
Kpol_1066.383.69ON33632655.8
AEL258W8.558ON52622656.0
KNAG0G018808.236ON22537646.1
KAFR0E008408.558ON56325656.9
ZYRO0B11968g8.242ON1101137658.0
Ecym_62781.308ON30143648.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0C03770
         (223 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0C03770 Chr3 (742558..743229) [672 bp, 223 aa] {ON} Anc_7.34...   391   e-139
KAFR0B00860 Chr2 (161692..162378) [687 bp, 228 aa] {ON} Anc_7.34...   278   9e-95
NCAS0A14140 Chr1 (2779202..2779876) [675 bp, 224 aa] {ON} Anc_7....   274   1e-93
NDAI0A01910 Chr1 complement(428746..429390) [645 bp, 214 aa] {ON...   271   2e-92
ZYRO0F11660g Chr6 (955635..956231) [597 bp, 198 aa] {ON} similar...   269   1e-91
SAKL0F11330g Chr6 (882784..883410) [627 bp, 208 aa] {ON} similar...   268   3e-91
Kpol_530.33 s530 complement(81184..81771) [588 bp, 195 aa] {ON} ...   265   3e-90
ACL150W Chr3 (87745..88404) [660 bp, 219 aa] {ON} Syntenic homol...   265   6e-90
TDEL0C02000 Chr3 complement(347930..348571) [642 bp, 213 aa] {ON...   265   7e-90
TPHA0F02950 Chr6 (649875..650525) [651 bp, 216 aa] {ON} Anc_7.34...   261   1e-88
Kwal_56.24635 s56 (1083026..1083706) [681 bp, 226 aa] {ON} YDL16...   261   3e-88
KLLA0D12386g Chr4 complement(1054141..1054776) [636 bp, 211 aa] ...   260   5e-88
KLTH0H01298g Chr8 complement(124206..124850) [645 bp, 214 aa] {O...   255   5e-86
TBLA0E00520 Chr5 (95049..95678) [630 bp, 209 aa] {ON} Anc_7.348 ...   254   1e-85
Ecym_4725 Chr4 complement(1419236..1419940) [705 bp, 234 aa] {ON...   253   8e-85
Smik_4.72 Chr4 complement(140216..140809) [594 bp, 197 aa] {ON} ...   248   1e-83
YDL166C Chr4 complement(163449..164042) [594 bp, 197 aa] {ON}  F...   247   4e-83
Suva_4.80 Chr4 complement(150992..151612) [621 bp, 206 aa] {ON} ...   247   5e-83
Skud_4.91 Chr4 complement(159116..159700) [585 bp, 194 aa] {ON} ...   241   5e-81
CAGL0I03366g Chr9 complement(287811..288449) [639 bp, 212 aa] {O...   241   1e-80
YKL024C Chr11 complement(392526..393140) [615 bp, 204 aa] {ON}  ...    33   0.36 
Ecym_4107 Chr4 complement(215380..215958) [579 bp, 192 aa] {ON} ...    33   0.36 
TBLA0E04260 Chr5 (1083669..1087277) [3609 bp, 1202 aa] {ON} Anc_...    33   0.46 
Smik_11.229 Chr11 complement(379526..380140) [615 bp, 204 aa] {O...    32   0.73 
TPHA0K01750 Chr11 (371736..372203) [468 bp, 155 aa] {ON} Anc_4.8...    32   0.89 
Skud_11.204 Chr11 complement(373437..374051,374060..374284) [840...    32   0.93 
KLTH0C00528g Chr3 (55308..56156) [849 bp, 282 aa] {ON} highly si...    32   1.1  
ZYRO0A13310g Chr1 complement(1050131..1051678) [1548 bp, 515 aa]...    32   1.3  
Zrou_YGOB_A13310g Chr1 complement(1049931..1050068,1050140..1051...    32   1.3  
Kpol_1026.6 s1026 (11817..12284) [468 bp, 155 aa] {ON} (11817..1...    31   1.5  
NCAS0A01790 Chr1 (347668..348135) [468 bp, 155 aa] {ON} Anc_4.84...    31   1.7  
NCAS0C05570 Chr3 (1131003..1131470) [468 bp, 155 aa] {ON} Anc_4....    31   1.7  
Kwal_47.18430 s47 (821910..822557) [648 bp, 215 aa] {ON} YDR454C...    31   1.9  
Kwal_27.12113 s27 complement(1090541..1092061) [1521 bp, 506 aa]...    31   2.0  
TBLA0C00480 Chr3 (88992..90074) [1083 bp, 360 aa] {ON} Anc_8.101...    31   2.0  
SAKL0H09658g Chr8 (828107..829639) [1533 bp, 510 aa] {OFF} simil...    31   2.1  
Ecym_7051 Chr7 complement(103898..104056,104172..105644) [1632 b...    31   2.1  
ZYRO0A02750g Chr1 (222495..223037) [543 bp, 180 aa] {ON} similar...    30   2.2  
NDAI0D03720 Chr4 (883565..884035) [471 bp, 156 aa] {ON} Anc_4.84...    30   2.4  
Smik_7.256 Chr7 complement(428915..429292) [378 bp, 126 aa] {ON}...    30   2.4  
KNAG0C02790 Chr3 complement(544595..545152) [558 bp, 185 aa] {ON...    30   2.5  
Sklu_YGOB_09658g Chr8 (828107..829591,829654..829791) [1623 bp, ...    31   2.5  
YBR186W Chr2 (600553..602103,602217..602360) [1695 bp, 564 aa] {...    31   2.6  
NDAI0H00530 Chr8 complement(122504..122971) [468 bp, 155 aa] {ON...    30   2.6  
CAGL0A01562g Chr1 (157645..158112) [468 bp, 155 aa] {ON} highly ...    30   2.6  
ABR139W Chr2 (658141..661953) [3813 bp, 1270 aa] {ON} Syntenic h...    31   2.7  
Skud_2.312 Chr2 (567925..569382,569566..569712) [1605 bp, 534 aa...    31   2.7  
Smik_2.326 Chr2 (586919..588469,588545..588688) [1695 bp, 564 aa...    31   2.7  
TBLA0A08930 Chr1 complement(2190651..2191118) [468 bp, 155 aa] {...    30   2.7  
Ecym_1421 Chr1 complement(873870..874331) [462 bp, 153 aa] {ON} ...    30   2.8  
Suva_4.437 Chr4 (770299..771957) [1659 bp, 552 aa] {ON} YBR186W ...    31   2.8  
Kpol_1048.53 s1048 (151366..153024) [1659 bp, 552 aa] {ON} (1513...    31   2.9  
KLTH0E12936g Chr5 complement(1145066..1146700) [1635 bp, 544 aa]...    31   3.0  
NDAI0C05170 Chr3 complement(1201173..1201745) [573 bp, 190 aa] {...    30   3.0  
Suva_7.439 Chr7 complement(757803..758270) [468 bp, 155 aa] {ON}...    30   3.3  
Cgla_YGOB_M06435 Chr13 (668126..669628,669749..669895) [1650 bp,...    31   3.3  
CAGL0M06435g Chr13 (668126..669691) [1566 bp, 521 aa] {OFF} simi...    30   3.4  
Suva_7.247 Chr7 complement(428086..428553) [468 bp, 155 aa] {ON}...    30   3.4  
Kwal_14.2299 s14 complement(696773..697240) [468 bp, 155 aa] {ON...    30   3.5  
Smik_7.255 Chr7 complement(428825..429292) [468 bp, 155 aa] {ON}...    30   3.6  
TPHA0I01820 Chr9 (404763..406295,406384..406530) [1680 bp, 559 a...    30   3.7  
KLTH0H09328g Chr8 complement(800260..800727) [468 bp, 155 aa] {O...    30   3.7  
Skud_7.255 Chr7 complement(439951..440418) [468 bp, 155 aa] {ON}...    30   3.7  
YGL031C Chr7 complement(437467..437934) [468 bp, 155 aa] {ON}  R...    30   3.7  
YGR148C Chr7 complement(787312..787779) [468 bp, 155 aa] {ON}  R...    30   3.7  
Smik_6.252 Chr6 complement(406483..406950) [468 bp, 155 aa] {ON}...    30   3.7  
NDAI0E02730 Chr5 (573056..574554,574636..574771) [1635 bp, 544 a...    30   3.7  
KAFR0F03570 Chr6 (710871..711338) [468 bp, 155 aa] {ON} Anc_4.84...    30   3.7  
YNL290W Chr14 (86218..87240) [1023 bp, 340 aa] {ON}  RFC3Subunit...    30   3.8  
Skud_7.471 Chr7 complement(770069..770536) [468 bp, 155 aa] {ON}...    30   3.8  
Skud_14.47 Chr14 (79783..80805) [1023 bp, 340 aa] {ON} YNL290W (...    30   3.9  
SAKL0H21164g Chr8 complement(1845674..1846123) [450 bp, 149 aa] ...    30   3.9  
Suva_14.49 Chr14 (82953..83975) [1023 bp, 340 aa] {ON} YNL290W (...    30   4.0  
KAFR0I00940 Chr9 complement(182794..183261) [468 bp, 155 aa] {ON...    30   4.1  
YKL197C Chr11 complement(70734..73865) [3132 bp, 1043 aa] {ON}  ...    30   4.2  
TDEL0B02870 Chr2 (512594..514168,514238..514384) [1722 bp, 573 a...    30   4.3  
TDEL0E00780 Chr5 (162061..163071) [1011 bp, 336 aa] {ON} Anc_3.6...    30   4.3  
AFR477C Chr6 complement(1296737..1297204) [468 bp, 155 aa] {ON} ...    30   4.3  
SAKL0C12144g Chr3 complement(1088849..1089838) [990 bp, 329 aa] ...    30   4.4  
TBLA0B08450 Chr2 complement(2024891..2025892) [1002 bp, 333 aa] ...    30   4.4  
Kpol_1057.16 s1057 (29809..30690) [882 bp, 293 aa] {ON} (29809.....    30   4.5  
Smik_14.41 Chr14 (70565..71587) [1023 bp, 340 aa] {ON} YNL290W (...    30   4.7  
KLLA0E13201g Chr5 (1168489..1169478) [990 bp, 329 aa] {ON} highl...    30   5.0  
NCAS0A09890 Chr1 complement(1978423..1979433) [1011 bp, 336 aa] ...    30   5.2  
Kpol_1066.38 s1066 complement(64176..65186) [1011 bp, 336 aa] {O...    30   5.8  
AEL258W Chr5 (152451..153911,153967..154086) [1581 bp, 526 aa] {...    30   6.0  
KNAG0G01880 Chr7 (420542..421219) [678 bp, 225 aa] {ON} Anc_8.23...    29   6.1  
KAFR0E00840 Chr5 (176559..178121,178220..178348) [1692 bp, 563 a...    30   6.9  
ZYRO0B11968g Chr2 (956319..959624) [3306 bp, 1101 aa] {ON} simil...    30   8.0  
Ecym_6278 Chr6 complement(526852..527757) [906 bp, 301 aa] {ON} ...    29   8.4  

