Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0C037507.346ON42442422920.0
KAFR0B008407.346ON42640915870.0
TDEL0C020207.346ON42540115280.0
Kpol_530.357.346ON42540415060.0
NDAI0E044807.346ON44340215010.0
CAGL0A03927g7.346ON43741614930.0
NCAS0E028807.346ON42940114880.0
TPHA0F029307.346ON43640214830.0
YLR203C (MSS51)7.346ON43640814800.0
Suva_10.2977.346ON43640814790.0
Skud_12.2667.346ON43642114720.0
Smik_12.2617.346ON43642714700.0
NCAS0A141207.346ON42740414670.0
SAKL0F11286g7.346ON42340214610.0
ZYRO0F11616g7.346ON41540414460.0
Ecym_47277.346ON42942914460.0
KLLA0D12430g7.346ON41840214400.0
KNAG0B026307.346ON43843714330.0
Kwal_56.246317.346ON42240214270.0
KLTH0H01342g7.346ON42240214220.0
NDAI0A019307.346ON45041514190.0
TBLA0E005007.346ON43740814110.0
ACL152W7.346ON42840014040.0
KLTH0G11418g8.357ON897106790.40
Kwal_27.113358.357ON898104722.4
Skud_12.1718.292ON650104679.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0C03750
         (424 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0C03750 Chr3 (740426..741700) [1275 bp, 424 aa] {ON} Anc_7.3...   887   0.0  
KAFR0B00840 Chr2 (159480..160760) [1281 bp, 426 aa] {ON} Anc_7.3...   615   0.0  
TDEL0C02020 Chr3 complement(349453..350730) [1278 bp, 425 aa] {O...   593   0.0  
Kpol_530.35 s530 complement(83032..84309) [1278 bp, 425 aa] {ON}...   584   0.0  
NDAI0E04480 Chr5 complement(1007346..1008677) [1332 bp, 443 aa] ...   582   0.0  
CAGL0A03927g Chr1 (397179..398492) [1314 bp, 437 aa] {ON} highly...   579   0.0  
NCAS0E02880 Chr5 complement(563006..564295) [1290 bp, 429 aa] {O...   577   0.0  
TPHA0F02930 Chr6 (647081..648391) [1311 bp, 436 aa] {ON} Anc_7.3...   575   0.0  
YLR203C Chr12 complement(550650..551960) [1311 bp, 436 aa] {ON} ...   574   0.0  
Suva_10.297 Chr10 complement(523465..524775) [1311 bp, 436 aa] {...   574   0.0  
Skud_12.266 Chr12 complement(497291..498601) [1311 bp, 436 aa] {...   571   0.0  
Smik_12.261 Chr12 complement(497673..498983) [1311 bp, 436 aa] {...   570   0.0  
NCAS0A14120 Chr1 (2777017..2778300) [1284 bp, 427 aa] {ON} Anc_7...   569   0.0  
SAKL0F11286g Chr6 (880536..881807) [1272 bp, 423 aa] {ON} simila...   567   0.0  
ZYRO0F11616g Chr6 (953577..954824) [1248 bp, 415 aa] {ON} simila...   561   0.0  
Ecym_4727 Chr4 complement(1420885..1422174) [1290 bp, 429 aa] {O...   561   0.0  
KLLA0D12430g Chr4 complement(1055878..1057134) [1257 bp, 418 aa]...   559   0.0  
KNAG0B02630 Chr2 complement(508645..509961) [1317 bp, 438 aa] {O...   556   0.0  
Kwal_56.24631 s56 (1080985..1082253) [1269 bp, 422 aa] {ON} YLR2...   554   0.0  
KLTH0H01342g Chr8 complement(125673..126941) [1269 bp, 422 aa] {...   552   0.0  
NDAI0A01930 Chr1 complement(430531..431883) [1353 bp, 450 aa] {O...   551   0.0  
TBLA0E00500 Chr5 (91769..93082) [1314 bp, 437 aa] {ON} Anc_7.346...   548   0.0  
ACL152W Chr3 (85701..86987) [1287 bp, 428 aa] {ON} Syntenic homo...   545   0.0  
KLTH0G11418g Chr7 (962267..964960) [2694 bp, 897 aa] {ON} simila...    35   0.40 
Kwal_27.11335 s27 complement(756212..758908) [2697 bp, 898 aa] {...    32   2.4  
Skud_12.171 Chr12 complement(327077..329029) [1953 bp, 650 aa] {...    30   9.2  

>KNAG0C03750 Chr3 (740426..741700) [1275 bp, 424 aa] {ON} Anc_7.346
           YLR203C
          Length = 424

 Score =  887 bits (2292), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/424 (100%), Positives = 424/424 (100%)

Query: 1   MLLSRVLTLGKHAPYESFHTEIVRYTFHRTIMGYVRNAFGLEPRDSPDTPQISNRFHPWE 60
           MLLSRVLTLGKHAPYESFHTEIVRYTFHRTIMGYVRNAFGLEPRDSPDTPQISNRFHPWE
Sbjct: 1   MLLSRVLTLGKHAPYESFHTEIVRYTFHRTIMGYVRNAFGLEPRDSPDTPQISNRFHPWE 60

Query: 61  ESPCADLRDRAARIKTLARCPVTGKNINYTCPISGIPTHHSRKAWEDDTDYHKNKTYEKL 120
           ESPCADLRDRAARIKTLARCPVTGKNINYTCPISGIPTHHSRKAWEDDTDYHKNKTYEKL
Sbjct: 61  ESPCADLRDRAARIKTLARCPVTGKNINYTCPISGIPTHHSRKAWEDDTDYHKNKTYEKL 120

Query: 121 KKVNIYEHDLRSGRSFPEFDFPAEQGRDRAVNLQNWDLFLYTRQFYSMDTEFHLATVTKM 180
           KKVNIYEHDLRSGRSFPEFDFPAEQGRDRAVNLQNWDLFLYTRQFYSMDTEFHLATVTKM
Sbjct: 121 KKVNIYEHDLRSGRSFPEFDFPAEQGRDRAVNLQNWDLFLYTRQFYSMDTEFHLATVTKM 180

Query: 181 LSYPITIASVLHEFSPYKLQPRGPVTLEGLKSIAALRYTLYPKLGKTSLSNNSPMRIFIV 240
           LSYPITIASVLHEFSPYKLQPRGPVTLEGLKSIAALRYTLYPKLGKTSLSNNSPMRIFIV
Sbjct: 181 LSYPITIASVLHEFSPYKLQPRGPVTLEGLKSIAALRYTLYPKLGKTSLSNNSPMRIFIV 240

Query: 241 GTRAESQLPGHVWKQLQYLFSERIFEIHFIGPECQLKEPKNTSTPLIKKVDDTLSLIYHP 300
           GTRAESQLPGHVWKQLQYLFSERIFEIHFIGPECQLKEPKNTSTPLIKKVDDTLSLIYHP
Sbjct: 241 GTRAESQLPGHVWKQLQYLFSERIFEIHFIGPECQLKEPKNTSTPLIKKVDDTLSLIYHP 300

Query: 301 QYFHELHKSGDLFPYNPYKDVFFIFHPGFAYPDTRKLWLDETIPNLLETKCAIFHTGFNE 360
           QYFHELHKSGDLFPYNPYKDVFFIFHPGFAYPDTRKLWLDETIPNLLETKCAIFHTGFNE
Sbjct: 301 QYFHELHKSGDLFPYNPYKDVFFIFHPGFAYPDTRKLWLDETIPNLLETKCAIFHTGFNE 360

Query: 361 GDITNDVTLIDKCYRNEIDVLMKPIKNVFGSVKWELNDINPQEVYQFNMYIAGFRGKRYH 420
           GDITNDVTLIDKCYRNEIDVLMKPIKNVFGSVKWELNDINPQEVYQFNMYIAGFRGKRYH
Sbjct: 361 GDITNDVTLIDKCYRNEIDVLMKPIKNVFGSVKWELNDINPQEVYQFNMYIAGFRGKRYH 420

Query: 421 PIKI 424
           PIKI
Sbjct: 421 PIKI 424

>KAFR0B00840 Chr2 (159480..160760) [1281 bp, 426 aa] {ON} Anc_7.346
           YLR203C
          Length = 426

 Score =  615 bits (1587), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/409 (67%), Positives = 345/409 (84%), Gaps = 6/409 (1%)

Query: 22  IVRYTFHRTIMGYVRNAFGLEPRDSPDTPQISNRFHPWEESPCADLRDRAARIKTLARCP 81
           + R    RT++G+VRNA GLEP  +PD P++SNRF+PW++SP  +LR+RAA+IK +ARCP
Sbjct: 18  LQRRVLSRTLVGFVRNALGLEPPPTPDEPRVSNRFYPWDQSPSPELRERAAKIKAMARCP 77

Query: 82  VTGKNINYTCPISGIPTHHSRKAWEDDTDYHKNKTYEKLKKVNIYEHDLRSGRSFPEFDF 141
           +TGK INYTCPISGIPTHHSR+AWE D  YH+NK  + LKKVNIYEHDLRSGRSFPEFDF
Sbjct: 78  ITGKEINYTCPISGIPTHHSREAWEQDEAYHRNKIPDILKKVNIYEHDLRSGRSFPEFDF 137

