Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0C037607.347ON19119110201e-143
ZYRO0F11638g7.347ON1911919021e-125
TDEL0C020107.347ON1911918871e-123
NDAI0A019207.347ON1931938641e-119
Suva_4.817.347ON1911918631e-119
NCAS0A141307.347ON1911918551e-118
YDL165W (CDC36)7.347ON1911918531e-117
Skud_4.927.347ON1911918511e-117
Smik_4.737.347ON1911918501e-117
KAFR0B008507.347ON1921938431e-116
Kpol_530.347.347ON1911918301e-114
CAGL0I03388g7.347ON1911918191e-112
TPHA0F029407.347ON1911918061e-110
TBLA0E005107.347ON2871677541e-101
KLTH0H01320g7.347ON1901927421e-100
Kwal_56.246347.347ON1901927351e-99
SAKL0F11308g7.347ON1911947272e-98
KLLA0D12408g7.347ON1841916776e-91
Ecym_47267.347ON1911986455e-86
ACL151C7.347ON2081986432e-85
SAKL0B08052g3.370ON576871072e-05
TPHA0A035003.370ON548821072e-05
Kpol_1006.73.370ON540801045e-05
ZYRO0C16588g3.370ON608821021e-04
KAFR0H008603.370ON578821002e-04
Kwal_23.39623.370ON55386992e-04
CAGL0D01342g3.370ON54889983e-04
Smik_16.3163.370ON56082974e-04
YPR072W (NOT5)3.370ON56082975e-04
KLTH0F11880g3.370ON56389967e-04
NDAI0A050803.370ON57582958e-04
TBLA0H014903.370ON55283940.001
Skud_16.3613.370ON56082940.001
Suva_16.4013.370ON56582930.001
KNAG0A072903.370ON50786910.003
Ecym_34563.370ON50888870.009
ADL364C3.370ON50489860.011
TDEL0C051203.370ON56284840.019
KLLA0B09196g3.370ON59047800.066
Kpol_1070.257.214ON686103790.089
KLTH0A03652g7.214ON77238790.10
ABR159C7.497ON38267750.28
Suva_9.1627.214ON84796691.8
NCAS0A112103.370ON58241682.5
ZYRO0D16302g7.214ON82981673.2
KAFR0A013801.267ON73992663.7
TBLA0D042707.214ON84766655.7
NDAI0A026907.214ON84681646.4
Kwal_47.181147.214ON76380647.7
CAGL0K00363g1.527ON122763647.7
TDEL0H023307.214ON81281648.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0C03760
         (191 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0C03760 Chr3 complement(741798..742373) [576 bp, 191 aa] {ON...   397   e-143
ZYRO0F11638g Chr6 complement(954908..955483) [576 bp, 191 aa] {O...   352   e-125
TDEL0C02010 Chr3 (348737..349312) [576 bp, 191 aa] {ON} Anc_7.34...   346   e-123
NDAI0A01920 Chr1 (429808..430389) [582 bp, 193 aa] {ON} Anc_7.34...   337   e-119
Suva_4.81 Chr4 (151849..152424) [576 bp, 191 aa] {ON} YDL165W (R...   337   e-119
NCAS0A14130 Chr1 complement(2778386..2778961) [576 bp, 191 aa] {...   333   e-118
YDL165W Chr4 (164290..164865) [576 bp, 191 aa] {ON}  CDC36Compon...   333   e-117
Skud_4.92 Chr4 (159953..160528) [576 bp, 191 aa] {ON} YDL165W (R...   332   e-117
Smik_4.73 Chr4 (141054..141629) [576 bp, 191 aa] {ON} YDL165W (R...   332   e-117
KAFR0B00850 Chr2 complement(160852..161430) [579 bp, 192 aa] {ON...   329   e-116
Kpol_530.34 s530 (82095..82670) [576 bp, 191 aa] {ON} (82095..82...   324   e-114
CAGL0I03388g Chr9 (288784..289359) [576 bp, 191 aa] {ON} highly ...   320   e-112
TPHA0F02940 Chr6 complement(648881..649456) [576 bp, 191 aa] {ON...   315   e-110
TBLA0E00510 Chr5 complement(93705..94568) [864 bp, 287 aa] {ON} ...   295   e-101
KLTH0H01320g Chr8 (125017..125589) [573 bp, 190 aa] {ON} highly ...   290   e-100
Kwal_56.24634 s56 complement(1082319..1082891) [573 bp, 190 aa] ...   287   1e-99
SAKL0F11308g Chr6 complement(882040..882615) [576 bp, 191 aa] {O...   284   2e-98
KLLA0D12408g Chr4 (1055117..1055671) [555 bp, 184 aa] {ON} simil...   265   6e-91
Ecym_4726 Chr4 (1420080..1420655) [576 bp, 191 aa] {ON} similar ...   253   5e-86
ACL151C Chr3 complement(87037..87663) [627 bp, 208 aa] {ON} Synt...   252   2e-85
SAKL0B08052g Chr2 (688482..690212) [1731 bp, 576 aa] {ON} highly...    46   2e-05
TPHA0A03500 Chr1 complement(769721..771367) [1647 bp, 548 aa] {O...    46   2e-05
Kpol_1006.7 s1006 (30700..32322) [1623 bp, 540 aa] {ON} (30700.....    45   5e-05
ZYRO0C16588g Chr3 (1293001..1294827) [1827 bp, 608 aa] {ON} high...    44   1e-04
KAFR0H00860 Chr8 complement(158881..160617) [1737 bp, 578 aa] {O...    43   2e-04
Kwal_23.3962 s23 complement(502287..503948) [1662 bp, 553 aa] {O...    43   2e-04
CAGL0D01342g Chr4 complement(149562..151208) [1647 bp, 548 aa] {...    42   3e-04
Smik_16.316 Chr16 (567157..568839) [1683 bp, 560 aa] {ON} YPR072...    42   4e-04
YPR072W Chr16 (690107..691789) [1683 bp, 560 aa] {ON}  NOT5Subun...    42   5e-04
KLTH0F11880g Chr6 complement(1000583..1002274) [1692 bp, 563 aa]...    42   7e-04
NDAI0A05080 Chr1 complement(1154530..1156257) [1728 bp, 575 aa] ...    41   8e-04
TBLA0H01490 Chr8 complement(331583..333241) [1659 bp, 552 aa] {O...    41   0.001
Skud_16.361 Chr16 (655247..656929) [1683 bp, 560 aa] {ON} YPR072...    41   0.001
Suva_16.401 Chr16 (697328..699025) [1698 bp, 565 aa] {ON} YPR072...    40   0.001
KNAG0A07290 Chr1 (1139630..1141153) [1524 bp, 507 aa] {ON} Anc_3...    40   0.003
Ecym_3456 Chr3 complement(853907..855433) [1527 bp, 508 aa] {ON}...    38   0.009
ADL364C Chr4 complement(66072..67586) [1515 bp, 504 aa] {ON} Syn...    38   0.011
TDEL0C05120 Chr3 (917832..919520) [1689 bp, 562 aa] {ON} Anc_3.3...    37   0.019
KLLA0B09196g Chr2 complement(803259..805031) [1773 bp, 590 aa] {...    35   0.066
Kpol_1070.25 s1070 complement(58286..59491,59501..59509,59592..6...    35   0.089
KLTH0A03652g Chr1 (314336..316654) [2319 bp, 772 aa] {ON} some s...    35   0.10 
ABR159C Chr2 complement(701341..702489) [1149 bp, 382 aa] {ON} S...    33   0.28 
Suva_9.162 Chr9 complement(268759..271299) [2541 bp, 847 aa] {ON...    31   1.8  
NCAS0A11210 Chr1 (2223815..2225563) [1749 bp, 582 aa] {ON} Anc_3...    31   2.5  
ZYRO0D16302g Chr4 (1357223..1359712) [2490 bp, 829 aa] {ON} simi...    30   3.2  
KAFR0A01380 Chr1 (268388..270607) [2220 bp, 739 aa] {ON} Anc_1.2...    30   3.7  
TBLA0D04270 Chr4 complement(1055025..1057568) [2544 bp, 847 aa] ...    30   5.7  
NDAI0A02690 Chr1 complement(603611..606151) [2541 bp, 846 aa] {O...    29   6.4  
Kwal_47.18114 s47 (692928..695219) [2292 bp, 763 aa] {ON} YIL038...    29   7.7  
CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {...    29   7.7  
TDEL0H02330 Chr8 complement(391361..393799) [2439 bp, 812 aa] {O...    29   8.3  