>KNAG0C03770 Chr3 (742558..743229) [672 bp, 223 aa] {ON} Anc_7.348
           YDL166C
          Length = 223

 Score =  391 bits (1004), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 189/202 (93%), Positives = 189/202 (93%)

Query: 1   MGESRRLNPNILVTGTPGTGKSTTCELLLRNLPDYTYYNISDFAAKNKCYDGYDEARKSH 60
           MGESRRLNPNILVTGTPGTGKSTTCELLLRNLPDYTYYNISDFAAKNKCYDGYDEARKSH
Sbjct: 1   MGESRRLNPNILVTGTPGTGKSTTCELLLRNLPDYTYYNISDFAAKNKCYDGYDEARKSH 60

Query: 61  IVXXXXXXXXXXXXXHSGGNIIDWHVNDVFPERLIDLVAVLRCDSSVLFDRLNKREYHSS 120
           IV             HSGGNIIDWHVNDVFPERLIDLVAVLRCDSSVLFDRLNKREYHSS
Sbjct: 61  IVDEDKLLDELEPLLHSGGNIIDWHVNDVFPERLIDLVAVLRCDSSVLFDRLNKREYHSS 120

Query: 121 KIDENMDAEIMGVVLQDALDSYEEQIVVELQSDDTEQMAANVDRVVTWTTMWKEQHPEGV 180
           KIDENMDAEIMGVVLQDALDSYEEQIVVELQSDDTEQMAANVDRVVTWTTMWKEQHPEGV
Sbjct: 121 KIDENMDAEIMGVVLQDALDSYEEQIVVELQSDDTEQMAANVDRVVTWTTMWKEQHPEGV 180

Query: 181 TNELSAHQAKKERNDESEEGDF 202
           TNELSAHQAKKERNDESEEGDF
Sbjct: 181 TNELSAHQAKKERNDESEEGDF 202

>KAFR0B00860 Chr2 (161692..162378) [687 bp, 228 aa] {ON} Anc_7.348
           YDL166C
          Length = 228

 Score =  278 bits (710), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 132/197 (67%), Positives = 153/197 (77%)

Query: 3   ESRRLNPNILVTGTPGTGKSTTCELLLRNLPDYTYYNISDFAAKNKCYDGYDEARKSHIV 62
           ESRR +PN+LVTGTPG GKSTTCELL+R LPDYTY+NIS+FA K+KCYDGYDE+RKSHIV
Sbjct: 7   ESRRYSPNLLVTGTPGCGKSTTCELLMRRLPDYTYFNISEFAEKHKCYDGYDESRKSHIV 66

Query: 63  XXXXXXXXXXXXXHSGGNIIDWHVNDVFPERLIDLVAVLRCDSSVLFDRLNKREYHSSKI 122
                          G +IIDWHVNDVFPERLIDLV VLRCD+S+LFDRL+ R YH SKI
Sbjct: 67  DDDKLLDELEPLLRRGKSIIDWHVNDVFPERLIDLVVVLRCDNSILFDRLHGRGYHESKI 126

Query: 123 DENMDAEIMGVVLQDALDSYEEQIVVELQSDDTEQMAANVDRVVTWTTMWKEQHPEGVTN 182
            EN+DAEIMGVVLQDALDSYE++IVVELQS+ TE+M ANV+R+V W  MW  QH  GVTN
Sbjct: 127 QENLDAEIMGVVLQDALDSYEQEIVVELQSNSTEEMDANVERIVAWQEMWLTQHKNGVTN 186

Query: 183 ELSAHQAKKERNDESEE 199
           E      K   +DE ++
Sbjct: 187 EYQGELPKDSNSDEEQQ 203

>NCAS0A14140 Chr1 (2779202..2779876) [675 bp, 224 aa] {ON} Anc_7.348
           YDL166C
          Length = 224

 Score =  274 bits (701), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 133/197 (67%), Positives = 155/197 (78%), Gaps = 3/197 (1%)

Query: 1   MGESRRLNPNILVTGTPGTGKSTTCELLLRNLPDYTYYNISDFAAKNKCYDGYDEARKSH 60
           M +SRR  PN+L+TGTPG GKSTTCELL R LP+Y YYNISDFA ++ CYDGYD+ RKSH
Sbjct: 1   MSKSRRYQPNLLITGTPGCGKSTTCELLQRRLPEYKYYNISDFAKEHDCYDGYDKGRKSH 60

Query: 61  IVXXXXXXXXXXXXXHSGGNIIDWHVNDVFPERLIDLVAVLRCDSSVLFDRLNKREYHSS 120
           IV               G +IIDWHVNDVFPERLIDLVAVLRCD+SVL+DRL+ R+YH +
Sbjct: 61  IVDEDKLLDELEPLLRQGKSIIDWHVNDVFPERLIDLVAVLRCDNSVLYDRLHGRKYHDT 120

Query: 121 KIDENMDAEIMGVVLQDALDSYEEQIVVELQSDDTEQMAANVDRVVTWTTMWKEQHPEGV 180
           KI+ENMDAEIMGVVLQDAL+SY ++IVVELQSD TEQM ANVDR+V W  MW EQH +GV
Sbjct: 121 KIEENMDAEIMGVVLQDALESYAKEIVVELQSDTTEQMDANVDRIVDWQKMWLEQHEDGV 180

Query: 181 TNELSAHQAKKERNDES 197
           TNEL   + K+  +DES
Sbjct: 181 TNEL---EDKQRNSDES 194

>NDAI0A01910 Chr1 complement(428746..429390) [645 bp, 214 aa] {ON}
           Anc_7.348 YDL166C
          Length = 214

 Score =  271 bits (692), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 124/183 (67%), Positives = 146/183 (79%)

Query: 4   SRRLNPNILVTGTPGTGKSTTCELLLRNLPDYTYYNISDFAAKNKCYDGYDEARKSHIVX 63
           SRR  PN+L+TGTPG+GKSTTCELL R LP+Y YYNISDFA +N CY+GYD+ RKSHIV 
Sbjct: 6   SRRYEPNLLITGTPGSGKSTTCELLQRRLPEYAYYNISDFAKENDCYEGYDKGRKSHIVD 65

Query: 64  XXXXXXXXXXXXHSGGNIIDWHVNDVFPERLIDLVAVLRCDSSVLFDRLNKREYHSSKID 123
                         G +I+DWHVND+FPERLIDLV VLRCD+S+L+DRLNKR YH SKI 
Sbjct: 66  EDKLLDELEPLLRKGKSIVDWHVNDIFPERLIDLVVVLRCDNSILYDRLNKRGYHDSKIQ 125

Query: 124 ENMDAEIMGVVLQDALDSYEEQIVVELQSDDTEQMAANVDRVVTWTTMWKEQHPEGVTNE 183
           EN+DAEIMGVVLQDA++SY+++IVVELQSDDTEQM ANV+R+V W  MW +QH  GVTNE
Sbjct: 126 ENLDAEIMGVVLQDAVESYQQEIVVELQSDDTEQMEANVERIVEWHKMWMDQHKNGVTNE 185

Query: 184 LSA 186
           L  
Sbjct: 186 LQG 188

>ZYRO0F11660g Chr6 (955635..956231) [597 bp, 198 aa] {ON} similar to
           uniprot|Q12055 Saccharomyces cerevisiae YDL166C FAP7
           Essential nuclear protein involved in the oxidative
           stress response
          Length = 198

 Score =  269 bits (687), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 125/182 (68%), Positives = 145/182 (79%)

Query: 3   ESRRLNPNILVTGTPGTGKSTTCELLLRNLPDYTYYNISDFAAKNKCYDGYDEARKSHIV 62
           ESRR +PN+L+TGTPG+GKSTT ELL R L D+ YYNISDFA +N C+DGYDE RKSHIV
Sbjct: 2   ESRRYHPNVLITGTPGSGKSTTSELLQRRLSDFQYYNISDFAQENDCFDGYDEGRKSHIV 61

Query: 63  XXXXXXXXXXXXXHSGGNIIDWHVNDVFPERLIDLVAVLRCDSSVLFDRLNKREYHSSKI 122
                          GGNIIDWHVNDVFPERLIDLV VLRC++S+LF RL KR YH +KI
Sbjct: 62  DEDKLLDLLEPLLRKGGNIIDWHVNDVFPERLIDLVVVLRCENSILFKRLKKRGYHQTKI 121

Query: 123 DENMDAEIMGVVLQDALDSYEEQIVVELQSDDTEQMAANVDRVVTWTTMWKEQHPEGVTN 182
           DEN+DAEIMGVV+QDALDSYE++IVVEL SD TEQM  NVDR+V+W  +W++QH  GVTN
Sbjct: 122 DENIDAEIMGVVMQDALDSYEKEIVVELTSDSTEQMENNVDRIVSWVELWQDQHHSGVTN 181

Query: 183 EL 184
           EL
Sbjct: 182 EL 183

>SAKL0F11330g Chr6 (882784..883410) [627 bp, 208 aa] {ON} similar to
           uniprot|Q12055 Saccharomyces cerevisiae YDL166C FAP7
           Essential nuclear protein involved in the oxidative
           stress response
          Length = 208

 Score =  268 bits (684), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 144/182 (79%)

Query: 3   ESRRLNPNILVTGTPGTGKSTTCELLLRNLPDYTYYNISDFAAKNKCYDGYDEARKSHIV 62
           E++R  PNILVTGTPG GKSTTCELL+R L DYTYYNISDFA ++KCYDGYDE RKSHIV
Sbjct: 2   ETKRSRPNILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDGYDEVRKSHIV 61