Query: 142 PAEQGRDRAVNLQNWDLFLYTRQFYSMDTEFHLATVTKMLSYPITIASVLHEFSPYKLQP 201
           P++Q  DRAVNL NWDL+ YTR FYSMDTEF LATVTKMLSYPITIASVLH++SPY L P
Sbjct: 138 PSDQTFDRAVNLANWDLYFYTRSFYSMDTEFQLATVTKMLSYPITIASVLHQYSPYSLYP 197

Query: 202 RGPVTLEGLKSIAALRYTLYPKLGKTS---LSNNSPMRIFIVGTRAESQLPGHVWKQLQY 258
            GP+TLEGLKSIAALRY+LYP   K+S   L+   PMRIFI+G RAESQLPGHVWKQ QY
Sbjct: 198 HGPITLEGLKSIAALRYSLYPSQHKSSRSVLNKTRPMRIFILGARAESQLPGHVWKQFQY 257

Query: 259 LFSERIFEIHFIGPECQLKEPKNT---STPLIKKVDDTLSLIYHPQYFHELHKSGDLFPY 315
           LF  + FEI FIGPECQL+EP N+   +  ++K++DDT+SL+YHP+ FH++HK+ D FPY
Sbjct: 258 LFPLQTFEIIFIGPECQLREPSNSVGGANNIVKRIDDTISLVYHPKLFHDIHKAQDFFPY 317

Query: 316 NPYKDVFFIFHPGFAYPDTRKLWLDETIPNLLETKCAIFHTGFNEGDITNDVTLIDKCYR 375
           +PY DVFF+FHPGFA P+T++LW+++T+  LL+TKCA+FHTGF++ D++NDV L++K Y 
Sbjct: 318 DPYNDVFFVFHPGFASPETKELWMNDTVKALLDTKCAVFHTGFSKKDLSNDVKLLNKMYG 377

Query: 376 NEIDVLMKPIKNVFGSVKWELNDINPQEVYQFNMYIAGFRGKRYHPIKI 424
           +++D LM P+KN+FGS KWELND+NPQEVYQFNMYI+ FRGKRYHPI+I
Sbjct: 378 DKLDTLMTPVKNLFGSTKWELNDLNPQEVYQFNMYISAFRGKRYHPIEI 426

>TDEL0C02020 Chr3 complement(349453..350730) [1278 bp, 425 aa] {ON}
           Anc_7.346 YLR203C
          Length = 425

 Score =  593 bits (1528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/401 (69%), Positives = 329/401 (82%), Gaps = 5/401 (1%)

Query: 29  RTIMGYVRNAFGLEPRDSPDTPQISNRFHPWEESPCADLRDRAARIKTLARCPVTGKNIN 88
           R I+G+VRNA GL+P  SPD P   NRFHPW++SP  DLR+RAARI+TLARCPVTGK IN
Sbjct: 25  RFIIGFVRNALGLDPPPSPDDPTPENRFHPWDQSPVGDLRERAARIRTLARCPVTGKEIN 84

Query: 89  YTCPISGIPTHHSRKAWEDDTDYHKNKTYEKLKKVNIYEHDLRSGRSFPEFDFPAEQGRD 148
           YTCP+SGIPTHHSR+AWE D  YH++K YE LKKVNIYEHDLRSGR FPEFDFP  Q  D
Sbjct: 85  YTCPLSGIPTHHSREAWEQDKQYHQSKKYEILKKVNIYEHDLRSGRPFPEFDFPQGQDFD 144

Query: 149 RAVNLQNWDLFLYTRQFYSMDTEFHLATVTKMLSYPITIASVLHEFSPYKLQPRGPVTLE 208
           R VN+ NWDLF YTRQFYSMDTEF LA VTKMLSYPI+IASVLH+FSPY L P+GPVTLE
Sbjct: 145 RTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPISIASVLHQFSPYSLNPKGPVTLE 204

Query: 209 GLKSIAALRYTLYPKLGKT-SLSNNSPMRIFIVGTRAESQLPGHVWKQLQYLFSERIFEI 267
           GLKS+AALRYTLYP   KT S + + PMRIFI+G RAE+QLPGHVWKQLQYLF E++FE+
Sbjct: 205 GLKSLAALRYTLYPLENKTISSTKDRPMRIFILGARAEAQLPGHVWKQLQYLFPEQMFEL 264

Query: 268 HFIGPECQLKEPKN----TSTPLIKKVDDTLSLIYHPQYFHELHKSGDLFPYNPYKDVFF 323
           HF+GPEC L + K+    +STP++K+VD+T+S +YH  +FH LH++ D FPY+PY DVFF
Sbjct: 265 HFVGPECLLNKEKHQYVTSSTPVVKRVDETISFVYHTDFFHVLHEAQDFFPYDPYLDVFF 324

Query: 324 IFHPGFAYPDTRKLWLDETIPNLLETKCAIFHTGFNEGDITNDVTLIDKCYRNEIDVLMK 383
            FHPGF  P+T   WL+ET+  LLETKCAIF TGFN+ D+  DV  +   Y  E+DVLM+
Sbjct: 325 CFHPGFGAPETSASWLNETMKGLLETKCAIFTTGFNKADLLRDVDAVKDKYGKEVDVLME 384

Query: 384 PIKNVFGSVKWELNDINPQEVYQFNMYIAGFRGKRYHPIKI 424
           P+KNVFGS KWELND+NPQEVYQFNMYIAGFRGKRYH I++
Sbjct: 385 PVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 425

>Kpol_530.35 s530 complement(83032..84309) [1278 bp, 425 aa] {ON}
           complement(83032..84309) [1278 nt, 426 aa]
          Length = 425

 Score =  584 bits (1506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/404 (67%), Positives = 330/404 (81%), Gaps = 8/404 (1%)

Query: 29  RTIMGYVRNAFGLEPRDSPDTPQISNRFHPWEESPCADLRDRAARIKTLARCPVTGKNIN 88
           R++MG+VRNA GL+P  SPD P   NRFHPW++SPC DLR+RAA+I+TLA+CPVT K+IN
Sbjct: 22  RSLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPCVDLRERAAKIRTLAKCPVTHKDIN 81

Query: 89  YTCPISGIPTHHSRKAWEDDTDYHKNKTYEKLKKVNIYEHDLRSGRSFPEFDFPAEQGRD 148
           YTCP+SGIPTHH ++AW  D DYH++K YE LKKVNIYEHDLRSGR FPEFDFP +Q  D
Sbjct: 82  YTCPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYEHDLRSGRPFPEFDFPQDQDYD 141

Query: 149 RAVNLQNWDLFLYTRQFYSMDTEFHLATVTKMLSYPITIASVLHEFSPYKLQPRGPVTLE 208
           R +NL NWDLF YTR FYSMDTEF LA VTKMLSYPITI S+LH+FSPY L P+GPVTLE
Sbjct: 142 RLINLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHQFSPYSLNPKGPVTLE 201

Query: 209 GLKSIAALRYTLYPKLGKTS----LSNNSPMRIFIVGTRAESQLPGHVWKQLQYLFSERI 264
           GLKS+AALRYTLYP   K+      + + PMRIFI+G RAE+QLPGHVWKQ QYLF E+ 
Sbjct: 202 GLKSLAALRYTLYPYQNKSQNVKVNTRDRPMRIFILGARAEAQLPGHVWKQFQYLFPEQE 261

Query: 265 FEIHFIGPECQLKEPKN----TSTPLIKKVDDTLSLIYHPQYFHELHKSGDLFPYNPYKD 320
           FEIHFIGPEC L + KN    +STP++KKVDDTL L++HP YFH  H++ D FPY+P+ D
Sbjct: 262 FEIHFIGPECYLNKEKNQYITSSTPIVKKVDDTLKLVFHPDYFHVFHEAQDFFPYDPFLD 321

Query: 321 VFFIFHPGFAYPDTRKLWLDETIPNLLETKCAIFHTGFNEGDITNDVTLIDKCYRNEIDV 380
           VFF FHPG+AYP+T ++WL ET+  LL+TKCAIF TGF++ D+  D+ ++   Y NE+D+
Sbjct: 322 VFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFSKQDLLRDIDVVKNRYGNELDM 381

Query: 381 LMKPIKNVFGSVKWELNDINPQEVYQFNMYIAGFRGKRYHPIKI 424
           LM P+KNVFGS KWELND+NPQEVYQFNMYIAGFRGKRYH I++
Sbjct: 382 LMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 425

>NDAI0E04480 Chr5 complement(1007346..1008677) [1332 bp, 443 aa]
           {ON} Anc_7.346 YLR203C
          Length = 443

 Score =  582 bits (1501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/402 (66%), Positives = 329/402 (81%), Gaps = 6/402 (1%)