>KNAG0C03760 Chr3 complement(741798..742373) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  397 bits (1020), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 191/191 (100%), Positives = 191/191 (100%)

Query: 1   MDKFGLKALVPLVRQGDPEVASKYDHSMALGADLSSMLHSLGIPRDSKRQAVLATFQSPW 60
           MDKFGLKALVPLVRQGDPEVASKYDHSMALGADLSSMLHSLGIPRDSKRQAVLATFQSPW
Sbjct: 1   MDKFGLKALVPLVRQGDPEVASKYDHSMALGADLSSMLHSLGIPRDSKRQAVLATFQSPW 60

Query: 61  AETSRSEVEPTFYIPASFLGIDEVLQSESTPPCFDSVQRDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEPTFYIPASFLGIDEVLQSESTPPCFDSVQRDQQRVALFQDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPTFYIPASFLGIDEVLQSESTPPCFDSVQRDQQRVALFQDETLFYLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSERGSYVFFDPQRWEKCQ 180

Query: 181 RDFLLFYNAIM 191
           RDFLLFYNAIM
Sbjct: 181 RDFLLFYNAIM 191

>ZYRO0F11638g Chr6 complement(954908..955483) [576 bp, 191 aa] {ON}
           highly similar to uniprot|P06100 Saccharomyces
           cerevisiae YDL165W CDC36 Component of the CCR4-NOT
           complex which has multiple roles in regulating mRNA
           levels including regulation of transcription and
           destabilizing mRNAs by deadenylation basal transcription
           factor
          Length = 191

 Score =  352 bits (902), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 167/191 (87%), Positives = 176/191 (92%)

Query: 1   MDKFGLKALVPLVRQGDPEVASKYDHSMALGADLSSMLHSLGIPRDSKRQAVLATFQSPW 60
           MDKFGL+ALVPLV+Q D E++ KYDHSM LGADLSSMLHSLGIPRDSKR  VL TFQSPW
Sbjct: 1   MDKFGLEALVPLVKQEDRELSGKYDHSMTLGADLSSMLHSLGIPRDSKRHKVLDTFQSPW 60

Query: 61  AETSRSEVEPTFYIPASFLGIDEVLQSESTPPCFDSVQRDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEP F+IP SF+ I  VL S+STPPCF+SVQ+DQQRVALFQDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPRFFIPESFVNIPNVLHSQSTPPCFNSVQQDQQRVALFQDETLFYLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHKTLKAWLTKDP MEPVVS DGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ 180

Query: 181 RDFLLFYNAIM 191
           RDFLLFYNAIM
Sbjct: 181 RDFLLFYNAIM 191

>TDEL0C02010 Chr3 (348737..349312) [576 bp, 191 aa] {ON} Anc_7.347
           YDL165W
          Length = 191

 Score =  346 bits (887), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 164/191 (85%), Positives = 175/191 (91%)

Query: 1   MDKFGLKALVPLVRQGDPEVASKYDHSMALGADLSSMLHSLGIPRDSKRQAVLATFQSPW 60
           M+KFGLKALVPL++Q + E AS YDHS+ LGADLSSMLHSLGIPRDSKR  VL TFQSPW
Sbjct: 1   MEKFGLKALVPLIKQEERETASLYDHSITLGADLSSMLHSLGIPRDSKRHRVLDTFQSPW 60

Query: 61  AETSRSEVEPTFYIPASFLGIDEVLQSESTPPCFDSVQRDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEP F+IP SF  I +VLQS++TPPCF+SVQ DQQRVALFQDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPKFFIPDSFTNIPQVLQSQTTPPCFNSVQHDQQRVALFQDETLFYLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHKTLKAWLTKDP MEPVVS DGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ 180

Query: 181 RDFLLFYNAIM 191
           R+FLLFYNAIM
Sbjct: 181 REFLLFYNAIM 191

>NDAI0A01920 Chr1 (429808..430389) [582 bp, 193 aa] {ON} Anc_7.347
           YDL165W
          Length = 193

 Score =  337 bits (864), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 163/193 (84%), Positives = 174/193 (90%), Gaps = 2/193 (1%)

Query: 1   MDKFGLKALVPLVRQGDPEVASKYDHSMALGADLSSMLHSLGIPRDSKRQAVLATFQSPW 60
           MDKFGL+ALVPL++  D E++  YDHSM LGADL+SMLHSLGIPRDSKR  VL TFQSPW
Sbjct: 1   MDKFGLEALVPLIKPDDKELSKIYDHSMTLGADLTSMLHSLGIPRDSKRHRVLDTFQSPW 60

Query: 61  AETSRSEVEPTFYIPASFLGIDEVLQSES--TPPCFDSVQRDQQRVALFQDETLFYLFYK 118
           AETSRSEVEPTF+IP SF  I +VLQS +  TPP FDSVQ+DQQRVALFQDETLFYLFYK
Sbjct: 61  AETSRSEVEPTFFIPDSFTHIPDVLQSNTKDTPPSFDSVQKDQQRVALFQDETLFYLFYK 120

Query: 119 HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSERGSYVFFDPQRWEK 178
           HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDP MEPVVS DGLSERGSYVFFDPQRWEK
Sbjct: 121 HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSERGSYVFFDPQRWEK 180

Query: 179 CQRDFLLFYNAIM 191
           CQR+FLLFYNAIM
Sbjct: 181 CQREFLLFYNAIM 193

>Suva_4.81 Chr4 (151849..152424) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  337 bits (863), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 159/191 (83%), Positives = 171/191 (89%)

Query: 1   MDKFGLKALVPLVRQGDPEVASKYDHSMALGADLSSMLHSLGIPRDSKRQAVLATFQSPW 60
           MDKFGL+ALVPL++Q D E++S YDHSM LGADLSSML+SLGIPRDS+   VL TFQSPW
Sbjct: 1   MDKFGLQALVPLLKQEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60

Query: 61  AETSRSEVEPTFYIPASFLGIDEVLQSESTPPCFDSVQRDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEP F+ P SF  I  VLQS  TPPCF+S+Q DQQRVALFQDETLF+LFYKHP
Sbjct: 61  AETSRSEVEPRFFTPESFTNIPSVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHKTLKAWLTKDP MEP+VS DGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180

Query: 181 RDFLLFYNAIM 191
           RDFLLFYNAIM
Sbjct: 181 RDFLLFYNAIM 191

>NCAS0A14130 Chr1 complement(2778386..2778961) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  333 bits (855), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 159/191 (83%), Positives = 169/191 (88%)