Query: 63  XXXXXXXXXXXXXHSGGNIIDWHVNDVFPERLIDLVAVLRCDSSVLFDRLNKREYHSSKI 122
                          G +I+DWHVNDVFPERLIDLV VLRCD+S+L+DRL+KR YH SKI
Sbjct: 62  DEDKLLDELEPLLRKGKSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHKRGYHDSKI 121

Query: 123 DENMDAEIMGVVLQDALDSYEEQIVVELQSDDTEQMAANVDRVVTWTTMWKEQHPEGVTN 182
           +EN+DAEIMGVV+QDA +SY ++IVVELQSD  E M ANVDR+V W  MW  QHP GVTN
Sbjct: 122 EENLDAEIMGVVMQDAAESYAQEIVVELQSDTVEHMDANVDRIVEWQEMWLNQHPNGVTN 181

Query: 183 EL 184
           EL
Sbjct: 182 EL 183

>Kpol_530.33 s530 complement(81184..81771) [588 bp, 195 aa] {ON}
           complement(81184..81771) [588 nt, 196 aa]
          Length = 195

 Score =  265 bits (676), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 124/181 (68%), Positives = 144/181 (79%)

Query: 4   SRRLNPNILVTGTPGTGKSTTCELLLRNLPDYTYYNISDFAAKNKCYDGYDEARKSHIVX 63
           SRRL PN+L+TGTPG GKST+CELL R L DY YYNISDFA ++ CY+GYDE RKSHIV 
Sbjct: 3   SRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEHDCYEGYDEDRKSHIVD 62

Query: 64  XXXXXXXXXXXXHSGGNIIDWHVNDVFPERLIDLVAVLRCDSSVLFDRLNKREYHSSKID 123
                         GG+I+DWHVNDVFPERLIDLV VLRCD+S+L+DRL+ R+YH SKI 
Sbjct: 63  EDKLLDELEPLLREGGSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHARKYHDSKIQ 122

Query: 124 ENMDAEIMGVVLQDALDSYEEQIVVELQSDDTEQMAANVDRVVTWTTMWKEQHPEGVTNE 183
           EN+DAEIMGVVLQDA +SY E+IVVELQSD TEQM ANVDR+V W  +W +QH +GVTNE
Sbjct: 123 ENLDAEIMGVVLQDAQESYAEEIVVELQSDTTEQMEANVDRIVDWVELWLKQHKKGVTNE 182

Query: 184 L 184
           L
Sbjct: 183 L 183

>ACL150W Chr3 (87745..88404) [660 bp, 219 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL166C (FAP7)
          Length = 219

 Score =  265 bits (677), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 124/185 (67%), Positives = 142/185 (76%)

Query: 3   ESRRLNPNILVTGTPGTGKSTTCELLLRNLPDYTYYNISDFAAKNKCYDGYDEARKSHIV 62
           +  R  PNILV+GTPG GKSTTCELL R+LPDY Y+NISDFA ++ CYDGYDEARKSHIV
Sbjct: 2   QQTRCRPNILVSGTPGCGKSTTCELLQRHLPDYQYFNISDFAREHNCYDGYDEARKSHIV 61

Query: 63  XXXXXXXXXXXXXHSGGNIIDWHVNDVFPERLIDLVAVLRCDSSVLFDRLNKREYHSSKI 122
                          GG I+DWHVND+FPERLIDLV VLRCD+++L DRL KR YHSSKI
Sbjct: 62  DEDRLLDELEPLLRRGGAIVDWHVNDIFPERLIDLVVVLRCDNAILHDRLQKRGYHSSKI 121

Query: 123 DENMDAEIMGVVLQDALDSYEEQIVVELQSDDTEQMAANVDRVVTWTTMWKEQHPEGVTN 182
           +EN+DAEIMGVVLQDALDSY  +IVVELQSDDTEQM  NVDR+  W   W  +HP+GV+N
Sbjct: 122 EENIDAEIMGVVLQDALDSYVREIVVELQSDDTEQMQQNVDRIAAWEANWVSEHPDGVSN 181

Query: 183 ELSAH 187
            L  H
Sbjct: 182 ALQQH 186

>TDEL0C02000 Chr3 complement(347930..348571) [642 bp, 213 aa] {ON}
           Anc_7.348 YDL166C
          Length = 213

 Score =  265 bits (676), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 143/182 (78%)

Query: 3   ESRRLNPNILVTGTPGTGKSTTCELLLRNLPDYTYYNISDFAAKNKCYDGYDEARKSHIV 62
           E RR  PN+L+TGTPG GKSTTCELL R LPDY YYNISDFA ++ C+DGYDEARKS+IV
Sbjct: 2   EPRRFKPNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEHDCHDGYDEARKSYIV 61

Query: 63  XXXXXXXXXXXXXHSGGNIIDWHVNDVFPERLIDLVAVLRCDSSVLFDRLNKREYHSSKI 122
                          G  I+DWHVNDVFPERLIDLV VLRCD+++L+DRL  R+YH +KI
Sbjct: 62  DEDKLLDELEPLLREGAAIVDWHVNDVFPERLIDLVVVLRCDNTILYDRLKSRDYHDAKI 121

Query: 123 DENMDAEIMGVVLQDALDSYEEQIVVELQSDDTEQMAANVDRVVTWTTMWKEQHPEGVTN 182
            EN+DAEIMGVVLQDA DSYE++IVVELQSD TEQM ANVDR+V+W  +W +QH +G TN
Sbjct: 122 QENLDAEIMGVVLQDATDSYEQEIVVELQSDSTEQMEANVDRIVSWEKLWLKQHKDGQTN 181

Query: 183 EL 184
           EL
Sbjct: 182 EL 183

>TPHA0F02950 Chr6 (649875..650525) [651 bp, 216 aa] {ON} Anc_7.348
           YDL166C
          Length = 216

 Score =  261 bits (668), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 125/182 (68%), Positives = 140/182 (76%)

Query: 4   SRRLNPNILVTGTPGTGKSTTCELLLRNLPDYTYYNISDFAAKNKCYDGYDEARKSHIVX 63
           SRR  PN+L+TGTPG GKSTTCELL R L DYTYYNISDFA ++ CYDG+DE RKSHIV 
Sbjct: 2   SRRYQPNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKEHNCYDGFDEGRKSHIVD 61

Query: 64  XXXXXXXXXXXXHSGGNIIDWHVNDVFPERLIDLVAVLRCDSSVLFDRLNKREYHSSKID 123
                         G  I+DWHVNDVFPERLIDLV VLRCD+SVL+DRL  R YH SKID
Sbjct: 62  EDKLLDELEPLLRKGKCIVDWHVNDVFPERLIDLVVVLRCDNSVLYDRLKSRGYHDSKID 121

Query: 124 ENMDAEIMGVVLQDALDSYEEQIVVELQSDDTEQMAANVDRVVTWTTMWKEQHPEGVTNE 183
           ENMDAEIMGVVLQDA +SY ++IVVELQSD TEQM  NVD++V W  +W +QH  GVTNE
Sbjct: 122 ENMDAEIMGVVLQDAQESYAQEIVVELQSDTTEQMDENVDKIVDWVELWIKQHKNGVTNE 181

Query: 184 LS 185
           LS
Sbjct: 182 LS 183

>Kwal_56.24635 s56 (1083026..1083706) [681 bp, 226 aa] {ON} YDL166C
           (FAP7) - Nuclear protein involved in oxidative stress
           response [contig 161] FULL
          Length = 226

 Score =  261 bits (666), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 125/183 (68%), Positives = 141/183 (77%)

Query: 4   SRRLNPNILVTGTPGTGKSTTCELLLRNLPDYTYYNISDFAAKNKCYDGYDEARKSHIVX 63
           S R +PNILVTGTPG GK++TCELL R L    YYNISDFA + KCYDGYDEARKSHIV 
Sbjct: 3   STRTSPNILVTGTPGCGKTSTCELLQRRLEGSKYYNISDFAKEYKCYDGYDEARKSHIVD 62

Query: 64  XXXXXXXXXXXXHSGGNIIDWHVNDVFPERLIDLVAVLRCDSSVLFDRLNKREYHSSKID 123
                        +GG I+DWHVNDVFPERLIDLV VLR D+S LFDRL+KR YH +KI 
Sbjct: 63  EDKLLDELEPLLRAGGAIVDWHVNDVFPERLIDLVVVLRTDNSALFDRLSKRGYHEAKIQ 122

Query: 124 ENMDAEIMGVVLQDALDSYEEQIVVELQSDDTEQMAANVDRVVTWTTMWKEQHPEGVTNE 183
           EN+DAEIMGVV+ DA DSY ++IVVELQSD TEQM  NVDR+VTW   W+EQHPEGVTNE
Sbjct: 123 ENIDAEIMGVVMHDARDSYAQEIVVELQSDTTEQMDENVDRIVTWRDAWREQHPEGVTNE 182

Query: 184 LSA 186
           L+ 
Sbjct: 183 LNG 185

>KLLA0D12386g Chr4 complement(1054141..1054776) [636 bp, 211 aa]
           {ON} similar to uniprot|Q12055 Saccharomyces cerevisiae
           YDL166C FAP7 Essential nuclear protein involved in the
           oxidative stress response
          Length = 211

 Score =  260 bits (664), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 144/182 (79%)

Query: 3   ESRRLNPNILVTGTPGTGKSTTCELLLRNLPDYTYYNISDFAAKNKCYDGYDEARKSHIV 62
           E  R  PNI+V+GTPG GKSTTCELL R LP+YTYYNISDFA ++ CYDGYD+ARKS+IV
Sbjct: 2   EPVRFKPNIIVSGTPGCGKSTTCELLSRRLPEYTYYNISDFAKEHDCYDGYDDARKSNIV 61

Query: 63  XXXXXXXXXXXXXHSGGNIIDWHVNDVFPERLIDLVAVLRCDSSVLFDRLNKREYHSSKI 122
                          GG IIDWHVNDVFPERL+DLV VLRCD+ +L+DRLNKR YH++KI
Sbjct: 62  DDDKLLDELEPLLRKGGCIIDWHVNDVFPERLVDLVVVLRCDNGILYDRLNKRGYHNAKI 121