Query: 29  RTIMGYVRNAFGLEPRDSPDTPQISNRFHPWEESPCADLRDRAARIKTLARCPVTGKNIN 88
           R++MG+VRNA GL+P+ SPD P   NRFHPW++SPC DLR+RAA+I+TLA CPVT K IN
Sbjct: 42  RSLMGFVRNALGLDPKSSPDDPTPENRFHPWDQSPCQDLRERAAKIRTLAHCPVTNKEIN 101

Query: 89  YTCPISGIPTHHSRKAWEDDTDYHKNKTYEKLKKVNIYEHDLRSGRSFPEFDFPAEQGRD 148
           YTCPISGIPTHHS+ AWE D +YH NK YE LKKVNIYEHDLRSGR FPEF FP +Q  D
Sbjct: 102 YTCPISGIPTHHSKNAWEMDENYHSNKIYEILKKVNIYEHDLRSGRPFPEFVFPQDQDFD 161

Query: 149 RAVNLQNWDLFLYTRQFYSMDTEFHLATVTKMLSYPITIASVLHEFSPYKLQPRGPVTLE 208
           R +N+ NWDLFLYTR FYSMDTEF +A VTKMLSYPITI S+LH+FSPY LQP+GP+TLE
Sbjct: 162 RMINMTNWDLFLYTRSFYSMDTEFQMAAVTKMLSYPITIGSILHQFSPYSLQPKGPITLE 221

Query: 209 GLKSIAALRYTLYPKLGKT--SLSNNSPMRIFIVGTRAESQLPGHVWKQLQYLFSERIFE 266
           GLKS+AALRYTLYP   K+  +L+ N PMRIF++G RAE+QLPGH+WKQLQYLF E+ FE
Sbjct: 222 GLKSMAALRYTLYPFHNKSFMTLTKNRPMRIFLLGARAEAQLPGHIWKQLQYLFPEQKFE 281

Query: 267 IHFIGPECQLKEPKNT----STPLIKKVDDTLSLIYHPQYFHELHKSGDLFPYNPYKDVF 322
           + FIGPE    + K        PLI+ +DDTL L +  +YFH LH+S DLFPY+PY DVF
Sbjct: 282 LFFIGPEAYYDKEKKQYLKLDKPLIQTIDDTLKLTFITEYFHTLHESQDLFPYDPYMDVF 341

Query: 323 FIFHPGFAYPDTRKLWLDETIPNLLETKCAIFHTGFNEGDITNDVTLIDKCYRNEIDVLM 382
           FIFHPGF+  +T + W+++T+ +LLET+CAIF+TGF+  D+ ND+ ++D+ Y+N++D+LM
Sbjct: 342 FIFHPGFSAIETTEHWMNDTMKSLLETQCAIFNTGFSRNDMLNDMNILDEKYKNDLDILM 401

Query: 383 KPIKNVFGSVKWELNDINPQEVYQFNMYIAGFRGKRYHPIKI 424
           KP+KNVFGS KWELND+NPQ+VYQFNMYIAGFRGKRY  +++
Sbjct: 402 KPVKNVFGSTKWELNDLNPQDVYQFNMYIAGFRGKRYPTVEL 443

>CAGL0A03927g Chr1 (397179..398492) [1314 bp, 437 aa] {ON} highly
           similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203c MSS51
          Length = 437

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/416 (64%), Positives = 320/416 (76%), Gaps = 20/416 (4%)

Query: 29  RTIMGYVRNAFGLEPRDSPDTPQISNRFHPWEESPCADLRDRAARIKTLARCPVTGKNIN 88
           R +MG+VRNA GL+P  SPD P   NRFHPW++SP  DLR+RAARIKTLA+CPVT K I 
Sbjct: 22  RQLMGFVRNALGLDPPPSPDEPTEQNRFHPWDQSPAVDLRERAARIKTLAKCPVTHKPIQ 81

Query: 89  YTCPISGIPTHHSRKAWEDDTDYHKNKTYEKLKKVNIYEHDLRSGRSFPEFDFPAEQGRD 148
           YTCPISGIPTHHSR+AWE D +YH +K YE LKKVNIYEHDLRSGR FPEFDFP +QG D
Sbjct: 82  YTCPISGIPTHHSREAWEQDKEYHASKKYEILKKVNIYEHDLRSGRPFPEFDFPRDQGPD 141

Query: 149 RAVNLQNWDLFLYTRQFYSMDTEFHLATVTKMLSYPITIASVLHEFSPYKLQPRGPVTLE 208
           R VNL NWDLFLYTR FYSMDTEF LA VTKMLSYPITI SVLH+FSPY L P+GP+TLE
Sbjct: 142 RTVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQFSPYSLNPKGPITLE 201

Query: 209 GLKSIAALRYTLYPKLGK--TSLSNNSPMRIFIVGTRAESQLPGHVWKQLQYLFSERIFE 266
           GLKS+AALRYTLYP   +  T+ + N PMRIFI+G RAE+QLPGHVWKQLQ+LF ++ FE
Sbjct: 202 GLKSLAALRYTLYPLQNRAVTTTAKNKPMRIFILGARAEAQLPGHVWKQLQFLFPQQNFE 261

Query: 267 IHFIGPECQLKEPKN------------------TSTPLIKKVDDTLSLIYHPQYFHELHK 308
           IHFIGPE      +N                  +S P+ K++D+T+   YH  YFH LH 
Sbjct: 262 IHFIGPESLYDRERNEYIRSATANGETAADGTTSSIPVTKRIDETMKFFYHTDYFHTLHT 321

Query: 309 SGDLFPYNPYKDVFFIFHPGFAYPDTRKLWLDETIPNLLETKCAIFHTGFNEGDITNDVT 368
           + D FPY+PY+DVFF+FHPG A P+++  W+ +T+  LL+TKCAIF TGFN+ D+ +D+ 
Sbjct: 322 AQDFFPYDPYQDVFFMFHPGLASPESKDTWMKDTVKGLLDTKCAIFTTGFNKKDMADDIQ 381

Query: 369 LIDKCYRNEIDVLMKPIKNVFGSVKWELNDINPQEVYQFNMYIAGFRGKRYHPIKI 424
           ++   Y  E+D+LM P+KNVFGS KWEL+D +P  VYQFNMYIAGFRGKRYHPIK+
Sbjct: 382 ILQDTYGKEMDMLMNPVKNVFGSTKWELDDSDPHSVYQFNMYIAGFRGKRYHPIKV 437

>NCAS0E02880 Chr5 complement(563006..564295) [1290 bp, 429 aa] {ON}
           Anc_7.346 YLR203C
          Length = 429

 Score =  577 bits (1488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/401 (68%), Positives = 322/401 (80%), Gaps = 6/401 (1%)

Query: 29  RTIMGYVRNAFGLEPRDSPDTPQISNRFHPWEESPCADLRDRAARIKTLARCPVTGKNIN 88
           R +MG+VRNA GL+P  SPD P   NRFHPW++SP  DLR+RAARI+TLARCPVTGK IN
Sbjct: 28  RHLMGFVRNALGLDPPTSPDDPTPENRFHPWDQSPSPDLRERAARIRTLARCPVTGKEIN 87

Query: 89  YTCPISGIPTHHSRKAWEDDTDYHKNKTYEKLKKVNIYEHDLRSGRSFPEFDFPAEQGRD 148
           YTCPISGIPTHHSR+AWE D +YH +K YE LKKVNIYEHDLRSGR FPEFDFP +QG+D
Sbjct: 88  YTCPISGIPTHHSREAWEQDKEYHASKRYELLKKVNIYEHDLRSGRPFPEFDFPRDQGQD 147

Query: 149 RAVNLQNWDLFLYTRQFYSMDTEFHLATVTKMLSYPITIASVLHEFSPYKLQPRGPVTLE 208
           R VN+ NWDLFLYTR FYSMDTEF +A VTKMLSYPITI SVLH+FSPY LQP+GP++LE
Sbjct: 148 RMVNMTNWDLFLYTRAFYSMDTEFQMAAVTKMLSYPITIGSVLHQFSPYSLQPKGPISLE 207

Query: 209 GLKSIAALRYTLYPKLGKTSLSNNS--PMRIFIVGTRAESQLPGHVWKQLQYLFSERIFE 266
           GLKS+AALRYTLYP   +  +S     PMRIFI+G RAESQLPGHVWKQLQYLF E+ FE
Sbjct: 208 GLKSLAALRYTLYPMQNRLVISTTKARPMRIFILGARAESQLPGHVWKQLQYLFPEQTFE 267

Query: 267 IHFIGPECQLKEPK----NTSTPLIKKVDDTLSLIYHPQYFHELHKSGDLFPYNPYKDVF 322
           IHFIGPE    + K      +TP+ + VD+TL LIYH +YFH+LH++ D FPY+PY DVF
Sbjct: 268 IHFIGPESYYDKDKKKYIQLTTPITESVDETLKLIYHTEYFHKLHEAQDFFPYDPYMDVF 327

Query: 323 FIFHPGFAYPDTRKLWLDETIPNLLETKCAIFHTGFNEGDITNDVTLIDKCYRNEIDVLM 382
           FIFHPGFA  +  + W+ +T+  LL+TKCAIF TGF + D+  D+ ++   Y  E+D+LM
Sbjct: 328 FIFHPGFASAEIGEHWMKDTMKGLLDTKCAIFTTGFTKNDLLEDIAVVQDKYGKELDILM 387