Query: 1   MDKFGLKALVPLVRQGDPEVASKYDHSMALGADLSSMLHSLGIPRDSKRQAVLATFQSPW 60
           MDKFGLKALVPL+RQ D E++  YDHSM LGADLSSM+HSLGIPRD+ R  VL TFQSPW
Sbjct: 1   MDKFGLKALVPLLRQDDKELSKPYDHSMTLGADLSSMIHSLGIPRDNTRHRVLDTFQSPW 60

Query: 61  AETSRSEVEPTFYIPASFLGIDEVLQSESTPPCFDSVQRDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEPTF+IP SF+GI  VLQS  TPP FDS Q DQQRVALFQDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPTFFIPDSFVGISGVLQSPVTPPRFDSAQNDQQRVALFQDETLFYLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSERGSYVFFDPQRWEKCQ 180
           GTV+QELTYLELR RNWRYH TL+AWLTKDP MEP VS DGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVLQELTYLELRNRNWRYHTTLRAWLTKDPLMEPEVSADGLSERGSYVFFDPQRWEKCQ 180

Query: 181 RDFLLFYNAIM 191
           +DFLLFYNAIM
Sbjct: 181 KDFLLFYNAIM 191

>YDL165W Chr4 (164290..164865) [576 bp, 191 aa] {ON}  CDC36Component
           of the CCR4-NOT complex, which has multiple roles in
           regulating mRNA levels including regulation of
           transcription and destabilizing mRNAs by deadenylation;
           basal transcription factor
          Length = 191

 Score =  333 bits (853), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 158/191 (82%), Positives = 170/191 (89%)

Query: 1   MDKFGLKALVPLVRQGDPEVASKYDHSMALGADLSSMLHSLGIPRDSKRQAVLATFQSPW 60
           M+KFGLKALVPL++  D E++S YDHSM LGADLSSML+SLGIPRDS+   VL TFQSPW
Sbjct: 1   MEKFGLKALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60

Query: 61  AETSRSEVEPTFYIPASFLGIDEVLQSESTPPCFDSVQRDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEP F+ P SF  I  VLQS  TPPCF+S+Q DQQRVALFQDETLF+LFYKHP
Sbjct: 61  AETSRSEVEPRFFTPESFTNIPGVLQSTVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHKTLKAWLTKDP MEP+VS DGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180

Query: 181 RDFLLFYNAIM 191
           RDFLLFYNAIM
Sbjct: 181 RDFLLFYNAIM 191

>Skud_4.92 Chr4 (159953..160528) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  332 bits (851), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 170/191 (89%)

Query: 1   MDKFGLKALVPLVRQGDPEVASKYDHSMALGADLSSMLHSLGIPRDSKRQAVLATFQSPW 60
           M+KFGL+ALVPL++  D E++S YDHSM LGADLSSML+SLGIPRDS+   VL TFQSPW
Sbjct: 1   MEKFGLRALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60

Query: 61  AETSRSEVEPTFYIPASFLGIDEVLQSESTPPCFDSVQRDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEP F+ P SF  I  VLQS  TPPCF+S+Q DQQRVALFQDETLF+LFYKHP
Sbjct: 61  AETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHKTLKAWLTKDP MEP+VS DGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180

Query: 181 RDFLLFYNAIM 191
           RDFLLFYNAIM
Sbjct: 181 RDFLLFYNAIM 191

>Smik_4.73 Chr4 (141054..141629) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  332 bits (850), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 170/191 (89%)

Query: 1   MDKFGLKALVPLVRQGDPEVASKYDHSMALGADLSSMLHSLGIPRDSKRQAVLATFQSPW 60
           M+KFGL+ALVPL++  D E++S YDHSM LGADLSSML+SLGIPRDS+   VL TFQSPW
Sbjct: 1   MEKFGLQALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60

Query: 61  AETSRSEVEPTFYIPASFLGIDEVLQSESTPPCFDSVQRDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEP F+ P SF  I  VLQS  TPPCF+S+Q DQQRVALFQDETLF+LFYKHP
Sbjct: 61  AETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHKTLKAWLTKDP MEP+VS DGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180

Query: 181 RDFLLFYNAIM 191
           RDFLLFYNAIM
Sbjct: 181 RDFLLFYNAIM 191

>KAFR0B00850 Chr2 complement(160852..161430) [579 bp, 192 aa] {ON}
           Anc_7.347 YDL165W
          Length = 192

 Score =  329 bits (843), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 168/193 (87%), Gaps = 3/193 (1%)

Query: 1   MDKFGLKALVPLVRQGDP--EVASKYDHSMALGADLSSMLHSLGIPRDSKRQAVLATFQS 58
           MDKFGLKAL+PL++Q DP  E   +YDHSM LGADLSSML+SLGIPRD +   VL TFQS
Sbjct: 1   MDKFGLKALIPLIKQ-DPQGEKNGQYDHSMTLGADLSSMLYSLGIPRDKQHHRVLDTFQS 59

Query: 59  PWAETSRSEVEPTFYIPASFLGIDEVLQSESTPPCFDSVQRDQQRVALFQDETLFYLFYK 118
           PWAETSRSEVEP F IP SF  I  VLQS  TPPCFDS+Q DQQRVALFQDETLFYLFYK
Sbjct: 60  PWAETSRSEVEPKFSIPDSFNNISNVLQSNVTPPCFDSIQNDQQRVALFQDETLFYLFYK 119

Query: 119 HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSERGSYVFFDPQRWEK 178
           HP TVIQELTYLELRKRNWRYHKTLKAWLTKDP MEP+VS DGLSE+GSYVFFDPQRWEK
Sbjct: 120 HPATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVFFDPQRWEK 179

Query: 179 CQRDFLLFYNAIM 191
           CQRDFLLFYNAIM
Sbjct: 180 CQRDFLLFYNAIM 192

>Kpol_530.34 s530 (82095..82670) [576 bp, 191 aa] {ON}
           (82095..82670) [576 nt, 192 aa]
          Length = 191

 Score =  324 bits (830), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 170/191 (89%)

Query: 1   MDKFGLKALVPLVRQGDPEVASKYDHSMALGADLSSMLHSLGIPRDSKRQAVLATFQSPW 60
           MDKFGL+AL+PL++Q D E++ KY+H+M +G DLSSMLHSLGIPRD++R  +L TFQSPW
Sbjct: 1   MDKFGLEALLPLIKQDDTELSKKYNHAMTIGTDLSSMLHSLGIPRDNQRYRILDTFQSPW 60

Query: 61  AETSRSEVEPTFYIPASFLGIDEVLQSESTPPCFDSVQRDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEP F+ P SF  I  VLQS+ TPP F+S++ DQQRV LFQDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPRFFTPESFKNIPNVLQSKVTPPVFNSIENDQQRVTLFQDETLFYLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHKTLKAWLTKDP +EP+VS DGLSERGSY+FFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLSERGSYIFFDPQRWEKCQ 180

Query: 181 RDFLLFYNAIM 191
           R+F+LFYNAIM
Sbjct: 181 REFVLFYNAIM 191

>CAGL0I03388g Chr9 (288784..289359) [576 bp, 191 aa] {ON} highly
           similar to uniprot|P06100 Saccharomyces cerevisiae
           YDL165w CDC36 transcription factor
          Length = 191

 Score =  320 bits (819), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 164/191 (85%)