Query: 123 DENMDAEIMGVVLQDALDSYEEQIVVELQSDDTEQMAANVDRVVTWTTMWKEQHPEGVTN 182
           +ENMDAEIMGVVLQDA DSY ++IVVELQSD TE+M  NVDR++ W  +W +QH +GVTN
Sbjct: 122 EENMDAEIMGVVLQDAHDSYAQEIVVELQSDTTEEMDKNVDRIIAWQEIWLKQHKKGVTN 181

Query: 183 EL 184
           EL
Sbjct: 182 EL 183

>KLTH0H01298g Chr8 complement(124206..124850) [645 bp, 214 aa] {ON}
           similar to uniprot|Q12055 Saccharomyces cerevisiae
           YDL166C FAP7 Essential nuclear protein involved in the
           oxidative stress response
          Length = 214

 Score =  255 bits (651), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 121/199 (60%), Positives = 146/199 (73%)

Query: 4   SRRLNPNILVTGTPGTGKSTTCELLLRNLPDYTYYNISDFAAKNKCYDGYDEARKSHIVX 63
           S R  PNILVTGTPG GK++TCELL R L D  YYNISDFA +++CYDGYDEARKSHIV 
Sbjct: 3   STRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNISDFAQQHECYDGYDEARKSHIVD 62

Query: 64  XXXXXXXXXXXXHSGGNIIDWHVNDVFPERLIDLVAVLRCDSSVLFDRLNKREYHSSKID 123
                         GG I+DWHVND+FPERLIDLV VLR D++VL+DRL  R YH +KI 
Sbjct: 63  EDRLLDELEPLMRKGGAIVDWHVNDIFPERLIDLVVVLRTDNTVLYDRLKSRGYHEAKIQ 122

Query: 124 ENMDAEIMGVVLQDALDSYEEQIVVELQSDDTEQMAANVDRVVTWTTMWKEQHPEGVTNE 183
           EN+DAEIMGVV+QDA DSYE++IVVELQSD  +QM  NVDR+ +W+  W EQ+P+GVTNE
Sbjct: 123 ENIDAEIMGVVIQDAQDSYEKEIVVELQSDTADQMDENVDRIASWSAAWLEQNPKGVTNE 182

Query: 184 LSAHQAKKERNDESEEGDF 202
           L    + +E   + E G +
Sbjct: 183 LVERGSDEEDGTDEEGGSY 201

>TBLA0E00520 Chr5 (95049..95678) [630 bp, 209 aa] {ON} Anc_7.348
           YDL166C
          Length = 209

 Score =  254 bits (648), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 144/182 (79%)

Query: 3   ESRRLNPNILVTGTPGTGKSTTCELLLRNLPDYTYYNISDFAAKNKCYDGYDEARKSHIV 62
           +SRR  PN+L++GTPGTGKS+TCELL R L DY Y NISDFA +  CYDG+D+ RKSHIV
Sbjct: 2   KSRRYLPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKGRKSHIV 61

Query: 63  XXXXXXXXXXXXXHSGGNIIDWHVNDVFPERLIDLVAVLRCDSSVLFDRLNKREYHSSKI 122
                          G NI+DWHVNDVFPERLIDLV +LR D+SVL+DRL  R+YH +K+
Sbjct: 62  DEDKLLDELEPILREGHNIVDWHVNDVFPERLIDLVVILRADNSVLYDRLQNRKYHDAKV 121

Query: 123 DENMDAEIMGVVLQDALDSYEEQIVVELQSDDTEQMAANVDRVVTWTTMWKEQHPEGVTN 182
            EN+DAEIMGVVLQDA+DSY ++IV+ELQS++TE+M +NVDR+V+W  +WK+QH +GVTN
Sbjct: 122 QENLDAEIMGVVLQDAIDSYAQEIVIELQSNNTEEMTSNVDRIVSWVELWKKQHADGVTN 181

Query: 183 EL 184
           EL
Sbjct: 182 EL 183

>Ecym_4725 Chr4 complement(1419236..1419940) [705 bp, 234 aa] {ON}
           similar to Ashbya gossypii ACL150W
          Length = 234

 Score =  253 bits (645), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 125/196 (63%), Positives = 143/196 (72%), Gaps = 3/196 (1%)

Query: 3   ESRRLNPNILVTGTPGTGKSTTCELLLRNLPDYTYYNISDFAAKNKCYDGYDEARKSHIV 62
           +S RL PNI+VTGTPG GK+TTCELL R L D  YYNISDFA ++ CY+GYDE RKSHIV
Sbjct: 16  DSTRLRPNIIVTGTPGCGKTTTCELLQRRLDDCRYYNISDFAKEHDCYEGYDEGRKSHIV 75

Query: 63  XXXXXXXXXXXXXHSGGNIIDWHVNDVFPERLIDLVAVLRCDSSVLFDRLNKREYHSSKI 122
                          GG IIDWHVNDVFPERLIDLV VLRCD+S L+DRL+KR YH +KI
Sbjct: 76  DEDKLLDELEPLLRKGGAIIDWHVNDVFPERLIDLVVVLRCDNSTLYDRLHKRGYHDAKI 135

Query: 123 DENMDAEIMGVVLQDALDSYEEQIVVELQSDDTEQMAANVDRVVTWTTMWKEQHPEGVTN 182
           +EN+DAEIMGVVLQDA+DSY   IVVELQS+   QM  NV R+V W + W  QHP GVTN
Sbjct: 136 EENIDAEIMGVVLQDAMDSYVHDIVVELQSNTANQMEENVGRIVAWESSWVSQHPTGVTN 195

Query: 183 ELSAHQAKKERNDESE 198
           EL   Q   + NDES+
Sbjct: 196 EL---QQDYQSNDESD 208

>Smik_4.72 Chr4 complement(140216..140809) [594 bp, 197 aa] {ON}
           YDL166C (REAL)
          Length = 197

 Score =  248 bits (634), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 117/181 (64%), Positives = 135/181 (74%)

Query: 3   ESRRLNPNILVTGTPGTGKSTTCELLLRNLPDYTYYNISDFAAKNKCYDGYDEARKSHIV 62
           ESRR  PNI+VTGTPG GKS+ CELL   L DY YYNISDFA  + C++GYDE RKSHIV
Sbjct: 2   ESRRYGPNIIVTGTPGCGKSSMCELLKNKLKDYKYYNISDFAKDHDCFEGYDEGRKSHIV 61

Query: 63  XXXXXXXXXXXXXHSGGNIIDWHVNDVFPERLIDLVAVLRCDSSVLFDRLNKREYHSSKI 122
                          G +I+DWHVND+FPERLIDLV VLRCD+S L+ RL+ R YH SKI
Sbjct: 62  DEDKLLDVLEPLLRQGNSIVDWHVNDIFPERLIDLVVVLRCDNSYLYSRLHARGYHDSKI 121

Query: 123 DENMDAEIMGVVLQDALDSYEEQIVVELQSDDTEQMAANVDRVVTWTTMWKEQHPEGVTN 182
           +EN+DAEIMGVV QDA++SYE  IVVELQSD  E M +NV R++TW  MW EQHPEGVTN
Sbjct: 122 EENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMESNVSRIITWEKMWLEQHPEGVTN 181

Query: 183 E 183
           E
Sbjct: 182 E 182

>YDL166C Chr4 complement(163449..164042) [594 bp, 197 aa] {ON}
           FAP7Essential NTPase required for small ribosome subunit
           synthesis, mediates processing of the 20S pre-rRNA at
           site D in the cytoplasm but associates only transiently
           with 43S preribosomes via Rps14p, may be the
           endonuclease for site D
          Length = 197

 Score =  247 bits (630), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 117/181 (64%), Positives = 134/181 (74%)

Query: 3   ESRRLNPNILVTGTPGTGKSTTCELLLRNLPDYTYYNISDFAAKNKCYDGYDEARKSHIV 62
           E+RR  PNI+VTGTPG GKS+TCE L   L DY YYNISDFA  N C++GYDE RKSHIV
Sbjct: 2   EARRYGPNIIVTGTPGCGKSSTCEFLKNKLKDYKYYNISDFAKDNDCFEGYDEGRKSHIV 61

Query: 63  XXXXXXXXXXXXXHSGGNIIDWHVNDVFPERLIDLVAVLRCDSSVLFDRLNKREYHSSKI 122
                          G +I+DWHVNDVFPERLIDLV VLRCD+S L+ RL+ R YH SKI
Sbjct: 62  DEDKLLDMLEPLLRQGNSIVDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSKI 121

Query: 123 DENMDAEIMGVVLQDALDSYEEQIVVELQSDDTEQMAANVDRVVTWTTMWKEQHPEGVTN 182
           +EN+DAEIMGVV QDA++SYE  IVVELQSD  E M +NV R+V W  MW EQHP+GVTN
Sbjct: 122 EENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVSRIVAWEKMWLEQHPDGVTN 181

Query: 183 E 183
           E
Sbjct: 182 E 182

>Suva_4.80 Chr4 complement(150992..151612) [621 bp, 206 aa] {ON}
           YDL166C (REAL)
          Length = 206

 Score =  247 bits (630), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 136/187 (72%)

Query: 3   ESRRLNPNILVTGTPGTGKSTTCELLLRNLPDYTYYNISDFAAKNKCYDGYDEARKSHIV 62
           ESRR  PNI+VTGTPG GKS+TCELL   L  Y YYNISDFA  N C++GYDE RKSHIV
Sbjct: 2   ESRRYGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEGYDEGRKSHIV 61

Query: 63  XXXXXXXXXXXXXHSGGNIIDWHVNDVFPERLIDLVAVLRCDSSVLFDRLNKREYHSSKI 122
                          G +IIDWHVNDVFPERLIDLV VLRCD+S L+ RL+ R YH SKI
Sbjct: 62  DEDKLLDTLEPLMRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSKLYSRLHARGYHDSKI 121

Query: 123 DENMDAEIMGVVLQDALDSYEEQIVVELQSDDTEQMAANVDRVVTWTTMWKEQHPEGVTN 182
           +EN+DAEIMGVV QDA+DSYE  IVVELQSD  + + +NV R++ W  MW EQHPEGVTN
Sbjct: 122 EENLDAEIMGVVKQDAVDSYEPHIVVELQSDTKQDIVSNVARIIAWEKMWLEQHPEGVTN 181

Query: 183 ELSAHQA 189
           E    ++
Sbjct: 182 EYQGGRS 188

>Skud_4.91 Chr4 complement(159116..159700) [585 bp, 194 aa] {ON}
           YDL166C (REAL)
          Length = 194