Query: 383 KPIKNVFGSVKWELNDINPQEVYQFNMYIAGFRGKRYHPIK 423
           KP KNVFGS KWELND+NPQEVYQFNMYIAGFRGKRY  IK
Sbjct: 388 KPTKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYPTIK 428

>TPHA0F02930 Chr6 (647081..648391) [1311 bp, 436 aa] {ON} Anc_7.346
           YLR203C
          Length = 436

 Score =  575 bits (1483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/402 (67%), Positives = 325/402 (80%), Gaps = 7/402 (1%)

Query: 29  RTIMGYVRNAFGLEPRDSPDTPQISNRFHPWEESPCADLRDRAARIKTLARCPVTGKNIN 88
           R++MG+V+NA GL+P  SPD P   NRFHPW++SP  DLR+RAARI+TLA+CPVT K IN
Sbjct: 34  RSLMGFVKNALGLDPSPSPDDPTPENRFHPWDQSPSPDLRERAARIRTLAKCPVTKKEIN 93

Query: 89  YTCPISGIPTHHSRKAWEDDTDYHKNKTYEKLKKVNIYEHDLRSGRSFPEFDFPAEQGRD 148
           YTCP+SGIPTHHSR+AWE D DYH++K YE LKKVNIYEHDLRSGR FPEFDFP +Q  D
Sbjct: 94  YTCPLSGIPTHHSREAWEADKDYHQSKRYEILKKVNIYEHDLRSGRPFPEFDFPLDQIHD 153

Query: 149 RAVNLQNWDLFLYTRQFYSMDTEFHLATVTKMLSYPITIASVLHEFSPYKLQPRGPVTLE 208
           R VNL NWDLF YTR FYSMDTEF LA VTKMLSYP+TI S+LH+FSPY L P+GP+TLE
Sbjct: 154 RVVNLTNWDLFFYTRNFYSMDTEFQLAAVTKMLSYPMTIGSILHQFSPYSLNPKGPITLE 213

Query: 209 GLKSIAALRYTLYPKLGKTSLS---NNSPMRIFIVGTRAESQLPGHVWKQLQYLFSERIF 265
           GLKS+AALRY+LYP   K+++S   ++ PMRIFI+G RAE+QLPGHVWKQLQ+LF ++ F
Sbjct: 214 GLKSLAALRYSLYPFQRKSNISLKLHDRPMRIFILGARAEAQLPGHVWKQLQFLFPDQTF 273

Query: 266 EIHFIGPECQLKEPKN----TSTPLIKKVDDTLSLIYHPQYFHELHKSGDLFPYNPYKDV 321
           EIHFIG EC L   KN    ++ P++KK+D+T+ LIYH  YFH  H++ D  PY+PY DV
Sbjct: 274 EIHFIGTECLLNNEKNKYIKSAIPVVKKIDETMKLIYHSDYFHVYHEAQDFVPYDPYLDV 333

Query: 322 FFIFHPGFAYPDTRKLWLDETIPNLLETKCAIFHTGFNEGDITNDVTLIDKCYRNEIDVL 381
           FF FHPGFA P+T  LW+ +T+  LLETKCAIF TGFN+ DITNDV ++   Y  E+D L
Sbjct: 334 FFTFHPGFAAPETSDLWMGDTMKALLETKCAIFTTGFNKQDITNDVEIVKARYGKEMDTL 393

Query: 382 MKPIKNVFGSVKWELNDINPQEVYQFNMYIAGFRGKRYHPIK 423
           M PIKN +GS KWELND+NPQE++QFNMY+AGFRGKRYH IK
Sbjct: 394 MDPIKNSYGSTKWELNDMNPQEIFQFNMYVAGFRGKRYHTIK 435

>YLR203C Chr12 complement(550650..551960) [1311 bp, 436 aa] {ON}
           MSS51Specific translational activator for the
           mitochondrial COX1 mRNA; loosely associated with the
           matrix face of the mitochondrial inner membrane;
           influences both COX1 mRNA translation and Cox1p assembly
           into cytochrome c oxidase
          Length = 436

 Score =  574 bits (1480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/408 (66%), Positives = 326/408 (79%), Gaps = 6/408 (1%)

Query: 22  IVRYTFHRTIMGYVRNAFGLEPRDSPDTPQISNRFHPWEESPCADLRDRAARIKTLARCP 81
           +V +   R +MG+VRNA GL+P  SP+ P   NRFHPW++SP  DLR+RAA+I+TLA CP
Sbjct: 27  VVSHQTRRHLMGFVRNALGLDPPPSPEDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCP 86

Query: 82  VTGKNINYTCPISGIPTHHSRKAWEDDTDYHKNKTYEKLKKVNIYEHDLRSGRSFPEFDF 141
           VTGK+INYTCP+SGIPTHHSR+AWE D  YH +K YE LKKVNIYEHDLRSGR FPEFDF
Sbjct: 87  VTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDF 146

Query: 142 PAEQGRDRAVNLQNWDLFLYTRQFYSMDTEFHLATVTKMLSYPITIASVLHEFSPYKLQP 201
           P +QG D+AVNL NWDLF YTR FYSMDTEF LA VTKMLSYPITI S+LH+FSPY L P
Sbjct: 147 PQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNP 206

Query: 202 RGPVTLEGLKSIAALRYTLYPKLGKT--SLSNNSPMRIFIVGTRAESQLPGHVWKQLQYL 259
           +GP+TLEGLKS+AALRYTLYP   ++  + + N  MRIFI+G RAE+QLPGHVWKQLQ+L
Sbjct: 207 KGPITLEGLKSLAALRYTLYPLENRSLPTTTKNRAMRIFILGARAEAQLPGHVWKQLQFL 266

Query: 260 FSERIFEIHFIGPECQLKEPKN----TSTPLIKKVDDTLSLIYHPQYFHELHKSGDLFPY 315
           F E+ FEIHFIGPEC  K  K     ++TP++++VD+TL  IY   +F   H++ D FPY
Sbjct: 267 FPEQSFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIYRTNFFEVFHEAQDFFPY 326

Query: 316 NPYKDVFFIFHPGFAYPDTRKLWLDETIPNLLETKCAIFHTGFNEGDITNDVTLIDKCYR 375
           +PY DVFF FHPG+A P++   W+ ET+  LLETKCAIF TGFN+ D+T+D+ L+   Y 
Sbjct: 327 DPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDINLVKSKYG 386

Query: 376 NEIDVLMKPIKNVFGSVKWELNDINPQEVYQFNMYIAGFRGKRYHPIK 423
            E+DVLM+P++NVFGS KWELND+NPQEVYQFNMYIAGFRGKRYH IK
Sbjct: 387 KEMDVLMEPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434

>Suva_10.297 Chr10 complement(523465..524775) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  574 bits (1479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/408 (66%), Positives = 325/408 (79%), Gaps = 6/408 (1%)

Query: 22  IVRYTFHRTIMGYVRNAFGLEPRDSPDTPQISNRFHPWEESPCADLRDRAARIKTLARCP 81
           +V +   R +MG+VRNA GL+P  SPD P   NRFHPW++SP  DLR+RAA+I+TLA CP
Sbjct: 27  VVSHQTRRHLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCP 86

Query: 82  VTGKNINYTCPISGIPTHHSRKAWEDDTDYHKNKTYEKLKKVNIYEHDLRSGRSFPEFDF 141
           VTGK+INYTCP+SGIPTHHSR+AWE D  YH +K YE LKKVNIYEHDLRSGR FPEFDF
Sbjct: 87  VTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDF 146

Query: 142 PAEQGRDRAVNLQNWDLFLYTRQFYSMDTEFHLATVTKMLSYPITIASVLHEFSPYKLQP 201
           P +QG D+AVNL NWDLFLYTR FYSMDTEF LA VTKMLSYPITI S+LH+FSPY L P
Sbjct: 147 PQQQGYDKAVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNP 206

Query: 202 RGPVTLEGLKSIAALRYTLYPKLGKTSLSN--NSPMRIFIVGTRAESQLPGHVWKQLQYL 259
           +GP+TLEGLKS+AALRYTLYP   ++ L+   N  MRIFI+G RAE+QLPGHVWKQLQ+L
Sbjct: 207 KGPITLEGLKSLAALRYTLYPLENRSVLATTRNRAMRIFILGARAEAQLPGHVWKQLQFL 266

Query: 260 FSERIFEIHFIGPECQLKEPKN----TSTPLIKKVDDTLSLIYHPQYFHELHKSGDLFPY 315
           F E+ FEIHFIGPEC  K  K     ++TP+++++D+TL   +H  +F   H++ D FPY
Sbjct: 267 FPEQNFEIHFIGPECLYKRDKQEYVKSATPVVQRIDETLKFFHHTDFFQVFHEAQDFFPY 326