Query: 1   MDKFGLKALVPLVRQGDPEVASKYDHSMALGADLSSMLHSLGIPRDSKRQAVLATFQSPW 60
           M KFGL+ LVPL+R  + +    YDHSM +G DLSSMLHSLGIPRDSK   VL TFQSPW
Sbjct: 1   MSKFGLQKLVPLIRADEEKDGKVYDHSMTIGTDLSSMLHSLGIPRDSKHHRVLDTFQSPW 60

Query: 61  AETSRSEVEPTFYIPASFLGIDEVLQSESTPPCFDSVQRDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEP +YIP SF  I +VLQS++TPP FD VQ DQQRVALFQDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPKYYIPESFKNIPDVLQSKTTPPTFDDVQTDQQRVALFQDETLFYLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHK LKAWLTKDP MEPVV+ DGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVFFDPQRWEKCQ 180

Query: 181 RDFLLFYNAIM 191
           RDF LFY+AIM
Sbjct: 181 RDFPLFYSAIM 191

>TPHA0F02940 Chr6 complement(648881..649456) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  315 bits (806), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 143/191 (74%), Positives = 167/191 (87%)

Query: 1   MDKFGLKALVPLVRQGDPEVASKYDHSMALGADLSSMLHSLGIPRDSKRQAVLATFQSPW 60
           MDKFGL+AL+PL++Q DPE + KY+H+M +GADL+S+ HSLGIP ++KR  VL TFQSPW
Sbjct: 1   MDKFGLEALLPLIKQDDPEFSKKYNHAMTIGADLTSIQHSLGIPNNNKRYRVLDTFQSPW 60

Query: 61  AETSRSEVEPTFYIPASFLGIDEVLQSESTPPCFDSVQRDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEP ++ P SF  I +VLQS  TP  F+SV+ DQQR++LFQDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPRYFTPKSFTNIPKVLQSIDTPSVFNSVETDQQRISLFQDETLFYLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHK LKAWLTKDP +EP+V+ DG SERGSY+FFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKILKAWLTKDPIVEPIVTADGQSERGSYIFFDPQRWEKCQ 180

Query: 181 RDFLLFYNAIM 191
           RDF+LFYNAIM
Sbjct: 181 RDFVLFYNAIM 191

>TBLA0E00510 Chr5 complement(93705..94568) [864 bp, 287 aa] {ON}
           Anc_7.347 YDL165W
          Length = 287

 Score =  295 bits (754), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 149/167 (89%)

Query: 25  DHSMALGADLSSMLHSLGIPRDSKRQAVLATFQSPWAETSRSEVEPTFYIPASFLGIDEV 84
           DHS+ +GADLSSMLHSLG+PRD+KR  +L TFQSPWAETSRSEV+P F+IP+SF  I  V
Sbjct: 121 DHSLTIGADLSSMLHSLGLPRDNKRHRILDTFQSPWAETSRSEVQPRFFIPSSFSNISNV 180

Query: 85  LQSESTPPCFDSVQRDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLK 144
           LQ  +TPP F++++ DQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWR+HK LK
Sbjct: 181 LQCNTTPPTFNNIELDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRFHKILK 240

Query: 145 AWLTKDPTMEPVVSPDGLSERGSYVFFDPQRWEKCQRDFLLFYNAIM 191
            WLTKDP MEP+V+ DG SERGSYVFFDPQRWEKCQR+F+LFYNAIM
Sbjct: 241 TWLTKDPMMEPIVAADGFSERGSYVFFDPQRWEKCQREFILFYNAIM 287

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 12/14 (85%), Positives = 14/14 (100%)

Query: 1  MDKFGLKALVPLVR 14
          MD+FGLKALVPL+R
Sbjct: 1  MDRFGLKALVPLIR 14

>KLTH0H01320g Chr8 (125017..125589) [573 bp, 190 aa] {ON} highly
           similar to uniprot|P06100 Saccharomyces cerevisiae
           YDL165W CDC36 Component of the CCR4-NOT complex which
           has multiple roles in regulating mRNA levels including
           regulation of transcription and destabilizing mRNAs by
           deadenylation basal transcription factor
          Length = 190

 Score =  290 bits (742), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 138/192 (71%), Positives = 157/192 (81%), Gaps = 3/192 (1%)

Query: 1   MDKFGLKALVPLVRQGDPEVASKYDHSMALGADLSSMLHSLGIPRDS-KRQAVLATFQSP 59
           M+K+GL AL+PL+R+ D   +  YD SM LG DLS +LHSLGIP +   R  VL TFQSP
Sbjct: 1   MEKYGLSALLPLIRRED--QSPDYDSSMTLGIDLSPVLHSLGIPNNQPSRNRVLDTFQSP 58

Query: 60  WAETSRSEVEPTFYIPASFLGIDEVLQSESTPPCFDSVQRDQQRVALFQDETLFYLFYKH 119
           W ETSRSEVEP F++P SF  I  VLQS   PP F+SVQ+D  +++LFQDETLFYLFYKH
Sbjct: 59  WVETSRSEVEPKFFVPESFKNIPNVLQSGERPPAFNSVQQDHAKISLFQDETLFYLFYKH 118

Query: 120 PGTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSERGSYVFFDPQRWEKC 179
           PG+V+QELTYLELRKRNWRYHKTLK WLTKDP MEPVV+P G SERGSYVFFDPQRWEKC
Sbjct: 119 PGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEKC 178

Query: 180 QRDFLLFYNAIM 191
           QRDF+LFYNAIM
Sbjct: 179 QRDFVLFYNAIM 190

>Kwal_56.24634 s56 complement(1082319..1082891) [573 bp, 190 aa]
           {ON} YDL165W (CDC36) - nuclear protein that negatively
           regulates basal transcription [contig 161] FULL
          Length = 190

 Score =  287 bits (735), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 158/192 (82%), Gaps = 3/192 (1%)

Query: 1   MDKFGLKALVPLVRQGDPEVASKYDHSMALGADLSSMLHSLGIPRD-SKRQAVLATFQSP 59
           M+K+GL AL+PL+R+ D   + +YD SM LG DLS +LHSLGI  + S R  VL TFQSP
Sbjct: 1   MEKYGLSALLPLIRREDQ--SPEYDSSMTLGIDLSPVLHSLGIASNQSTRYRVLDTFQSP 58

Query: 60  WAETSRSEVEPTFYIPASFLGIDEVLQSESTPPCFDSVQRDQQRVALFQDETLFYLFYKH 119
           W ETSRSEVEP F++P SF  I  VLQ+   PP F+SVQ+D  +++LFQDETLFYLFYKH
Sbjct: 59  WVETSRSEVEPKFFVPESFKNIPNVLQAGDKPPAFNSVQQDHAKISLFQDETLFYLFYKH 118

Query: 120 PGTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSERGSYVFFDPQRWEKC 179
           PG+V+QELTYLELRKRNWRYHKTLK WLTKDP MEPVV+P G SERGSYVFFDPQRWEKC
Sbjct: 119 PGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEKC 178

Query: 180 QRDFLLFYNAIM 191
           QRDF+LFYNAIM
Sbjct: 179 QRDFVLFYNAIM 190

>SAKL0F11308g Chr6 complement(882040..882615) [576 bp, 191 aa] {ON}
           highly similar to uniprot|P06100 Saccharomyces
           cerevisiae YDL165W CDC36 Component of the CCR4-NOT
           complex which has multiple roles in regulating mRNA
           levels including regulation of transcription and
           destabilizing mRNAs by deadenylation basal transcription
           factor
          Length = 191

 Score =  284 bits (727), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 161/194 (82%), Gaps = 8/194 (4%)