 Score =  241 bits (616), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 121/196 (61%), Positives = 138/196 (70%), Gaps = 3/196 (1%)

Query: 3   ESRRLNPNILVTGTPGTGKSTTCELLLRNLPDYTYYNISDFAAKNKCYDGYDEARKSHIV 62
           E RR  PNI+VTGTPG GKS+TCELL   L  Y YYNISDFA  N C++ YDEARKSHIV
Sbjct: 2   ELRRFGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEAYDEARKSHIV 61

Query: 63  XXXXXXXXXXXXXHSGGNIIDWHVNDVFPERLIDLVAVLRCDSSVLFDRLNKREYHSSKI 122
                          G +IIDWHVNDVFPERLIDLV VLRCD+S L+ RL+ R YH SKI
Sbjct: 62  DEDKLLDKLEPLLRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSKI 121

Query: 123 DENMDAEIMGVVLQDALDSYEEQIVVELQSDDTEQMAANVDRVVTWTTMWKEQHPEGVTN 182
           +EN+DAEIMGVV QDA+DSYE  IVVELQ D  E M +NV R+V W  MW EQH +GVTN
Sbjct: 122 EENLDAEIMGVVKQDAVDSYEPHIVVELQGDTKEDMVSNVARIVAWEKMWLEQHSDGVTN 181

Query: 183 ELSAHQAKKERNDESE 198
           E   +Q     ++ESE
Sbjct: 182 E---YQGPHGDDEESE 194

>CAGL0I03366g Chr9 complement(287811..288449) [639 bp, 212 aa] {ON}
           highly similar to uniprot|Q12055 Saccharomyces
           cerevisiae YDL166c
          Length = 212

 Score =  241 bits (615), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 119/184 (64%), Positives = 138/184 (75%), Gaps = 1/184 (0%)

Query: 1   MGESRRLNPNILVTGTPGTGKSTTCELLLRNLPDYTYYNISDFAAKNKCYDGYDEARKSH 60
           MG SRR +PNI+VTGTPG GKSTTCELL R L  Y YYNIS+FA ++KCYDGYDE RKSH
Sbjct: 1   MG-SRRFHPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAEEHKCYDGYDEGRKSH 59

Query: 61  IVXXXXXXXXXXXXXHSGGNIIDWHVNDVFPERLIDLVAVLRCDSSVLFDRLNKREYHSS 120
           IV               G +IIDWHVNDVFPERLIDLV VLR ++  L+DRL  R YH S
Sbjct: 60  IVDEDKLLDELEPLLLEGKSIIDWHVNDVFPERLIDLVVVLRSENGKLYDRLKARGYHDS 119

Query: 121 KIDENMDAEIMGVVLQDALDSYEEQIVVELQSDDTEQMAANVDRVVTWTTMWKEQHPEGV 180
           KI+EN+DAEIMGVVLQDA +SYE +IVVELQS+ TE M  NVDR+ TW   W E+H +GV
Sbjct: 120 KIEENLDAEIMGVVLQDAQESYEPEIVVELQSNTTEDMENNVDRINTWVDNWVEEHKDGV 179

Query: 181 TNEL 184
           ++EL
Sbjct: 180 SSEL 183

>YKL024C Chr11 complement(392526..393140) [615 bp, 204 aa] {ON}
          URA6Uridylate kinase, catalyzes the seventh enzymatic
          step in the de novo biosynthesis of pyrimidines,
          converting uridine monophosphate (UMP) into
          uridine-5'-diphosphate (UDP)
          Length = 204

 Score = 33.1 bits (74), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 3/31 (9%)

Query: 11 ILVTGTPGTGKSTTCELLLRNLPDYTYYNIS 41
          I V G PG GK T CE L++   DY++ ++S
Sbjct: 19 IFVLGGPGAGKGTQCEKLVK---DYSFVHLS 46

>Ecym_4107 Chr4 complement(215380..215958) [579 bp, 192 aa] {ON}
          similar to Ashbya gossypii AER309W
          Length = 192

 Score = 33.1 bits (74), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 29/62 (46%), Gaps = 2/62 (3%)

Query: 1  MGESRRLNPNILVTGTPGTGKSTTCELLLRNLPDYTYYNISDFAAKNKCYDGYDEARKSH 60
          M   R +   I+V+G  GTGKST  + L    PD   +++S    K +   G  E +  H
Sbjct: 1  MNFVRAMPRPIVVSGPSGTGKSTLLKKLFAEFPDTFGFSVSSTTRKPRV--GEVEGKDYH 58

Query: 61 IV 62
           V
Sbjct: 59 FV 60

>TBLA0E04260 Chr5 (1083669..1087277) [3609 bp, 1202 aa] {ON}
           Anc_8.242 YER176W
          Length = 1202

 Score = 33.5 bits (75), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 53/114 (46%), Gaps = 10/114 (8%)

Query: 12  LVTGTPGTGKSTTC-ELLLRNLPDYTYYNISDFAAKNKCYDGYDE--ARKSHIVXXXXXX 68
           +V G PGTGK++T  E++L+ + ++  + I   AA N   D   E   + S+I       
Sbjct: 747 IVQGPPGTGKTSTIEEIILQMIKNFNSFPILVVAASNIAIDNIAEKFVKNSNIRILRIVS 806

Query: 69  XXXXX---XXHSGGNIIDWH-VNDVFPERLIDLVAVLRCDSSVLFDRLNKREYH 118
                     H    I   H V D  PE  ++ ++ L+   + LF  ++K+EY+
Sbjct: 807 EAKESEYNKEHPLAPICLHHIVYDQLPENALNTLSKLK---NGLFSSISKKEYN 857

>Smik_11.229 Chr11 complement(379526..380140) [615 bp, 204 aa]
          {ON} YKL024C (REAL)
          Length = 204

 Score = 32.0 bits (71), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%), Gaps = 3/31 (9%)

Query: 11 ILVTGTPGTGKSTTCELLLRNLPDYTYYNIS 41
          I V G PG GK T CE L++   D+++ ++S
Sbjct: 19 IFVLGGPGAGKGTQCERLVK---DFSFVHLS 46

>TPHA0K01750 Chr11 (371736..372203) [468 bp, 155 aa] {ON} Anc_4.84
           YGR148C
          Length = 155

 Score = 31.6 bits (70), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 9/28 (32%), Positives = 20/28 (71%)

Query: 164 RVVTWTTMWKEQHPEGVTNELSAHQAKK 191
           R + WT ++++ H +G+T E+S  +++K
Sbjct: 47  RRIAWTVLYRKSHKKGITEEVSKKRSRK 74

>Skud_11.204 Chr11 complement(373437..374051,374060..374284) [840
           bp, 279 aa] {ON} YKL024C (REAL)
          Length = 279

 Score = 32.0 bits (71), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%), Gaps = 3/31 (9%)

Query: 11  ILVTGTPGTGKSTTCELLLRNLPDYTYYNIS 41
           + V G PG GK T CE L++   DY++ ++S
Sbjct: 94  VFVLGGPGAGKGTQCEKLVK---DYSFVHLS 121

>KLTH0C00528g Chr3 (55308..56156) [849 bp, 282 aa] {ON} highly
           similar to uniprot|P15700 Saccharomyces cerevisiae
           YKL024C URA6
          Length = 282

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 3/53 (5%)

Query: 11  ILVTGTPGTGKSTTCELLLRNLPDYTYYNISDF--AAKNKCYDGYDEARKSHI 61
           I V G PG GK T C  L+R+   + + +  D   A +N+    Y E  K +I
Sbjct: 96  IFVLGGPGAGKGTQCANLVRDF-QFVHLSAGDLLRAEQNRSNSKYGELIKHYI 147

>ZYRO0A13310g Chr1 complement(1050131..1051678) [1548 bp, 515 aa]
           {OFF} similar to uniprot|P38126 Saccharomyces cerevisiae
           YBR186W PCH2 Nucleolar component of the pachytene
           checkpoint which prevents chromosome segregation when
           recombination and chromosome synapsis are defective also
           represses meiotic interhomolog recombination in the rDNA
          Length = 515

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 17/25 (68%)

Query: 8   NPNILVTGTPGTGKSTTCELLLRNL 32
           N  +LV G PGTGK+T C+ L + L
Sbjct: 304 NKLLLVQGPPGTGKTTICKALCQKL 328

>Zrou_YGOB_A13310g Chr1
           complement(1049931..1050068,1050140..1051678) [1677 bp,
           558 aa] {ON} ANNOTATED BY YGOB -
          Length = 558

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 17/25 (68%)

Query: 8   NPNILVTGTPGTGKSTTCELLLRNL 32
           N  +LV G PGTGK+T C+ L + L
Sbjct: 304 NKLLLVQGPPGTGKTTICKALCQKL 328

>Kpol_1026.6 s1026 (11817..12284) [468 bp, 155 aa] {ON}
           (11817..12284) [468 nt, 156 aa]
          Length = 155

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 9/28 (32%), Positives = 19/28 (67%)

Query: 164 RVVTWTTMWKEQHPEGVTNELSAHQAKK 191
           R + WT +++  H +G+T E+S  +++K
Sbjct: 47  RRIAWTVLYRRHHKKGITEEVSKKRSRK 74

>NCAS0A01790 Chr1 (347668..348135) [468 bp, 155 aa] {ON} Anc_4.84
           YGL031C
          Length = 155

 Score = 30.8 bits (68), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 18/28 (64%)

Query: 164 RVVTWTTMWKEQHPEGVTNELSAHQAKK 191
           R V WT +++  H +G+T E+S  + +K
Sbjct: 47  RRVAWTVLYRRHHKKGITEEVSKKRTRK 74

>NCAS0C05570 Chr3 (1131003..1131470) [468 bp, 155 aa] {ON} Anc_4.84
           YGL031C
          Length = 155

 Score = 30.8 bits (68), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 18/28 (64%)

Query: 164 RVVTWTTMWKEQHPEGVTNELSAHQAKK 191
           R V WT +++  H +G+T E+S  + +K
Sbjct: 47  RRVAWTVLYRRHHKKGITEEVSKKRTRK 74

>Kwal_47.18430 s47 (821910..822557) [648 bp, 215 aa] {ON} YDR454C
          (GUK1) - guanylate kinase [contig 195] FULL
          Length = 215