Query: 316 NPYKDVFFIFHPGFAYPDTRKLWLDETIPNLLETKCAIFHTGFNEGDITNDVTLIDKCYR 375
           +PY DVFF FHPG+A P++   W+ ET+  LLETKCAIF TGFN+ D+ +D+ L+   Y 
Sbjct: 327 DPYMDVFFTFHPGYASPESHGSWMGETMTALLETKCAIFTTGFNKKDLMDDINLVKSKYG 386

Query: 376 NEIDVLMKPIKNVFGSVKWELNDINPQEVYQFNMYIAGFRGKRYHPIK 423
            E+D+LM P+KNVFGS KWELND+NPQEVYQFNMYIAGFRGKRYH IK
Sbjct: 387 KEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434

>Skud_12.266 Chr12 complement(497291..498601) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/421 (64%), Positives = 329/421 (78%), Gaps = 9/421 (2%)

Query: 9   LGKHAPYESFHTEIVRYTFHRTIMGYVRNAFGLEPRDSPDTPQISNRFHPWEESPCADLR 68
           L + +PY      +V +   R +MG+VRNA GL+P  SPD P   NRFHPW++SP  DLR
Sbjct: 17  LLRRSPYNRL---VVYHQTRRHLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSVDLR 73

Query: 69  DRAARIKTLARCPVTGKNINYTCPISGIPTHHSRKAWEDDTDYHKNKTYEKLKKVNIYEH 128
           +RAA+I+TLA CPVTGK+INYTCP+SGIPTHHSR+AWE D  YH +K YE LKKVNIYEH
Sbjct: 74  ERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKTYHDSKKYEILKKVNIYEH 133

Query: 129 DLRSGRSFPEFDFPAEQGRDRAVNLQNWDLFLYTRQFYSMDTEFHLATVTKMLSYPITIA 188
           DLRSGR FPEFDFP +QG D+AVNL NWDLF YTR FYSMDTEF LA VTKMLSYPITI 
Sbjct: 134 DLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIG 193

Query: 189 SVLHEFSPYKLQPRGPVTLEGLKSIAALRYTLYPKLGKTSLSN--NSPMRIFIVGTRAES 246
           SVLH+FSPY L P+GP+TLEGLKS+AALRYTLYP   ++ L+   N  MRIFI+G RAE+
Sbjct: 194 SVLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSVLATTKNRAMRIFILGARAEA 253

Query: 247 QLPGHVWKQLQYLFSERIFEIHFIGPECQLKEPKN----TSTPLIKKVDDTLSLIYHPQY 302
           QLPGHVWKQLQ+LF E+ FEIHF+GPEC  K  K     ++TP++++VD+TL  I+H  +
Sbjct: 254 QLPGHVWKQLQFLFPEQNFEIHFVGPECLYKRDKQEYVKSATPVVQRVDETLRFIHHTDF 313

Query: 303 FHELHKSGDLFPYNPYKDVFFIFHPGFAYPDTRKLWLDETIPNLLETKCAIFHTGFNEGD 362
           F   H++ D FPY+PY DVFF FHPG+A P++   W+ ET+  LLETKCAIF TGFN+ D
Sbjct: 314 FDVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMRALLETKCAIFTTGFNKKD 373

Query: 363 ITNDVTLIDKCYRNEIDVLMKPIKNVFGSVKWELNDINPQEVYQFNMYIAGFRGKRYHPI 422
           + +D+  +   Y  E+D+LM P++NVFGS KWELND+NPQEVYQFNMYIAGFRGKRYH I
Sbjct: 374 LMDDINAVKSKYGKEMDILMDPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTI 433

Query: 423 K 423
           K
Sbjct: 434 K 434

>Smik_12.261 Chr12 complement(497673..498983) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  570 bits (1470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/427 (64%), Positives = 329/427 (77%), Gaps = 7/427 (1%)

Query: 4   SRVLTLGKHAPYESFHTEIV-RYTFHRTIMGYVRNAFGLEPRDSPDTPQISNRFHPWEES 62
           S    L  H    S H  +V  +   R +MG+VRNA GL+P  SPD P   NRFHPW++S
Sbjct: 8   SGATQLYSHLLRRSSHNRLVLSHQTRRHLMGFVRNALGLDPPPSPDDPTPENRFHPWDQS 67

Query: 63  PCADLRDRAARIKTLARCPVTGKNINYTCPISGIPTHHSRKAWEDDTDYHKNKTYEKLKK 122
           P  DLR+RAA+I+TLA CPVTGK+INYTCP+SGIPTHHSR+AWE D  YH +K YE LKK
Sbjct: 68  PSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKK 127

Query: 123 VNIYEHDLRSGRSFPEFDFPAEQGRDRAVNLQNWDLFLYTRQFYSMDTEFHLATVTKMLS 182
           VNIYEHDLRSGR FPEFDFP  QG D+AVNL NWDLF YTR FYSMDTEF LA VTKMLS
Sbjct: 128 VNIYEHDLRSGRPFPEFDFPQNQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLS 187

Query: 183 YPITIASVLHEFSPYKLQPRGPVTLEGLKSIAALRYTLYPKLGKTSL--SNNSPMRIFIV 240
           YPITI S+LH+FSPY L P+GP+TLEGLKS+AALRYTLYP   ++ L  + N  MRIFI+
Sbjct: 188 YPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSLLTATKNRAMRIFIL 247

Query: 241 GTRAESQLPGHVWKQLQYLFSERIFEIHFIGPECQLKEPKN----TSTPLIKKVDDTLSL 296
           G RAE+QLPGHVWKQLQ+LF E+ FEIHFIGPEC  K  K     ++TP++++VD+TL  
Sbjct: 248 GARAEAQLPGHVWKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKF 307

Query: 297 IYHPQYFHELHKSGDLFPYNPYKDVFFIFHPGFAYPDTRKLWLDETIPNLLETKCAIFHT 356
           I+   +F   H++ D FPY+PY DVFF FHPG+A P++   W+ ET+  LLETKCAIF T
Sbjct: 308 IHRTDFFEVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTT 367

Query: 357 GFNEGDITNDVTLIDKCYRNEIDVLMKPIKNVFGSVKWELNDINPQEVYQFNMYIAGFRG 416
           GFN+ D+T+D+ L+   Y  E+D+LM P+KNVFGS KWELND+NPQEVYQFNMYIAGFRG
Sbjct: 368 GFNKKDLTDDLNLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRG 427

Query: 417 KRYHPIK 423
           KRYH IK
Sbjct: 428 KRYHTIK 434

>NCAS0A14120 Chr1 (2777017..2778300) [1284 bp, 427 aa] {ON}
           Anc_7.346 YLR203C
          Length = 427

 Score =  569 bits (1467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/404 (63%), Positives = 323/404 (79%), Gaps = 6/404 (1%)

Query: 24  RYTFHRTIMGYVRNAFGLEPRDSPDTPQISNRFHPWEESPCADLRDRAARIKTLARCPVT 83
           R + HRT++G+V+NA G++P   P  P  +NRF+PW+ESP   +R+RAARIK  A+CPVT
Sbjct: 25  RISSHRTLVGFVKNALGIDPPPLPTEPVFANRFYPWDESPSPAIRERAARIKAQAKCPVT 84

Query: 84  GKNINYTCPISGIPTHHSRKAWEDDTDYHKNKTYEKLKKVNIYEHDLRSGRSFPEFDFPA 143
           GK I +TCP+SGIPTH+S++AWE+DT+YHKNK YEKL+KVNIYEHDLRSGR FPEFDFP 
Sbjct: 85  GKEIRFTCPLSGIPTHYSKEAWENDTNYHKNKIYEKLRKVNIYEHDLRSGRPFPEFDFPG 144

Query: 144 EQGRDRAVNLQNWDLFLYTRQFYSMDTEFHLATVTKMLSYPITIASVLHEFSPYKLQPRG 203
           EQ RD  VN+ NWDLF YTRQFYSMDTEF LATVTKMLSYPITI S+L+++SPY L P+G
Sbjct: 145 EQARDSTVNMTNWDLFFYTRQFYSMDTEFQLATVTKMLSYPITIGSILYKYSPYNLIPKG 204

Query: 204 PVTLEGLKSIAALRYTLYPKLGKTSLSNNSPMRIFIVGTRAESQLPGHVWKQLQYLFSER 263
           PVTLEGLKS+AALRYTL  +    + +   PMRIFI+G RAESQLP H+WKQLQ+LF  +
Sbjct: 205 PVTLEGLKSLAALRYTL--RNNAFATTKTRPMRIFILGARAESQLPIHIWKQLQFLFPAQ 262

Query: 264 IFEIHFIGPECQLKEPK----NTSTPLIKKVDDTLSLIYHPQYFHELHKSGDLFPYNPYK 319
            FEI+FIGPEC L E      ++ + ++K+VD++L+L Y+P YF + HK+ D FPY+PY 
Sbjct: 263 AFEINFIGPECSLLEQDSNYLSSDSRIVKRVDESLTLAYYPDYFDKFHKAQDFFPYDPYN 322