Query: 1   MDKFGLKALVPLVRQ--GDPEVASKYDHSMALGADLSSMLHSLGIPRDSK-RQAVLATFQ 57
           ++K+GLKAL+PL++Q  G+ E    YD +M +G DLSSMLHSLGI  + + +  VL TF 
Sbjct: 3   VEKYGLKALLPLIKQETGNAE----YDPAMTMGMDLSSMLHSLGIDSNQEYKTRVLDTFP 58

Query: 58  SPWAETSRSEVEPTFYIPASFLGIDEVLQSESTPPCFDSVQRDQQRVALFQDETLFYLFY 117
           SPW ETSRSEVEP F+ P SF+ I  VLQS S PP F+SVQ+D  ++ALFQDETLFYLFY
Sbjct: 59  SPWVETSRSEVEPKFFTPESFVNIPNVLQSPS-PPSFNSVQQDHPKIALFQDETLFYLFY 117

Query: 118 KHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSERGSYVFFDPQRWE 177
           KHPGTV+QE+TYLELRKRNWRYHKTLK WLTKDP MEPVVS DGLSERGSYVFFDPQRWE
Sbjct: 118 KHPGTVVQEITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYVFFDPQRWE 177

Query: 178 KCQRDFLLFYNAIM 191
           KCQRDF+LFYNAIM
Sbjct: 178 KCQRDFVLFYNAIM 191

>KLLA0D12408g Chr4 (1055117..1055671) [555 bp, 184 aa] {ON} similar
           to uniprot|P06100 Saccharomyces cerevisiae YDL165W CDC36
           Component of the CCR4-NOT complex which has multiple
           roles in regulating mRNA levels including regulation of
           transcription and destabilizing mRNAs by deadenylation
           basal transcription factor
          Length = 184

 Score =  265 bits (677), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 129/191 (67%), Positives = 151/191 (79%), Gaps = 7/191 (3%)

Query: 1   MDKFGLKALVPLVRQGDPEVASKYDHSMALGADLSSMLHSLGIPRDSKRQAVLATFQSPW 60
           M+K+GLK LVP++R  DP     YD +M LG DL+S+L+SL I +D+K    L  F+SPW
Sbjct: 1   MEKYGLKDLVPVLRH-DP----TYDANMTLGIDLNSLLNSLDITKDTKSHHCLDAFESPW 55

Query: 61  AETSRSEVEPTFYIPASFLGIDEVLQSESTPPCFDSVQRDQQRVALFQDETLFYLFYKHP 120
            ETSRSEV+PTF+IP SF  I  +L ++     F SV RDQ R++L QDETLFYLFYKHP
Sbjct: 56  VETSRSEVQPTFFIPESFKNIKGMLGTDQVE--FTSVNRDQPRISLLQDETLFYLFYKHP 113

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSERGSYVFFDPQRWEKCQ 180
           G+VIQELTYLELRKRNWRYHKTLK WLTKDP MEPVV+ D +SERGSYVFFDPQRWEKCQ
Sbjct: 114 GSVIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVFFDPQRWEKCQ 173

Query: 181 RDFLLFYNAIM 191
           RDF+L YNAIM
Sbjct: 174 RDFVLHYNAIM 184

>Ecym_4726 Chr4 (1420080..1420655) [576 bp, 191 aa] {ON} similar to
           Ashbya gossypii ACL151C
          Length = 191

 Score =  253 bits (645), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 130/198 (65%), Positives = 146/198 (73%), Gaps = 14/198 (7%)

Query: 1   MDKFGLKALVPLVRQGDPEVASKYDHSMALGADLSSMLHSLGIP-RDSKRQAV------L 53
           M K+GLK+L+P+++        +YD SM LG DL S+LHSL +  RDS    +      L
Sbjct: 1   MSKYGLKSLLPVIKHD-----KQYDSSMTLGTDLPSILHSLQLTTRDSYNSGLNNGHHTL 55

Query: 54  ATFQSPWAETSRSEVEPTFYIPASFLGIDEVLQSESTPPCFDSVQRDQQRVALFQDETLF 113
            TF SPW ETSRSEVEP F+IP SF  I  VL   ST   F SV RD  R++L QDETLF
Sbjct: 56  DTFPSPWVETSRSEVEPKFFIPESFKNIVGVLGQPST--YFTSVARDHPRISLLQDETLF 113

Query: 114 YLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSERGSYVFFDP 173
           YLFYKHPGTV+QELTYLELRKRNWRYHKTLK WLTKDP MEP+VS D  SERGSYVFFDP
Sbjct: 114 YLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDP 173

Query: 174 QRWEKCQRDFLLFYNAIM 191
           QRWEKCQRDF+L YNAIM
Sbjct: 174 QRWEKCQRDFILNYNAIM 191

>ACL151C Chr3 complement(87037..87663) [627 bp, 208 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL165W
           (CDC36)
          Length = 208

 Score =  252 bits (643), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 143/198 (72%), Gaps = 14/198 (7%)

Query: 1   MDKFGLKALVPLVRQGDPEVASKYDHSMALGADLSSMLHSLGIPRD-------SKRQAVL 53
           MDK+GLK L+P+++        +YD  M LG D+SS+LHSL +          S     L
Sbjct: 18  MDKYGLKGLLPVIKH-----EKQYDAFMTLGVDVSSLLHSLQVSSKDGYNTALSNGHHAL 72

Query: 54  ATFQSPWAETSRSEVEPTFYIPASFLGIDEVLQSESTPPCFDSVQRDQQRVALFQDETLF 113
            TF SPW ETSRSEVEP F+IP SF  I  VL   ST   F SV RD  R++L QDETLF
Sbjct: 73  DTFPSPWVETSRSEVEPKFFIPESFCNIGGVLGQASTD--FTSVARDHPRISLLQDETLF 130

Query: 114 YLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSERGSYVFFDP 173
           YLFYKHPGTV+QELTYLELRKRNWRYHKTLK WLTKDP MEP+VS D  SERGSYVFFDP
Sbjct: 131 YLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDP 190

Query: 174 QRWEKCQRDFLLFYNAIM 191
           QRWEKCQRDF+L Y+AIM
Sbjct: 191 QRWEKCQRDFILNYSAIM 208

>SAKL0B08052g Chr2 (688482..690212) [1731 bp, 576 aa] {ON} highly
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 576

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 47/87 (54%), Gaps = 6/87 (6%)

Query: 104 VALFQDETLFYLFYKHPGTVIQELTYLEL-RKRNWRYHKTLKAWLTKDPTMEP--VVSPD 160
            + F  +TLF++FY + GT  Q L   EL + RNW+++K    W  K+    P  VVS +
Sbjct: 481 TSKFDLDTLFFIFYHYQGTYEQFLAARELSQNRNWQFNKLNHCWFYKEVEKLPPGVVSSE 540

Query: 161 GLSERGSYVFFDPQR-W--EKCQRDFL 184
              E  S+ +FD Q+ W   +C  DF+
Sbjct: 541 NKQEEISWRYFDYQKSWLARRCGSDFV 567

>TPHA0A03500 Chr1 complement(769721..771367) [1647 bp, 548 aa] {ON}
           Anc_3.370 YPR072W
          Length = 548

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 45/82 (54%), Gaps = 8/82 (9%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPTMEPVVSPD-GLSE 164
           F  +TLF++FY + GT  Q L   EL K RNW+Y+K  + W  K+ T     +PD   +E
Sbjct: 460 FDLDTLFFIFYHYQGTYEQFLVARELSKCRNWKYNKVDRNWYFKEVTK---SAPDMAQTE 516