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 19/31 (61%)

Query: 11 ILVTGTPGTGKSTTCELLLRNLPDYTYYNIS 41
          I+V+G  GTGKST    L +  PD   +++S
Sbjct: 35 IVVSGPSGTGKSTLLNKLFQEFPDTFGFSVS 65

>Kwal_27.12113 s27 complement(1090541..1092061) [1521 bp, 506 aa]
           {ON} YBR186W (PCH2) - Putative ATPase [contig 23] FULL
          Length = 506

 Score = 31.2 bits (69), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 17/25 (68%)

Query: 8   NPNILVTGTPGTGKSTTCELLLRNL 32
           N  +LV G PGTGK+T C+ L + L
Sbjct: 285 NKILLVHGPPGTGKTTICKALCQKL 309

>TBLA0C00480 Chr3 (88992..90074) [1083 bp, 360 aa] {ON} Anc_8.101
          YFR007W
          Length = 360

 Score = 31.2 bits (69), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 13/23 (56%), Positives = 16/23 (69%)

Query: 10 NILVTGTPGTGKSTTCELLLRNL 32
          NI++ G PG+GKST  E L  NL
Sbjct: 26 NIIIVGPPGSGKSTIAEKLSANL 48

>SAKL0H09658g Chr8 (828107..829639) [1533 bp, 510 aa] {OFF} similar
           to uniprot|P38126 Saccharomyces cerevisiae YBR186W PCH2
           Nucleolar component of the pachytene checkpoint which
           prevents chromosome segregation when recombination and
           chromosome synapsis are defective also represses meiotic
           interhomolog recombination in the rDNA
          Length = 510

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 17/25 (68%)

Query: 8   NPNILVTGTPGTGKSTTCELLLRNL 32
           N  +LV G PGTGK+T C+ L + L
Sbjct: 287 NKLLLVHGPPGTGKTTVCKALCQKL 311

>Ecym_7051 Chr7 complement(103898..104056,104172..105644) [1632 bp,
           543 aa] {ON} similar to Ashbya gossypii AEL258W
          Length = 543

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 21/32 (65%), Gaps = 3/32 (9%)

Query: 1   MGESRRLNPNILVTGTPGTGKSTTCELLLRNL 32
           + +S RL   +L+ G PGTGK+T C+ L + L
Sbjct: 280 IADSNRL---LLIHGPPGTGKTTICKALCQKL 308

>ZYRO0A02750g Chr1 (222495..223037) [543 bp, 180 aa] {ON} similar
          to uniprot|Q03786 Saccharomyces cerevisiae YDR248C
          Hypothetical ORF
          Length = 180

 Score = 30.4 bits (67), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 18/24 (75%)

Query: 8  NPNILVTGTPGTGKSTTCELLLRN 31
          N  I++ GT GTGKST  ++L++N
Sbjct: 3  NKVIVLAGTAGTGKSTVADILIKN 26

>NDAI0D03720 Chr4 (883565..884035) [471 bp, 156 aa] {ON} Anc_4.84
           YGL031C
          Length = 156

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 9/28 (32%), Positives = 19/28 (67%)

Query: 164 RVVTWTTMWKEQHPEGVTNELSAHQAKK 191
           R V WT +++  H +G+T E++  +++K
Sbjct: 47  RRVAWTVLYRRHHKKGITEEVAKKRSRK 74

>Smik_7.256 Chr7 complement(428915..429292) [378 bp, 126 aa] {ON}
           YGR148C (REAL)
          Length = 126

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 8/28 (28%), Positives = 20/28 (71%)

Query: 164 RVVTWTTMWKEQHPEGVTNELSAHQAKK 191
           R + WT ++++ H +G+T E++  +++K
Sbjct: 47  RRIAWTVLFRKHHKKGITEEVAKKRSRK 74

>KNAG0C02790 Chr3 complement(544595..545152) [558 bp, 185 aa] {ON}
          Anc_5.572 YDR454C
          Length = 185

 Score = 30.4 bits (67), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 11 ILVTGTPGTGKSTTCELLLRNLPDYTYYNIS 41
          I+++G  GTGKST  + LL   PD   +++S
Sbjct: 5  IVISGPSGTGKSTLLKKLLAEYPDTFGFSVS 35

>Sklu_YGOB_09658g Chr8 (828107..829591,829654..829791) [1623 bp, 540
           aa] {ON} ANNOTATED BY YGOB -
          Length = 540

 Score = 30.8 bits (68), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 17/25 (68%)

Query: 8   NPNILVTGTPGTGKSTTCELLLRNL 32
           N  +LV G PGTGK+T C+ L + L
Sbjct: 287 NKLLLVHGPPGTGKTTVCKALCQKL 311

>YBR186W Chr2 (600553..602103,602217..602360) [1695 bp, 564 aa] {ON}
            PCH2Nucleolar component of the pachytene checkpoint,
           which prevents chromosome segregation when recombination
           and chromosome synapsis are defective; also represses
           meiotic interhomolog recombination in the rDNA; required
           for meiotic double-stranded break formation
          Length = 564

 Score = 30.8 bits (68), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 17/25 (68%)

Query: 8   NPNILVTGTPGTGKSTTCELLLRNL 32
           N  +LV G PGTGK+T C+ L + L
Sbjct: 307 NKLLLVHGPPGTGKTTLCKALCQKL 331

>NDAI0H00530 Chr8 complement(122504..122971) [468 bp, 155 aa] {ON}
           Anc_4.84 YGL031C
          Length = 155

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 9/28 (32%), Positives = 19/28 (67%)

Query: 164 RVVTWTTMWKEQHPEGVTNELSAHQAKK 191
           R V WT +++  H +G+T E++  +++K
Sbjct: 47  RRVAWTVLYRRHHKKGITEEVAKKRSRK 74

>CAGL0A01562g Chr1 (157645..158112) [468 bp, 155 aa] {ON} highly
           similar to uniprot|P24000 Saccharomyces cerevisiae
           YGR148c RPL30B or uniprot|P04449 Saccharomyces
           cerevisiae YGL031c RPL30A
          Length = 155

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 9/28 (32%), Positives = 19/28 (67%)

Query: 164 RVVTWTTMWKEQHPEGVTNELSAHQAKK 191
           R V WT +++  H +G+T E++  +++K
Sbjct: 47  RRVAWTVLYRRHHKKGITEEVAKKRSRK 74

>ABR139W Chr2 (658141..661953) [3813 bp, 1270 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR270W (YTA7)
          Length = 1270

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 22/40 (55%)

Query: 1   MGESRRLNPNILVTGTPGTGKSTTCELLLRNLPDYTYYNI 40
           + ++R + P +L+TG  G G+      LL +L DY   N+
Sbjct: 721 LDQARTVKPKLLITGPAGNGQQYIGSALLHHLEDYNIQNL 760

>Skud_2.312 Chr2 (567925..569382,569566..569712) [1605 bp, 534 aa]
           {ON} YBR186W (REAL)
          Length = 534

 Score = 30.8 bits (68), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 17/25 (68%)

Query: 8   NPNILVTGTPGTGKSTTCELLLRNL 32
           N  +LV G PGTGK+T C+ L + L
Sbjct: 309 NKLLLVHGPPGTGKTTLCKALCQKL 333

>Smik_2.326 Chr2 (586919..588469,588545..588688) [1695 bp, 564 aa]
           {ON} YBR186W (REAL)
          Length = 564

 Score = 30.8 bits (68), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 17/25 (68%)

Query: 8   NPNILVTGTPGTGKSTTCELLLRNL 32
           N  +LV G PGTGK+T C+ L + L
Sbjct: 307 NKLLLVHGPPGTGKTTLCKALCQKL 331

>TBLA0A08930 Chr1 complement(2190651..2191118) [468 bp, 155 aa] {ON}
           Anc_4.84 YGR148C
          Length = 155

 Score = 30.0 bits (66), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 9/28 (32%), Positives = 18/28 (64%)

Query: 164 RVVTWTTMWKEQHPEGVTNELSAHQAKK 191
           R + WT +++  H +G+T E+S  + +K
Sbjct: 47  RKIAWTVLYRRHHKKGITEEVSKKRTRK 74

>Ecym_1421 Chr1 complement(873870..874331) [462 bp, 153 aa] {ON}
           similar to Ashbya gossypii AFR477C
          Length = 153

 Score = 30.0 bits (66), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 8/28 (28%), Positives = 20/28 (71%)

Query: 164 RVVTWTTMWKEQHPEGVTNELSAHQAKK 191
           R ++WT +++  H +G+T E++  +++K
Sbjct: 47  RRISWTVLYRRHHKKGITEEVAKKRSRK 74

>Suva_4.437 Chr4 (770299..771957) [1659 bp, 552 aa] {ON} YBR186W
           (REAL)
          Length = 552

 Score = 30.8 bits (68), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 17/25 (68%)

Query: 8   NPNILVTGTPGTGKSTTCELLLRNL 32
           N  +LV G PGTGK+T C+ L + L
Sbjct: 308 NKLLLVHGPPGTGKTTLCKALCQKL 332

>Kpol_1048.53 s1048 (151366..153024) [1659 bp, 552 aa] {ON}
           (151366..153024) [1659 nt, 553 aa]
          Length = 552

 Score = 30.8 bits (68), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 17/25 (68%)

Query: 8   NPNILVTGTPGTGKSTTCELLLRNL 32
           N  +LV G PGTGK+T C+ L + L
Sbjct: 301 NKLLLVHGPPGTGKTTVCKALCQKL 325

>KLTH0E12936g Chr5 complement(1145066..1146700) [1635 bp, 544 aa]
           {ON} similar to uniprot|P38126 Saccharomyces cerevisiae
           YBR186W PCH2 Nucleolar component of the pachytene
           checkpoint which prevents chromosome segregation when
           recombination and chromosome synapsis are defective also
           represses meiotic interhomolog recombination in the rDNA
          Length = 544

 Score = 30.8 bits (68), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 16/25 (64%)

Query: 8   NPNILVTGTPGTGKSTTCELLLRNL 32
           N  +L+ G PGTGK+T C  L + L
Sbjct: 294 NKILLIHGPPGTGKTTVCRALCQKL 318

>NDAI0C05170 Chr3 complement(1201173..1201745) [573 bp, 190 aa]
          {ON} Anc_8.478 YDR248C
          Length = 190