Query: 320 DVFFIFHPGFAYPDTRKLWLDETIPNLLETKCAIFHTGFNEGDITNDVTLIDKCYRNEID 379
           D+FF FHPGFA P++ K W+ +T+  LL+TKCAIF TGF++ DI  D+T +   Y  E+D
Sbjct: 323 DIFFTFHPGFASPESSKTWMGDTMKALLDTKCAIFTTGFSQDDIMKDITSVQDTYGEEVD 382

Query: 380 VLMKPIKNVFGSVKWELNDINPQEVYQFNMYIAGFRGKRYHPIK 423
           +LM PIKNVFGS KWELND+NPQ+VYQFNMYIAGFRGKRYH +K
Sbjct: 383 MLMNPIKNVFGSTKWELNDLNPQQVYQFNMYIAGFRGKRYHTVK 426

>SAKL0F11286g Chr6 (880536..881807) [1272 bp, 423 aa] {ON} similar
           to uniprot|P32335 Saccharomyces cerevisiae YLR203C MSS51
           Protein required for the maturation and translation of
           COX1 mRNA involved in maturation of COX1 and COB mRNA
          Length = 423

 Score =  567 bits (1461), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/402 (66%), Positives = 322/402 (80%), Gaps = 6/402 (1%)

Query: 29  RTIMGYVRNAFGLEPRDSPDTPQISNRFHPWEESPCADLRDRAARIKTLARCPVTGKNIN 88
           R I+G+VRNA GL+P  SPD P   NRFHPW++SP  DLR RAA I+ LARCPVTGK IN
Sbjct: 22  RHIIGFVRNALGLDPPPSPDDPTPDNRFHPWDQSPSPDLRTRAATIRALARCPVTGKEIN 81

Query: 89  YTCPISGIPTHHSRKAWEDDTDYHKNKTYEKLKKVNIYEHDLRSGRSFPEFDFPAEQGRD 148
           YTCP SGIPTHHSR+AWE DT YH  K YE LKKVNIYEHDLRSGR FPEFDFP +Q  D
Sbjct: 82  YTCPQSGIPTHHSREAWEQDTMYHATKKYEILKKVNIYEHDLRSGRPFPEFDFPQDQDYD 141

Query: 149 RAVNLQNWDLFLYTRQFYSMDTEFHLATVTKMLSYPITIASVLHEFSPYKLQPRGPVTLE 208
           R VN+ NWDLF YTRQFYSMDTEF LA VTKMLSYP T+ SVLHEFSPY L P+GP+TLE
Sbjct: 142 RMVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPTTVGSVLHEFSPYALNPKGPITLE 201

Query: 209 GLKSIAALRYTLYPKLGK--TSLSNNSPMRIFIVGTRAESQLPGHVWKQLQYLFSERIFE 266
           GLKS+AALRYTLYP+  +  ++ + + PMRIFI+G RAE+QLPGHVWKQ Q+LF E  FE
Sbjct: 202 GLKSLAALRYTLYPQQHRKVSAATKDRPMRIFILGARAEAQLPGHVWKQFQFLFPEINFE 261

Query: 267 IHFIGPEC----QLKEPKNTSTPLIKKVDDTLSLIYHPQYFHELHKSGDLFPYNPYKDVF 322
           +HFIGPE     + +E   +STP++++VD+TLS +YH  YFH  H++ D FPY+PY D+F
Sbjct: 262 LHFIGPESFYDREKREYITSSTPIVRRVDETLSFVYHTDYFHVFHEAQDFFPYDPYLDIF 321

Query: 323 FIFHPGFAYPDTRKLWLDETIPNLLETKCAIFHTGFNEGDITNDVTLIDKCYRNEIDVLM 382
           F FHPGFA P++ + W+ +T+  LLETKCAIF TGFNE D+  D+T + + Y NE+D+LM
Sbjct: 322 FCFHPGFAAPESTEHWMGKTMEGLLETKCAIFTTGFNEQDLVRDMTAVREKYGNEMDMLM 381

Query: 383 KPIKNVFGSVKWELNDINPQEVYQFNMYIAGFRGKRYHPIKI 424
           +P++N+FGS KWELND+NPQEVYQFNMYIAGFRGKRYH I++
Sbjct: 382 EPVRNLFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 423

>ZYRO0F11616g Chr6 (953577..954824) [1248 bp, 415 aa] {ON} similar
           to uniprot|P32335 Saccharomyces cerevisiae YLR203C MSS51
           Protein required for the maturation and translation of
           COX1 mRNA involved in maturation of COX1 and COB mRNA
          Length = 415

 Score =  561 bits (1446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/404 (65%), Positives = 321/404 (79%), Gaps = 5/404 (1%)

Query: 26  TFHRTIMGYVRNAFGLEPRDSPDTPQISNRFHPWEESPCADLRDRAARIKTLARCPVTGK 85
           T  RTI+G+VRNA GL+P  SPD P   NRFH W++SP  DLR+RAARI+ LA+CPVTGK
Sbjct: 12  TQRRTIIGFVRNALGLDPPPSPDDPTPENRFHLWDQSPAGDLRERAARIRALAQCPVTGK 71

Query: 86  NINYTCPISGIPTHHSRKAWEDDTDYHKNKTYEKLKKVNIYEHDLRSGRSFPEFDFPAEQ 145
            INYTCP+SGIPTHHS++AWE D  YH++K +E LKKVNIYEHDLRSGR FPEFDFP + 
Sbjct: 72  EINYTCPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGRPFPEFDFPQDL 131

Query: 146 GRDRAVNLQNWDLFLYTRQFYSMDTEFHLATVTKMLSYPITIASVLHEFSPYKLQPRGPV 205
             DR VN+ NWDLF YTRQFYSMDTEF LA VTKMLSYPITIASVL++FSPY L P+GP+
Sbjct: 132 EFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQFSPYSLNPKGPI 191

Query: 206 TLEGLKSIAALRYTLYPKLGKT-SLSNNSPMRIFIVGTRAESQLPGHVWKQLQYLFSERI 264
           TLEGLKS+AALRYTLYP   KT + + + PMR+FI+G RAE+ LPGHVWKQLQ+LF E  
Sbjct: 192 TLEGLKSLAALRYTLYPFENKTVAATKDRPMRLFILGARAEALLPGHVWKQLQFLFPETA 251

Query: 265 FEIHFIGPECQLKEPK----NTSTPLIKKVDDTLSLIYHPQYFHELHKSGDLFPYNPYKD 320
           FE+HFIGPEC + + K    ++  P++K++D+TLS +YH  YFH  H + D FPY+PY D
Sbjct: 252 FELHFIGPECLVNKEKHQYVSSPAPVVKRIDETLSFVYHTDYFHVYHDAQDFFPYDPYLD 311

Query: 321 VFFIFHPGFAYPDTRKLWLDETIPNLLETKCAIFHTGFNEGDITNDVTLIDKCYRNEIDV 380
            FF FHPGF  P++ KLWL++TIP LLETKCAIF TG N+  +  D+  +   +  EID+
Sbjct: 312 AFFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINAVMDKHSKEIDI 371

Query: 381 LMKPIKNVFGSVKWELNDINPQEVYQFNMYIAGFRGKRYHPIKI 424
           LM+P KN++GS KWELND+NPQEVYQFNMYIAGFRGKRYH I+I
Sbjct: 372 LMEPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIEI 415

>Ecym_4727 Chr4 complement(1420885..1422174) [1290 bp, 429 aa] {ON}
           similar to Ashbya gossypii ACL152W
          Length = 429

 Score =  561 bits (1446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/429 (59%), Positives = 325/429 (75%), Gaps = 5/429 (1%)

Query: 1   MLLSRVLTLGKHAPYESFHTEIVRYTFHRTIMGYVRNAFGLEPRDSPDTPQISNRFHPWE 60
           MLL     LG+     S  + +      R IMG+VRNA GL+P  SPD P + NRFHPW+
Sbjct: 1   MLLPVTKRLGRPGFISSSSSRVCGKQQRRQIMGFVRNALGLDPPTSPDEPTVDNRFHPWD 60

Query: 61  ESPCADLRDRAARIKTLARCPVTGKNINYTCPISGIPTHHSRKAWEDDTDYHKNKTYEKL 120
           +SP  +LR+RAARIK LA+CPVTGKNI ++C  SGIPTHHS +AW++D++YH++K Y  L
Sbjct: 61  QSPSPELRERAARIKALAKCPVTGKNIQFSCKYSGIPTHHSEEAWKNDSEYHESKRYRLL 120

Query: 121 KKVNIYEHDLRSGRSFPEFDFPAEQGRDRAVNLQNWDLFLYTRQFYSMDTEFHLATVTKM 180
           KKVNIYEHDLRSGR F EFDFP +Q  DR VN+ NWDL+ YTR F+SMDTEF LA VTKM
Sbjct: 121 KKVNIYEHDLRSGRPFLEFDFPEQQDYDRMVNMMNWDLYFYTRSFFSMDTEFQLAAVTKM 180