Query: 165 RGSYVFFDPQR-W--EKCQRDF 183
             ++ +FD Q  W   +C  DF
Sbjct: 517 EETWRYFDYQNSWLARRCNHDF 538

>Kpol_1006.7 s1006 (30700..32322) [1623 bp, 540 aa] {ON}
           (30700..32322) [1623 nt, 541 aa]
          Length = 540

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 45/80 (56%), Gaps = 10/80 (12%)

Query: 110 ETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPTMEPVVSPDGL--SERG 166
           +TLF++FY + GT  Q L   EL K RNW+++K  + W  K+ T     SP G+  +E  
Sbjct: 455 DTLFFIFYHYQGTYEQFLVARELAKHRNWKFNKINRNWYYKEVTK----SPPGMQQAEEE 510

Query: 167 SYVFFDPQR-W--EKCQRDF 183
           ++ +FD Q  W   +C  DF
Sbjct: 511 TWRYFDYQNSWLARRCNSDF 530

>ZYRO0C16588g Chr3 (1293001..1294827) [1827 bp, 608 aa] {ON} highly
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 608

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 45/82 (54%), Gaps = 6/82 (7%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPTMEPVVSPDGLSER 165
           F  +TLF++FY + GT  Q L   EL K R W+++K  + W  K+  +E +      SE 
Sbjct: 519 FDLDTLFFIFYHYQGTYEQFLAARELAKNRKWKFNKVDRCWYYKE--VEKLPPGMAQSEE 576

Query: 166 GSYVFFDPQR-W--EKCQRDFL 184
            S+ +FD QR W   +C  DF+
Sbjct: 577 ESWRYFDYQRSWLARRCNSDFI 598

>KAFR0H00860 Chr8 complement(158881..160617) [1737 bp, 578 aa] {ON}
           Anc_3.370 YPR072W
          Length = 578

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 6/82 (7%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPTMEPVVSPDGLSER 165
           F  +TLF++FY + GT  Q L+  EL K RNW+++K  + W  K+  +E +      SE 
Sbjct: 490 FDLDTLFFIFYHYQGTYEQFLSSRELNKNRNWQFNKVDRCWYYKE--IEKLPPGMNKSEE 547

Query: 166 GSYVFFDPQR-W--EKCQRDFL 184
            S+ +FD ++ W   +C  DF+
Sbjct: 548 ESWRYFDYKKSWLARRCSPDFV 569

>Kwal_23.3962 s23 complement(502287..503948) [1662 bp, 553 aa] {ON}
           YPR072W (NOT5) - member of the NOT complex, a global
           negative regulator of transcription [contig 255] FULL
          Length = 553

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 49/86 (56%), Gaps = 9/86 (10%)

Query: 104 VALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDGL- 162
           ++ F  +TLF++FY + GT  Q L   EL  R W+++K  + W  K+  +E +  P G+ 
Sbjct: 463 MSKFDLDTLFFIFYHYQGTHEQFLAARELTMRGWQFNKVNRCWFYKE--VEKL--PPGME 518

Query: 163 -SERGSYVFFDPQR-W--EKCQRDFL 184
            SE  S+ +FD Q+ W   +C  DF+
Sbjct: 519 QSEEISWRYFDYQKSWLARRCGTDFV 544

>CAGL0D01342g Chr4 complement(149562..151208) [1647 bp, 548 aa] {ON}
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072w NOT5
          Length = 548

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 51/89 (57%), Gaps = 12/89 (13%)

Query: 106 LFQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPTMEPVVSPDGL-- 162
           +F  +TLF++FY + GT  Q L   EL K RNW+++K  + W  K+  +E +  P G+  
Sbjct: 459 MFDLDTLFFIFYHYQGTYEQFLAARELAKIRNWQFNKKDRCWYYKE--IEKL--PPGMTK 514

Query: 163 SERGSYVFFD-PQRW--EKCQRDFLLFYN 188
           SE  S+ +FD  + W   +C  DF+  YN
Sbjct: 515 SEEESWRYFDFKKSWLSRRCGSDFV--YN 541

>Smik_16.316 Chr16 (567157..568839) [1683 bp, 560 aa] {ON} YPR072W
           (REAL)
          Length = 560

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 46/82 (56%), Gaps = 6/82 (7%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLEL-RKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSER 165
           F  +TLF++FY + G+  Q L   EL + RNW ++K  + W  K+  +E +    G SE 
Sbjct: 472 FDLDTLFFIFYHYQGSYEQFLAARELYKNRNWLFNKVDRCWYYKE--IEKLPPGMGKSEE 529

Query: 166 GSYVFFDPQR-W--EKCQRDFL 184
            S+ +FD ++ W   +C  DF+
Sbjct: 530 ESWRYFDYKKSWLARRCGNDFV 551

>YPR072W Chr16 (690107..691789) [1683 bp, 560 aa] {ON}  NOT5Subunit
           of the CCR4-NOT complex, which is a global
           transcriptional regulator with roles in transcription
           initiation and elongation and in mRNA degradation
          Length = 560

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 46/82 (56%), Gaps = 6/82 (7%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLEL-RKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSER 165
           F  +TLF++FY + G+  Q L   EL + RNW ++K  + W  K+  +E +    G SE 
Sbjct: 472 FDLDTLFFIFYHYQGSYEQFLAARELFKNRNWLFNKVDRCWYYKE--IEKLPPGMGKSEE 529

Query: 166 GSYVFFDPQR-W--EKCQRDFL 184
            S+ +FD ++ W   +C  DF+
Sbjct: 530 ESWRYFDYKKSWLARRCGNDFV 551

>KLTH0F11880g Chr6 complement(1000583..1002274) [1692 bp, 563 aa]
           {ON} highly similar to uniprot|Q12514 Saccharomyces
           cerevisiae YPR072W NOT5 Subunit of global
           transcriptional regulator
          Length = 563

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 47/89 (52%), Gaps = 15/89 (16%)

Query: 104 VALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKD-----PTMEPVVS 158
           ++ F  +TLF++FY + GT  Q L+  EL  R W+++K  + W  K+     P ME    
Sbjct: 473 MSKFDLDTLFFIFYHYQGTYEQFLSARELSIRGWQFNKVNRCWFYKEVEKLPPGME---- 528

Query: 159 PDGLSERGSYVFFDPQR-W--EKCQRDFL 184
               SE  S+ +FD Q+ W   +C  +F+
Sbjct: 529 ---QSEEISWRYFDYQKSWLARRCGAEFV 554

>NDAI0A05080 Chr1 complement(1154530..1156257) [1728 bp, 575 aa]
           {ON} Anc_3.370
          Length = 575

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 43/82 (52%), Gaps = 4/82 (4%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPTMEPVVSPDGLSER 165
           F  +TLF++FY + GT  Q L   EL K R+W+Y+K    W  K+    P  +     E 
Sbjct: 485 FDLDTLFFIFYHYQGTYDQFLASRELSKNRDWKYNKVDYCWYYKEIEKLPPGANYNKDEE 544

Query: 166 GSYVFFDPQR-W--EKCQRDFL 184
            S+ +FD ++ W   +C  DF+
Sbjct: 545 ESWRYFDYKKSWLSRRCGNDFV 566

>TBLA0H01490 Chr8 complement(331583..333241) [1659 bp, 552 aa] {ON}
           Anc_3.370 YPR072W
          Length = 552