 Score = 30.0 bits (66), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 16/22 (72%)

Query: 11 ILVTGTPGTGKSTTCELLLRNL 32
          I++ GT GTGKST  +L+LR  
Sbjct: 14 IVLAGTAGTGKSTIADLILRTF 35

>Suva_7.439 Chr7 complement(757803..758270) [468 bp, 155 aa] {ON}
           YGR148C (REAL)
          Length = 155

 Score = 30.0 bits (66), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 8/28 (28%), Positives = 20/28 (71%)

Query: 164 RVVTWTTMWKEQHPEGVTNELSAHQAKK 191
           R + WT ++++ H +G+T E++  +++K
Sbjct: 47  RRIAWTVLFRKHHKKGITEEVAKKRSRK 74

>Cgla_YGOB_M06435 Chr13 (668126..669628,669749..669895) [1650 bp,
           549 aa] {ON} ANNOTATED BY YGOB -
          Length = 549

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 16/25 (64%)

Query: 8   NPNILVTGTPGTGKSTTCELLLRNL 32
           N  IL+ G PGTGK+T C+ L   L
Sbjct: 297 NKMILLHGPPGTGKTTLCKALCNKL 321

>CAGL0M06435g Chr13 (668126..669691) [1566 bp, 521 aa] {OFF} similar
           to uniprot|P38126 Saccharomyces cerevisiae YBR186w PCH2
          Length = 521

 Score = 30.4 bits (67), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 16/25 (64%)

Query: 8   NPNILVTGTPGTGKSTTCELLLRNL 32
           N  IL+ G PGTGK+T C+ L   L
Sbjct: 297 NKMILLHGPPGTGKTTLCKALCNKL 321

>Suva_7.247 Chr7 complement(428086..428553) [468 bp, 155 aa] {ON}
           YGR148C (REAL)
          Length = 155

 Score = 29.6 bits (65), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 8/28 (28%), Positives = 20/28 (71%)

Query: 164 RVVTWTTMWKEQHPEGVTNELSAHQAKK 191
           R + WT ++++ H +G+T E++  +++K
Sbjct: 47  RRIAWTVLFRKHHKKGITEEVAKKRSRK 74

>Kwal_14.2299 s14 complement(696773..697240) [468 bp, 155 aa] {ON}
           YGR148C (RPL24B) - Ribosomal protein L24B (rp29) (YL21)
           (L30B) [contig 226] FULL
          Length = 155

 Score = 29.6 bits (65), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 8/28 (28%), Positives = 19/28 (67%)

Query: 164 RVVTWTTMWKEQHPEGVTNELSAHQAKK 191
           R + WT +++  H +G+T E++  +++K
Sbjct: 47  RRIAWTVLYRRHHKKGITEEVAKKRSRK 74

>Smik_7.255 Chr7 complement(428825..429292) [468 bp, 155 aa] {ON}
           YGL031C (REAL)
          Length = 155

 Score = 29.6 bits (65), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 8/28 (28%), Positives = 20/28 (71%)

Query: 164 RVVTWTTMWKEQHPEGVTNELSAHQAKK 191
           R + WT ++++ H +G+T E++  +++K
Sbjct: 47  RRIAWTVLFRKHHKKGITEEVAKKRSRK 74

>TPHA0I01820 Chr9 (404763..406295,406384..406530) [1680 bp, 559 aa]
           {ON} Anc_8.558 YBR186W
          Length = 559

 Score = 30.4 bits (67), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 23/36 (63%), Gaps = 5/36 (13%)

Query: 2   GESRRLNPN-----ILVTGTPGTGKSTTCELLLRNL 32
           G++++L  N     IL+ G PGTGK+T C+ L + +
Sbjct: 291 GKNQQLTNNNSNRLILLHGPPGTGKTTLCKALFQKI 326

>KLTH0H09328g Chr8 complement(800260..800727) [468 bp, 155 aa] {ON}
           similar to uniprot|P04449 Saccharomyces cerevisiae
           YGL031C RPL24A and to uniprot|P24000 Saccharomyces
           cerevisiae YGR148C RPL24B
          Length = 155

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 8/28 (28%), Positives = 19/28 (67%)

Query: 164 RVVTWTTMWKEQHPEGVTNELSAHQAKK 191
           R + WT +++  H +G+T E++  +++K
Sbjct: 47  RRIAWTVLYRRHHKKGITEEVAKKRSRK 74

>Skud_7.255 Chr7 complement(439951..440418) [468 bp, 155 aa] {ON}
           YGL031C (REAL)
          Length = 155

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 8/28 (28%), Positives = 20/28 (71%)

Query: 164 RVVTWTTMWKEQHPEGVTNELSAHQAKK 191
           R + WT ++++ H +G+T E++  +++K
Sbjct: 47  RRIAWTVLFRKHHKKGITEEVAKKRSRK 74

>YGL031C Chr7 complement(437467..437934) [468 bp, 155 aa] {ON}
           RPL24ARibosomal protein L30 of the large (60S) ribosomal
           subunit, nearly identical to Rpl24Bp and has similarity
           to rat L24 ribosomal protein; not essential for
           translation but may be required for normal translation
           rate
          Length = 155

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 8/28 (28%), Positives = 20/28 (71%)

Query: 164 RVVTWTTMWKEQHPEGVTNELSAHQAKK 191
           R + WT ++++ H +G+T E++  +++K
Sbjct: 47  RRIAWTVLFRKHHKKGITEEVAKKRSRK 74

>YGR148C Chr7 complement(787312..787779) [468 bp, 155 aa] {ON}
           RPL24BRibosomal protein L30 of the large (60S) ribosomal
           subunit, nearly identical to Rpl24Ap and has similarity
           to rat L24 ribosomal protein; not essential for
           translation but may be required for normal translation
           rate
          Length = 155

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 8/28 (28%), Positives = 20/28 (71%)

Query: 164 RVVTWTTMWKEQHPEGVTNELSAHQAKK 191
           R + WT ++++ H +G+T E++  +++K
Sbjct: 47  RRIAWTVLFRKHHKKGITEEVAKKRSRK 74

>Smik_6.252 Chr6 complement(406483..406950) [468 bp, 155 aa] {ON}
           YGR148C (REAL)
          Length = 155

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 8/28 (28%), Positives = 20/28 (71%)

Query: 164 RVVTWTTMWKEQHPEGVTNELSAHQAKK 191
           R + WT ++++ H +G+T E++  +++K
Sbjct: 47  RRIAWTVLFRKHHKKGITEEVAKKRSRK 74

>NDAI0E02730 Chr5 (573056..574554,574636..574771) [1635 bp, 544 aa]
           {ON} Anc_8.558 YBR186W
          Length = 544

 Score = 30.4 bits (67), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 16/25 (64%)

Query: 8   NPNILVTGTPGTGKSTTCELLLRNL 32
           N  +L+ G PGTGK+T C  L + L
Sbjct: 292 NKLLLIHGPPGTGKTTLCRALCQKL 316

>KAFR0F03570 Chr6 (710871..711338) [468 bp, 155 aa] {ON} Anc_4.84
           YGR148C
          Length = 155

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 8/28 (28%), Positives = 19/28 (67%)

Query: 164 RVVTWTTMWKEQHPEGVTNELSAHQAKK 191
           R + WT +++  H +G+T E++  +++K
Sbjct: 47  RRIAWTVLYRRHHKKGITEEVAKKRSRK 74

>YNL290W Chr14 (86218..87240) [1023 bp, 340 aa] {ON}  RFC3Subunit
          of heteropentameric Replication factor C (RF-C), which
          is a DNA binding protein and ATPase that acts as a
          clamp loader of the proliferating cell nuclear antigen
          (PCNA) processivity factor for DNA polymerases delta
          and epsilon
          Length = 340

 Score = 30.4 bits (67), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 19/32 (59%)

Query: 9  PNILVTGTPGTGKSTTCELLLRNLPDYTYYNI 40
          P++L  G PGTGK++T   L R +    Y N+
Sbjct: 47 PHLLFYGPPGTGKTSTIVALAREIYGKNYSNM 78

>Skud_7.471 Chr7 complement(770069..770536) [468 bp, 155 aa] {ON}
           YGR148C (REAL)
          Length = 155

 Score = 29.6 bits (65), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 8/28 (28%), Positives = 20/28 (71%)

Query: 164 RVVTWTTMWKEQHPEGVTNELSAHQAKK 191
           R + WT ++++ H +G+T E++  +++K
Sbjct: 47  RRIAWTVLFRKHHKKGITEEVAKKRSRK 74

>Skud_14.47 Chr14 (79783..80805) [1023 bp, 340 aa] {ON} YNL290W
          (REAL)
          Length = 340

 Score = 30.4 bits (67), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 19/32 (59%)

Query: 9  PNILVTGTPGTGKSTTCELLLRNLPDYTYYNI 40
          P++L  G PGTGK++T   L R +    Y N+
Sbjct: 47 PHLLFYGPPGTGKTSTIVALAREIYGRNYSNM 78

>SAKL0H21164g Chr8 complement(1845674..1846123) [450 bp, 149 aa]
           {ON} similar to uniprot|P04449 Saccharomyces cerevisiae
           YGL031C RPL24A and to uniprot|P24000 Saccharomyces
           cerevisiae YGR148C RPL24B
          Length = 149

 Score = 29.6 bits (65), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 8/28 (28%), Positives = 19/28 (67%)

Query: 164 RVVTWTTMWKEQHPEGVTNELSAHQAKK 191
           R + WT +++  H +G+T E++  +++K
Sbjct: 47  RKIAWTVLYRRHHKKGITEEVAKKRSRK 74

>Suva_14.49 Chr14 (82953..83975) [1023 bp, 340 aa] {ON} YNL290W
          (REAL)
          Length = 340

 Score = 30.0 bits (66), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 19/32 (59%)

Query: 9  PNILVTGTPGTGKSTTCELLLRNLPDYTYYNI 40
          P++L  G PGTGK++T   L R +    Y N+
Sbjct: 47 PHLLFYGPPGTGKTSTIVALAREIYGKNYSNM 78

>KAFR0I00940 Chr9 complement(182794..183261) [468 bp, 155 aa] {ON}
           Anc_4.84 YGR148C
          Length = 155

 Score = 29.6 bits (65), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 8/28 (28%), Positives = 19/28 (67%)