Query: 181 LSYPITIASVLHEFSPYKLQPRGPVTLEGLKSIAALRYTLYPKLGKTSLS-NNSPMRIFI 239
           LSYPITI S+LH++SPY L P+GP+TLEGLKS+AALRYTLYP+  +   S  + P+R+FI
Sbjct: 181 LSYPITIGSILHQYSPYSLNPKGPITLEGLKSLAALRYTLYPEQNRRVRSIQDKPLRVFI 240

Query: 240 VGTRAESQLPGHVWKQLQYLFSERIFEIHFIGPECQLKEPK----NTSTPLIKKVDDTLS 295
           +G RAE+QLPGHVWKQLQYLF E + E+HF+GPE      K     +S P++K++DDT+ 
Sbjct: 241 LGARAEAQLPGHVWKQLQYLFPESLIELHFVGPESNYDREKREYVTSSIPVVKRIDDTMK 300

Query: 296 LIYHPQYFHELHKSGDLFPYNPYKDVFFIFHPGFAYPDTRKLWLDETIPNLLETKCAIFH 355
           + YH  YFH  H++ D FPY+PY D+FF FHPGF  P+TR  W++ T+  LL+TKCAIF 
Sbjct: 301 MHYHTDYFHVFHEAQDFFPYDPYNDIFFCFHPGFGSPETRDTWMNSTLQALLQTKCAIFT 360

Query: 356 TGFNEGDITNDVTLIDKCYRNEIDVLMKPIKNVFGSVKWELNDINPQEVYQFNMYIAGFR 415
           TGFN+ D+ +D+  + + Y +E+D+L+ P KNVFGS KWELND+NP EVYQFNMYIAGFR
Sbjct: 361 TGFNKKDLMDDLQAVKEKYGDELDMLVDPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFR 420

Query: 416 GKRYHPIKI 424
           GKRYH I++
Sbjct: 421 GKRYHAIEL 429

>KLLA0D12430g Chr4 complement(1055878..1057134) [1257 bp, 418 aa]
           {ON} similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203C MSS51 Protein required for the maturation and
           translation of COX1 mRNA involved in maturation of COX1
           and COB mRNA
          Length = 418

 Score =  559 bits (1440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/402 (62%), Positives = 317/402 (78%), Gaps = 6/402 (1%)

Query: 29  RTIMGYVRNAFGLEPRDSPDTPQISNRFHPWEESPCADLRDRAARIKTLARCPVTGKNIN 88
           R IMG+VRNA GL+P  SPD P   NRFHPW++SP  DLR+RAARIK +A CPVT K+I 
Sbjct: 17  RPIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPSPDLRERAARIKAMATCPVTHKDIQ 76

Query: 89  YTCPISGIPTHHSRKAWEDDTDYHKNKTYEKLKKVNIYEHDLRSGRSFPEFDFPAEQGRD 148
           +TCP+SGIPTHHSR+AWE DT+YHK+K YE LKKVNIYEHDLRSGR FPEFDFP +Q  D
Sbjct: 77  FTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRSGRPFPEFDFPQDQDYD 136

Query: 149 RAVNLQNWDLFLYTRQFYSMDTEFHLATVTKMLSYPITIASVLHEFSPYKLQPRGPVTLE 208
           R VN+ NWDLF YTR FYSMDTEF LA VTKMLSYPITI SVLH++SPY L P+GP+TLE
Sbjct: 137 RMVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQYSPYSLNPKGPITLE 196

Query: 209 GLKSIAALRYTLYP-KLGKTSLSNNSPMRIFIVGTRAESQLPGHVWKQLQYLFSERIFEI 267
           GLKS+AALRYTLYP + G+     ++P+RIFI+GTRAE+QLPGHVWKQLQYL  +   E+
Sbjct: 197 GLKSLAALRYTLYPEQSGRFRAGQDTPIRIFILGTRAEAQLPGHVWKQLQYLIPDTSIEL 256

Query: 268 HFIGPECQLKEPK-----NTSTPLIKKVDDTLSLIYHPQYFHELHKSGDLFPYNPYKDVF 322
           HF+GPE      K     +++  ++K++D+ + L YH  +FH  H++ D FPY+PY DVF
Sbjct: 257 HFVGPESFYDREKRSYVQSSTETIVKRIDEKMQLFYHTDFFHVFHEAQDFFPYDPYNDVF 316

Query: 323 FIFHPGFAYPDTRKLWLDETIPNLLETKCAIFHTGFNEGDITNDVTLIDKCYRNEIDVLM 382
           F FHPGFA P+T + W+ +T+  L++TKCA+F TGF++ D+  D++++   Y +E+D+LM
Sbjct: 317 FCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTGFSKEDLLRDISIVQDKYGSELDMLM 376

Query: 383 KPIKNVFGSVKWELNDINPQEVYQFNMYIAGFRGKRYHPIKI 424
           +P+ NVFGS KWELND NP EVYQFNMYIAGFRGKRYH I++
Sbjct: 377 EPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGKRYHAIEL 418

>KNAG0B02630 Chr2 complement(508645..509961) [1317 bp, 438 aa] {ON}
           Anc_7.346 YLR203C
          Length = 438

 Score =  556 bits (1433), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/437 (61%), Positives = 322/437 (73%), Gaps = 14/437 (3%)

Query: 1   MLLSRVLTLGKHAPYESFHTEIVRYTFHRTIMGYVRNAFGLEPRDSPDTPQISNRFHPWE 60
           ML +  L  G  + + +     +     R +MG+VRNA GLEP  SP  P   NRFHPW+
Sbjct: 1   MLCTWTLRPGVRSAHRALRASGLPCIARRQLMGFVRNALGLEPPPSPMDPTPENRFHPWD 60

Query: 61  ESPCADLRDRAARIKTLARCPVTGKNINYTCPISGIPTHHSRKAWEDDTDYHKNKTYEKL 120
           +SP   LR+RAARIKTLA+CPVTG N+ YTCP+SGIPTHHSR+AWE DT YH  K YE L
Sbjct: 61  QSPVDALRERAARIKTLAKCPVTGLNVEYTCPLSGIPTHHSREAWEQDTQYHATKRYETL 120

Query: 121 KKVNIYEHDLRSGRSFPEFDFPAEQGRDRAVNLQNWDLFLYTRQFYSMDTEFHLATVTKM 180
           KKVNIYEHDLRSGR FPEFDFP EQG D+ VN+ NWDLF YTR FYSMDTEF LA VTKM
Sbjct: 121 KKVNIYEHDLRSGRPFPEFDFPQEQGYDKVVNMTNWDLFFYTRGFYSMDTEFQLAAVTKM 180

Query: 181 LSYPITIASVLHEFSPYKLQPRGPVTLEGLKSIAALRYTLYPKLGKTSLS---------- 230
           LSYP+TIAS+L +FSPY L P+GP+TLEGLKS+AA+RYTLY +    S            
Sbjct: 181 LSYPVTIASLLAQFSPYSLNPKGPITLEGLKSLAAVRYTLYSQSFNNSARAGGVTTGGAL 240

Query: 231 NNSPMRIFIVGTRAESQLPGHVWKQLQYLFSERIFEIHFIGPECQLKEPKN----TSTPL 286
            N PMR+F++G RAE+QLPGHVWKQL YLF E+ FE+ FIGPE      +     + TP+
Sbjct: 241 KNRPMRLFVLGARAEAQLPGHVWKQLSYLFPEQSFEMVFIGPESYYDRARGQYVRSPTPV 300

Query: 287 IKKVDDTLSLIYHPQYFHELHKSGDLFPYNPYKDVFFIFHPGFAYPDTRKLWLDETIPNL 346
           ++KVD+TL  I++  YFH LH+S D FPY+PY D FF FHPGFA P+ R  WL  T+P L
Sbjct: 301 VEKVDETLKFIHYTDYFHVLHESQDFFPYDPYFDCFFTFHPGFASPENRDTWLSNTLPAL 360

Query: 347 LETKCAIFHTGFNEGDITNDVTLIDKCYRNEIDVLMKPIKNVFGSVKWELNDINPQEVYQ 406
           L+TKCAIF TGF+  D+ NDV L+++ + +E+D+LM+P KNVFGS KWELND+NP EVYQ
Sbjct: 361 LDTKCAIFTTGFDRDDLMNDVALLNEKFGSEMDILMEPTKNVFGSTKWELNDLNPHEVYQ 420

Query: 407 FNMYIAGFRGKRYHPIK 423
           FNMYIAGFRGKRYH IK
Sbjct: 421 FNMYIAGFRGKRYHTIK 437

>Kwal_56.24631 s56 (1080985..1082253) [1269 bp, 422 aa] {ON} YLR203C
           (MSS51) - involved in maturation of COX1 and COB mRNA
           [contig 161] FULL
          Length = 422

 Score =  554 bits (1427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/402 (64%), Positives = 318/402 (79%), Gaps = 6/402 (1%)

Query: 29  RTIMGYVRNAFGLEPRDSPDTPQISNRFHPWEESPCADLRDRAARIKTLARCPVTGKNIN 88
           R IMG+VRNA GL+P  SPD P   NRFHPW++SP  DLR+RAA I+ LA+CPVTG+ IN
Sbjct: 21  RHIMGFVRNALGLDPPPSPDEPTPENRFHPWDQSPSPDLRERAATIRALAKCPVTGREIN 80