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 48/83 (57%), Gaps = 10/83 (12%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPTMEPVVSPDGL--S 163
           F  +TLF++FY + GT  Q L+  EL K RNW ++K  + W  ++  +E +  P GL  S
Sbjct: 463 FDLDTLFFIFYHYQGTYDQFLSARELAKNRNWEFNKVDRRWYYRE--VEKL--PPGLPQS 518

Query: 164 ERGSYVFFDPQR-W--EKCQRDF 183
           E  S+ +FD Q+ W   +C  +F
Sbjct: 519 EEISWRYFDYQKSWLSRRCNSNF 541

>Skud_16.361 Chr16 (655247..656929) [1683 bp, 560 aa] {ON} YPR072W
           (REAL)
          Length = 560

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 46/82 (56%), Gaps = 6/82 (7%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLEL-RKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSER 165
           F  +TLF++FY + G+  Q L   EL + RNW +++  + W  K+  +E +    G SE 
Sbjct: 472 FDLDTLFFIFYHYQGSYEQFLAARELYKNRNWLFNRVDRCWYYKE--IEKLPPGMGKSEE 529

Query: 166 GSYVFFDPQR-W--EKCQRDFL 184
            S+ +FD ++ W   +C  DF+
Sbjct: 530 ESWRYFDYKKSWLARRCGNDFV 551

>Suva_16.401 Chr16 (697328..699025) [1698 bp, 565 aa] {ON} YPR072W
           (REAL)
          Length = 565

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 46/82 (56%), Gaps = 6/82 (7%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLEL-RKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSER 165
           F  +TLF++FY + G+  Q L   EL + RNW +++  + W  K+  +E +    G SE 
Sbjct: 477 FDLDTLFFIFYHYQGSYEQFLAARELYKNRNWLFNRVDRCWYYKE--IEKLPPGMGKSEE 534

Query: 166 GSYVFFDPQR-W--EKCQRDFL 184
            S+ +FD ++ W   +C  DF+
Sbjct: 535 ESWRYFDYKKSWLARRCGNDFV 556

>KNAG0A07290 Chr1 (1139630..1141153) [1524 bp, 507 aa] {ON}
           Anc_3.370 YPR072W
          Length = 507

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 47/86 (54%), Gaps = 8/86 (9%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLELR-KRNWRYHKTLKAWLTKDPTMEPVVSPDGLSER 165
           F  +TLF++FY + GT  Q L   EL   R+W+++K  + W  K+  +E +      SE 
Sbjct: 419 FDLDTLFFIFYHYQGTYEQFLAARELSINRDWQFNKKDRCWYYKE--IEKLPPGMNKSEE 476

Query: 166 GSYVFFDPQR-W--EKCQRDFLLFYN 188
            S+ +FD ++ W   +C  DF+  YN
Sbjct: 477 ESWRYFDYKKSWLARRCNSDFV--YN 500

>Ecym_3456 Chr3 complement(853907..855433) [1527 bp, 508 aa] {ON}
           similar to Ashbya gossypii ADL364C
          Length = 508

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 48/88 (54%), Gaps = 9/88 (10%)

Query: 102 QRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDG 161
           Q +  F  +TLF++FY + GT  Q L   EL  R W +++  + W  ++  +E +  P G
Sbjct: 416 QILTKFDLDTLFFIFYHYQGTYEQFLAARELNIRGWLFNRVNRCWFYRE--VEKL--PPG 471

Query: 162 LSERG--SYVFFDPQR-W--EKCQRDFL 184
           + ++   S+ +FD Q+ W   +C  DF+
Sbjct: 472 MEQKEEVSWRYFDYQKSWLARRCGPDFV 499

>ADL364C Chr4 complement(66072..67586) [1515 bp, 504 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR072W
           (NOT5)
          Length = 504

 Score = 37.7 bits (86), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 47/89 (52%), Gaps = 9/89 (10%)

Query: 102 QRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDG 161
           Q +  F  +TLF++FY + GT  Q L   EL  R W +++  + W  K+  +E +  P G
Sbjct: 412 QIMTKFDLDTLFFIFYHYQGTYDQFLAARELIIRGWIFNRVNRCWFYKE--VEKL--PPG 467

Query: 162 L--SERGSYVFFDPQR-W--EKCQRDFLL 185
           +   E  S+ +FD Q+ W   +C  DF+ 
Sbjct: 468 MDQKEEVSWRYFDYQKSWLARRCGPDFVF 496

>TDEL0C05120 Chr3 (917832..919520) [1689 bp, 562 aa] {ON} Anc_3.370
           YPR072W
          Length = 562

 Score = 37.0 bits (84), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 46/84 (54%), Gaps = 10/84 (11%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPTMEPVVSPDGL--S 163
           F  +TLF++FY + GT  Q L   EL K R W+++K  + W  K+  +E +  P G+  +
Sbjct: 473 FDLDTLFFIFYHYQGTYDQFLAARELSKNRKWKFNKIDRCWYYKE--VEKL--PPGMLQA 528

Query: 164 ERGSYVFFDPQ-RW--EKCQRDFL 184
           E  S+ +FD Q  W   +C  D +
Sbjct: 529 EEESWRYFDYQGSWLARRCNNDVV 552

>KLLA0B09196g Chr2 complement(803259..805031) [1773 bp, 590 aa] {ON}
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 590

 Score = 35.4 bits (80), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 27/47 (57%)

Query: 104 VALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKD 150
           ++ F  +TLF++FY + G+  Q L   EL  R W ++K  + W  K+
Sbjct: 499 MSKFALDTLFFIFYHYQGSYDQFLASRELSLRGWTFNKVNRCWFHKE 545

>Kpol_1070.25 s1070
           complement(58286..59491,59501..59509,59592..60437) [2061
           bp, 686 aa] {ON}
           complement(58286..59491,59501..59509,59592..60437) [2061
           nt, 687 aa]
          Length = 686

 Score = 35.0 bits (79), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 52/103 (50%), Gaps = 9/103 (8%)

Query: 95  DSVQRDQQRVAL--FQDETLFYLFYKH--PGTVIQ-ELTYLELRKRNWRYHKTLKAWLTK 149
           D+   D+ R+ L  F+   +F LFY +  P T +Q +++ + L +R+W+  K    W  K
Sbjct: 543 DNTNEDKLRLVLERFRPTEIFTLFYHYYFPLTPLQKQISSILLIERDWKLLKNGTMWFLK 602

Query: 150 DPTMEPVVSPDGLSERGSYVFFDPQRWEKCQR-DFLLFYNAIM 191
               EP  S +   E G+Y  F    W   ++ +F L +N++M
Sbjct: 603 --QGEPKFSNESF-EVGNYKIFKADDWTVIEKFNFKLDFNSLM 642

>KLTH0A03652g Chr1 (314336..316654) [2319 bp, 772 aa] {ON} some
           similarities with uniprot|P06102 Saccharomyces
           cerevisiae YIL038C NOT3 Subunit of the CCR4-NOT complex
           which is a global transcriptional regulator with roles
           in transcription initiation and elongation and in mRNA
           degradation
          Length = 772

 Score = 35.0 bits (79), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%)

Query: 112 LFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTK 149
           LFY FY     + QE+ Y  L +RNW+  KT + W ++
Sbjct: 667 LFYCFYYSITPLEQEIAYTLLGERNWKVSKTGENWFSR 704

>ABR159C Chr2 complement(701341..702489) [1149 bp, 382 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR107W
          Length = 382

 Score = 33.5 bits (75), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 30/67 (44%), Gaps = 4/67 (5%)