Query: 164 RVVTWTTMWKEQHPEGVTNELSAHQAKK 191
           R + WT +++  H +G+T E++  +++K
Sbjct: 47  RRIAWTVLYRRHHKKGITEEVAKKRSRK 74

>YKL197C Chr11 complement(70734..73865) [3132 bp, 1043 aa] {ON}
           PEX1AAA-peroxin that heterodimerizes with AAA-peroxin
           Pex6p and participates in the recycling of peroxisomal
           signal receptor Pex5p from the peroxisomal membrane to
           the cystosol; induced by oleic acid and upregulated
           during anaerobiosis
          Length = 1043

 Score = 30.4 bits (67), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 40/81 (49%), Gaps = 10/81 (12%)

Query: 132 GVVLQDALDSYEEQIVVELQSDDTEQMAANVDRV----VTW--TTMWKEQHPEGVTNELS 185
           G +L + L    EQI++E++  ++EQ   N++ +    V W  T M KE+  + +   L 
Sbjct: 353 GSLLTNNLILPTEQIIIEIKKGESEQQLCNLNEISNESVQWKVTQMGKEEVKDIIERHLP 412

Query: 186 AHQAKKERNDES----EEGDF 202
            H   KE  + S    +E DF
Sbjct: 413 KHYHVKETGEVSRTSKDEDDF 433

>TDEL0B02870 Chr2 (512594..514168,514238..514384) [1722 bp, 573 aa]
           {ON} Anc_8.558 YBR186W
          Length = 573

 Score = 30.4 bits (67), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 16/25 (64%)

Query: 8   NPNILVTGTPGTGKSTTCELLLRNL 32
           N  +LV G PGTGK+T C+ L   L
Sbjct: 315 NKLLLVHGPPGTGKTTICKALCHKL 339

>TDEL0E00780 Chr5 (162061..163071) [1011 bp, 336 aa] {ON} Anc_3.69
          YNL290W
          Length = 336

 Score = 30.0 bits (66), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 19/32 (59%)

Query: 9  PNILVTGTPGTGKSTTCELLLRNLPDYTYYNI 40
          P++L  G PGTGK++T   L R +    Y N+
Sbjct: 45 PHLLFYGPPGTGKTSTVVALAREIYGKNYSNM 76

>AFR477C Chr6 complement(1296737..1297204) [468 bp, 155 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL031C
           (RPL24A) and YGR148C (RPL24B)
          Length = 155

 Score = 29.6 bits (65), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 8/28 (28%), Positives = 19/28 (67%)

Query: 164 RVVTWTTMWKEQHPEGVTNELSAHQAKK 191
           R + WT +++  H +G+T E++  +++K
Sbjct: 47  RRIAWTVLYRRHHKKGITEEVAKKRSRK 74

>SAKL0C12144g Chr3 complement(1088849..1089838) [990 bp, 329 aa]
          {ON} highly similar to uniprot|P38629 Saccharomyces
          cerevisiae YNL290W RFC3 Subunit of heteropentameric
          Replication factor C (RF-C) which is a DNA binding
          protein and ATPase that acts as a clamp loader of the
          proliferating cell nuclear antigen (PCNA) processivity
          factor for DNA polymerases delta and epsilon
          Length = 329

 Score = 30.0 bits (66), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 19/32 (59%)

Query: 9  PNILVTGTPGTGKSTTCELLLRNLPDYTYYNI 40
          P++L  G PGTGK++T   L R +    Y N+
Sbjct: 42 PHLLFYGPPGTGKTSTIVALAREIYGKNYKNM 73

>TBLA0B08450 Chr2 complement(2024891..2025892) [1002 bp, 333 aa]
          {ON} Anc_3.69 YNL290W
          Length = 333

 Score = 30.0 bits (66), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 19/32 (59%)

Query: 9  PNILVTGTPGTGKSTTCELLLRNLPDYTYYNI 40
          P++L  G PGTGK++T   L R +    Y N+
Sbjct: 45 PHLLFYGPPGTGKTSTIVALAREIYGNNYSNM 76

>Kpol_1057.16 s1057 (29809..30690) [882 bp, 293 aa] {ON}
           (29809..30690) [882 nt, 294 aa]
          Length = 293

 Score = 30.0 bits (66), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 3/53 (5%)

Query: 11  ILVTGTPGTGKSTTCELLLRNLPDYTYYNISDF--AAKNKCYDGYDEARKSHI 61
           + V G PG GK T C+ L++N   + + +  D   A +N+    Y E  K +I
Sbjct: 105 VFVLGGPGAGKGTQCDKLVKN-HQFVHLSAGDLLRAEQNREGSQYGELIKKYI 156

>Smik_14.41 Chr14 (70565..71587) [1023 bp, 340 aa] {ON} YNL290W
          (REAL)
          Length = 340

 Score = 30.0 bits (66), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 19/32 (59%)

Query: 9  PNILVTGTPGTGKSTTCELLLRNLPDYTYYNI 40
          P++L  G PGTGK++T   L R +    Y N+
Sbjct: 47 PHLLFYGPPGTGKTSTIVALAREIYGKNYSNM 78

>KLLA0E13201g Chr5 (1168489..1169478) [990 bp, 329 aa] {ON} highly
          similar to uniprot|P38629 YNL290W Saccharomyces
          cerevisiae RFC3 Subunit of heteropentameric Replication
          factor C (RF-C)
          Length = 329

 Score = 30.0 bits (66), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 19/32 (59%)

Query: 9  PNILVTGTPGTGKSTTCELLLRNLPDYTYYNI 40
          P++L  G PGTGK++T   L R +    Y N+
Sbjct: 42 PHLLFYGPPGTGKTSTIVALAREIYGSNYRNM 73

>NCAS0A09890 Chr1 complement(1978423..1979433) [1011 bp, 336 aa]
          {ON} Anc_3.69
          Length = 336

 Score = 30.0 bits (66), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 19/32 (59%)

Query: 9  PNILVTGTPGTGKSTTCELLLRNLPDYTYYNI 40
          P++L  G PGTGK++T   L R +    Y N+
Sbjct: 47 PHLLFYGPPGTGKTSTIVALAREIYGRNYSNM 78

>Kpol_1066.38 s1066 complement(64176..65186) [1011 bp, 336 aa]
          {ON} complement(64176..65186) [1011 nt, 337 aa]
          Length = 336

 Score = 29.6 bits (65), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 20/32 (62%)

Query: 9  PNILVTGTPGTGKSTTCELLLRNLPDYTYYNI 40
          P++L  G PGTGK++T   L + +    Y+N+
Sbjct: 46 PHLLFYGPPGTGKTSTIIALAKEIYGKNYHNM 77

>AEL258W Chr5 (152451..153911,153967..154086) [1581 bp, 526 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR186W
           (PCH2); 1-intron
          Length = 526

 Score = 29.6 bits (65), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 15/22 (68%)

Query: 11  ILVTGTPGTGKSTTCELLLRNL 32
           +LV G PGTGK+T C+ L   L
Sbjct: 283 LLVHGPPGTGKTTICKALCHKL 304

>KNAG0G01880 Chr7 (420542..421219) [678 bp, 225 aa] {ON} Anc_8.236
          YER170W
          Length = 225

 Score = 29.3 bits (64), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 19/37 (51%)

Query: 11 ILVTGTPGTGKSTTCELLLRNLPDYTYYNISDFAAKN 47
          +L+ G PG GK T  + L++  P+    +  D   KN
Sbjct: 10 LLLLGAPGAGKGTQTKRLIKRFPEIKAISSGDLLRKN 46

>KAFR0E00840 Chr5 (176559..178121,178220..178348) [1692 bp, 563 aa]
           {ON} Anc_8.558 YBR186W
          Length = 563

 Score = 29.6 bits (65), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 17/25 (68%)

Query: 8   NPNILVTGTPGTGKSTTCELLLRNL 32
           N  ++V G PGTGK+T C+ L + L
Sbjct: 311 NKLLIVHGPPGTGKTTLCKALCQKL 335

>ZYRO0B11968g Chr2 (956319..959624) [3306 bp, 1101 aa] {ON} similar
           to uniprot|P32644 Saccharomyces cerevisiae YER176W ECM32
           DNA dependent ATPase/DNA helicase belonging to the
           Dna2p- and Nam7p-like family of helicases that is
           involved in modulating translation termination interacts
           with the translation termination factors localized to
           polysomes
          Length = 1101

 Score = 29.6 bits (65), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 60/137 (43%), Gaps = 22/137 (16%)

Query: 12  LVTGTPGTGKSTTC-ELLLRNLPDYTYYNISDFAAKN--------KCYDGYDEARKSHIV 62
           ++ G PGTGK++T  EL+++ + +++ + I   AA N        K  D  D  R   IV
Sbjct: 651 VLQGPPGTGKTSTIEELIIQMIRNFSSWPILCVAASNIAIDNIAEKFIDNKDSIRILRIV 710

Query: 63  XXXXXXXXXXXXXHSGGNIIDWH-VNDVFPERLIDLVAVLRCDSSVLFDRLNKREYHSSK 121
                        H  G I   + VND  P +L ++   LR   S     ++K +Y++  
Sbjct: 711 --SDSKESQYNKDHPLGKICLHNIVNDQLPPQLKEVQHKLRTGKS---HEVSKNQYNNLS 765

Query: 122 IDEN-------MDAEIM 131
             +N       M A+I+
Sbjct: 766 TAQNQIADRYIMQAQIL 782

>Ecym_6278 Chr6 complement(526852..527757) [906 bp, 301 aa] {ON}
           similar to Ashbya gossypii AEL156W
          Length = 301

 Score = 29.3 bits (64), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 25/43 (58%)

Query: 5   RRLNPNILVTGTPGTGKSTTCELLLRNLPDYTYYNISDFAAKN 47
           ++L P +L+T T GT      +L + +  D++YY +S F  ++
Sbjct: 248 KQLKPELLLTATAGTSWEGMVDLHMEDGFDHSYYFVSSFVPEH 290

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 21,612,163
Number of extensions: 858237
Number of successful extensions: 3489
Number of sequences better than 10.0: 102
Number of HSP's gapped: 3488
Number of HSP's successfully gapped: 102
Length of query: 223
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 118
Effective length of database: 41,441,469
Effective search space: 4890093342
Effective search space used: 4890093342
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 63 (28.9 bits)