Query: 43  IPRDSKRQAVLATFQSPWAET---SRSEVEPTFYIPASFLGIDEVLQSESTPPCFDS-VQ 98
           +  D  RQ V+  F+    +    S  ++ P  Y+PAS    ++++     PPC D  V 
Sbjct: 135 VAVDHGRQVVILAFRGSSTQQDWFSDMQIHPIAYVPASLTRYNKLVADGVIPPCVDCKVH 194

Query: 99  RDQQRVA 105
           R   R A
Sbjct: 195 RGFYRFA 201

>Suva_9.162 Chr9 complement(268759..271299) [2541 bp, 847 aa] {ON}
           YIL038C (REAL)
          Length = 847

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 43/96 (44%), Gaps = 6/96 (6%)

Query: 81  IDEVLQSESTPPCFDSVQRDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYH 140
           ID   Q ES+   +D +  + + + +F   TLFY +Y     + +E+ +  L +R+W+  
Sbjct: 691 IDSETQKESSSLVYDKILENFRTLEMF---TLFYNYYFSITPLEREIAFKILNERDWKVS 747

Query: 141 KTLKAWLTKDPTMEPVVSPDGLSERGSYVFFDPQRW 176
           K    W  +   ++     + + E G Y  F    W
Sbjct: 748 KDGAMWFLRQGEIKFF---NEICEVGDYKIFKLDDW 780

>NCAS0A11210 Chr1 (2223815..2225563) [1749 bp, 582 aa] {ON}
           Anc_3.370 YPR072W
          Length = 582

 Score = 30.8 bits (68), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLEL-RKRNWRYHKTLKAW 146
           F  +TLF++FY + GT  Q L   EL + R+W ++K    W
Sbjct: 480 FDLDTLFFIFYHYQGTYDQFLAARELSQNRHWLFNKVDSCW 520

>ZYRO0D16302g Chr4 (1357223..1359712) [2490 bp, 829 aa] {ON} similar
           to uniprot|P06102 Saccharomyces cerevisiae YIL038C NOT3
           Subunit of the CCR4-NOT complex which is a global
           transcriptional regulator with roles in transcription
           initiation and elongation and in mRNA degradation
          Length = 829

 Score = 30.4 bits (67), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 34/81 (41%), Gaps = 4/81 (4%)

Query: 111 TLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSERGSYVF 170
           TLFY +Y     + QE+  + L +R+W+  K    W  +    +     + L E   Y  
Sbjct: 712 TLFYNYYFAVTPLEQEIASIILSERDWKVSKNCAMWFLRQSETKFA---NELCEVADYKI 768

Query: 171 FDPQRWEKCQR-DFLLFYNAI 190
           F    W    R +F L Y A+
Sbjct: 769 FKLDDWTVIDRLNFKLDYAAL 789

>KAFR0A01380 Chr1 (268388..270607) [2220 bp, 739 aa] {ON} Anc_1.267
           YJL099W
          Length = 739

 Score = 30.0 bits (66), Expect = 3.7,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 44/92 (47%), Gaps = 7/92 (7%)

Query: 62  ETSRSEVEPTFYIPASFLGI---DEVLQSESTPPCFDSVQRDQQRVALFQDETLFYLFYK 118
           E S    E  +Y+   ++ +   D+ L + ++ P   +V   ++++    +ET+ Y FYK
Sbjct: 363 ELSLDSFECWYYLAKCYINLGEFDKALGAINSMPNLPAVDNIKKKIL---NETVLYDFYK 419

Query: 119 HPGTVIQELTYLELRKRNWRYHKTLKAWLTKD 150
            P    +EL  L+ R+  +    T+K W   D
Sbjct: 420 RPLGRSRELNELDSREF-YNLGSTMKKWRESD 450

>TBLA0D04270 Chr4 complement(1055025..1057568) [2544 bp, 847 aa]
           {ON} Anc_7.214 YIL038C
          Length = 847

 Score = 29.6 bits (65), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 3/66 (4%)

Query: 111 TLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSERGSYVF 170
           TLFY +Y     + +E++ + L +R+WR       W ++    E  +S D L E G Y  
Sbjct: 725 TLFYNYYFSVTPLEKEVSMVVLAERDWRITNNETMWFSRQG--EAKLS-DELYEIGDYRI 781

Query: 171 FDPQRW 176
           F  + W
Sbjct: 782 FSLEDW 787

>NDAI0A02690 Chr1 complement(603611..606151) [2541 bp, 846 aa] {ON}
           Anc_7.214
          Length = 846

 Score = 29.3 bits (64), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 36/81 (44%), Gaps = 4/81 (4%)

Query: 111 TLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSERGSYVF 170
           TLFY +Y     + +E+  + L +RNW+       W  +     P+   + L E G Y  
Sbjct: 719 TLFYNYYFAVTPLEKEIANVILNERNWKVSFDETMWFLR---QGPIKFQNELCELGDYKI 775

Query: 171 FDPQRWEKCQR-DFLLFYNAI 190
           F    W    + +F L Y+++
Sbjct: 776 FKLDEWLVVDKINFKLDYSSL 796

>Kwal_47.18114 s47 (692928..695219) [2292 bp, 763 aa] {ON} YIL038C
           (NOT3) - CCR4 trascriptional complex component [contig
           198] FULL
          Length = 763

 Score = 29.3 bits (64), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 39/80 (48%), Gaps = 4/80 (5%)

Query: 112 LFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSERGSYVFF 171
           LFY FY     + +E+ Y  L +R+W+  K+  +W ++     P  S + L E   +  F
Sbjct: 674 LFYCFYYSITPLEREIAYTLLIERSWKVSKSGDSWFSRHGV--PKFS-NELCEVADFKIF 730

Query: 172 DPQRWEKCQR-DFLLFYNAI 190
           +   W   ++ +F L Y+ +
Sbjct: 731 NLDDWTVSEKLNFKLDYSIL 750

>CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209c STE6
          Length = 1227

 Score = 29.3 bits (64), Expect = 7.7,   Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 5/63 (7%)

Query: 81   IDEVLQSESTPPCFDSVQRDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYH 140
            I++++ S S  P    V   ++ + L   + +F+L     GTV    TY EL + NW + 
Sbjct: 1168 INDIIGSRSLAPVTIIVSHQKETIKLC--DKIFFLV---DGTVAMMGTYEELMENNWEFR 1222

Query: 141  KTL 143
            K L
Sbjct: 1223 KLL 1225

>TDEL0H02330 Chr8 complement(391361..393799) [2439 bp, 812 aa] {ON}
           Anc_7.214 YIL038C
          Length = 812

 Score = 29.3 bits (64), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 36/81 (44%), Gaps = 4/81 (4%)

Query: 111 TLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSERGSYVF 170
           TLFY +Y     + Q +  L L +RNW+  K+   W  +    EP  + + + E   Y  
Sbjct: 692 TLFYNYYFAVTPLEQTIASLVLSERNWKVSKSGTLWFLR--QGEPKFA-NEVCEVADYKI 748

Query: 171 FDPQRWEKCQR-DFLLFYNAI 190
           F    W    + +F L Y A+
Sbjct: 749 FKLDDWTVADKPNFKLDYAAL 769

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 20,522,731
Number of extensions: 813197
Number of successful extensions: 1840
Number of sequences better than 10.0: 55
Number of HSP's gapped: 1821
Number of HSP's successfully gapped: 56
Length of query: 191
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 88
Effective length of database: 41,670,801
Effective search space: 3667030488
Effective search space used: 3667030488
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 62 (28.5 bits)