Query: 89  YTCPISGIPTHHSRKAWEDDTDYHKNKTYEKLKKVNIYEHDLRSGRSFPEFDFPAEQGRD 148
           YTCP SGIPTHHSR+AWE D DY ++K  E LKKVNIYEHDLRSGR FPEFDFP +Q  D
Sbjct: 81  YTCPKSGIPTHHSREAWEKDLDYQQSKRPEILKKVNIYEHDLRSGRPFPEFDFPLDQDFD 140

Query: 149 RAVNLQNWDLFLYTRQFYSMDTEFHLATVTKMLSYPITIASVLHEFSPYKLQPRGPVTLE 208
           R VNL NWDLF YTR F+SMDTEF LA VTKMLSYPITI SVLH+FSPY L P+GP+TLE
Sbjct: 141 RMVNLTNWDLFFYTRGFFSMDTEFQLAAVTKMLSYPITIGSVLHQFSPYSLNPKGPITLE 200

Query: 209 GLKSIAALRYTLYPKLGK--TSLSNNSPMRIFIVGTRAESQLPGHVWKQLQYLFSERIFE 266
           GLKS+AALRYTLYP   +  TS++ NSP+RIF++G RAE+QLPGHVWKQLQ++F E   E
Sbjct: 201 GLKSLAALRYTLYPDQNRRVTSIAKNSPLRIFVLGARAEAQLPGHVWKQLQFMFPETQME 260

Query: 267 IHFIGPEC----QLKEPKNTSTPLIKKVDDTLSLIYHPQYFHELHKSGDLFPYNPYKDVF 322
           IHF+GPE       +E  +++ P+I++VD+TL+ +YH  YFH  H++ D FPY+PY D+F
Sbjct: 261 IHFVGPESYYDRNKREYVHSAAPIIRRVDETLNFVYHTDYFHVFHEAQDFFPYDPYTDIF 320

Query: 323 FIFHPGFAYPDTRKLWLDETIPNLLETKCAIFHTGFNEGDITNDVTLIDKCYRNEIDVLM 382
           F FHPGFA P++R+ W+ +T+  LLETKCAIF TGFNE D+  D+  +   Y  E+D++M
Sbjct: 321 FCFHPGFAAPESRENWMGKTMEALLETKCAIFTTGFNEVDLQRDLDAVVAEYGKELDIIM 380

Query: 383 KPIKNVFGSVKWELNDINPQEVYQFNMYIAGFRGKRYHPIKI 424
            P KN FGS KWELND+NPQEVYQFNM++AGFRGKRYH I++
Sbjct: 381 DPAKNAFGSTKWELNDVNPQEVYQFNMFMAGFRGKRYHAIEV 422

>KLTH0H01342g Chr8 complement(125673..126941) [1269 bp, 422 aa] {ON}
           similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203C MSS51 Protein required for the maturation and
           translation of COX1 mRNA involved in maturation of COX1
           and COB mRNA
          Length = 422

 Score =  552 bits (1422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/402 (64%), Positives = 322/402 (80%), Gaps = 6/402 (1%)

Query: 29  RTIMGYVRNAFGLEPRDSPDTPQISNRFHPWEESPCADLRDRAARIKTLARCPVTGKNIN 88
           R IMG+VRNA GL+P  SPD P   NRFHPW++SP  DLR+RAA I+ LA+CPVTG+ IN
Sbjct: 21  RHIMGFVRNALGLDPPPSPDEPTPENRFHPWDQSPSPDLRERAATIRALAKCPVTGREIN 80

Query: 89  YTCPISGIPTHHSRKAWEDDTDYHKNKTYEKLKKVNIYEHDLRSGRSFPEFDFPAEQGRD 148
           YTCP SGIPTH+SR+AWE+D +Y ++K  E LKKVNIYEHDLRSGR FPEFDFP +Q  D
Sbjct: 81  YTCPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNIYEHDLRSGRPFPEFDFPLDQDFD 140

Query: 149 RAVNLQNWDLFLYTRQFYSMDTEFHLATVTKMLSYPITIASVLHEFSPYKLQPRGPVTLE 208
           R VNL NWDLF YTR FYSMDTEF LA VTKMLSYP+TI SVLH+FSPY L P+GPVTLE
Sbjct: 141 RMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIGSVLHQFSPYSLNPKGPVTLE 200

Query: 209 GLKSIAALRYTLYPKLGK--TSLSNNSPMRIFIVGTRAESQLPGHVWKQLQYLFSERIFE 266
           GLKS+AALRYTLYP+  +  TS++ NSP+RIFI+G RAE+QLPGHVWKQLQ++F E   E
Sbjct: 201 GLKSLAALRYTLYPEQNRRVTSITKNSPLRIFILGARAEAQLPGHVWKQLQFMFPETNIE 260

Query: 267 IHFIGPEC----QLKEPKNTSTPLIKKVDDTLSLIYHPQYFHELHKSGDLFPYNPYKDVF 322
           +HF+GPE       +E  ++S+P++++VD+TLS +YH  YFH  H++ D FPY+PY D+F
Sbjct: 261 LHFVGPESYYDRNKREYVHSSSPIVRRVDETLSFVYHTDYFHVFHEAQDFFPYDPYTDIF 320

Query: 323 FIFHPGFAYPDTRKLWLDETIPNLLETKCAIFHTGFNEGDITNDVTLIDKCYRNEIDVLM 382
           F FHPGFA P++R+ W+ +T+  LLETKCA+F TGFNE D+  DV  +   +  E+D+LM
Sbjct: 321 FCFHPGFAAPESRENWMGKTMEALLETKCAVFTTGFNELDLRRDVGTVVGKHGKELDMLM 380

Query: 383 KPIKNVFGSVKWELNDINPQEVYQFNMYIAGFRGKRYHPIKI 424
           +P+ N FGS KWELND+NPQEVYQFNM+IAGFRGKRYH I++
Sbjct: 381 EPVHNAFGSTKWELNDMNPQEVYQFNMFIAGFRGKRYHAIEV 422

>NDAI0A01930 Chr1 complement(430531..431883) [1353 bp, 450 aa] {ON}
           Anc_7.346 YLR203C
          Length = 450

 Score =  551 bits (1419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/415 (60%), Positives = 319/415 (76%), Gaps = 20/415 (4%)

Query: 28  HRTIMGYVRNAFGLEPRDSPDTPQISNRFHPWEESPCADLRDRAARIKTLARCPVTGKNI 87
           +R  +G+V+NA G+EP  SP+ P   NRFHPW++SP  DLR+RAARI+ LA+CPVTGK I
Sbjct: 38  NRHFVGFVKNALGMEPPPSPNEPAFENRFHPWDQSPSPDLRERAARIRALAKCPVTGKEI 97

Query: 88  NYTCPISGIPTHHSRKAWEDDTDYHKNKTYEKLKKVNIYEHDLRSGRSFPEFDFPAEQGR 147
           NYTCPISGIPTHHS++AWE+DT+YH+NK Y+ LKKVN++EHDLRSGRSFPEF+FP  Q  
Sbjct: 98  NYTCPISGIPTHHSKEAWENDTNYHQNKIYDILKKVNVFEHDLRSGRSFPEFEFPQSQDH 157

Query: 148 DRAVNLQNWDLFLYTRQFYSMDTEFHLATVTKMLSYPITIASVLHEFSPYKLQPRGPVTL 207
           D AV++ NWD+F YTRQF SMD+EF LATVTKMLSYPITIAS+LH++ PY L+P GP+TL
Sbjct: 158 DCAVSMNNWDMFFYTRQFVSMDSEFQLATVTKMLSYPITIASILHKYCPYALEPNGPITL 217

Query: 208 EGLKSIAALRYTLYPKLGKTSLSNNSPMRIFIVGTRAESQLPGHVWKQLQYLFSERIFEI 267
           EGLKSIAAL+Y+L  +  +   +   PMRIFI+G RAESQLP H+WKQ  YLF  + FEI
Sbjct: 218 EGLKSIAALKYSL--RHNEFETTKERPMRIFILGARAESQLPEHIWKQFSYLFPFQNFEI 275

Query: 268 HFIGPECQL--------KEPKNTSTP----------LIKKVDDTLSLIYHPQYFHELHKS 309
           +FIGPEC +         E  NT+T           ++K++D+ L+L+YH  +FH LH +
Sbjct: 276 NFIGPECSVLMNNNNMNAEETNTTTSGSMTEIRPNRIVKRIDERLNLVYHTDFFHTLHNA 335

Query: 310 GDLFPYNPYKDVFFIFHPGFAYPDTRKLWLDETIPNLLETKCAIFHTGFNEGDITNDVTL 369
            D FPY+ Y DVFF FHPGFA P+  K W+ ET+  LL+TKCAIF TGFN+ D+  D+ +
Sbjct: 336 RDFFPYDSYNDVFFTFHPGFASPENTKSWMGETMKALLDTKCAIFTTGFNKQDLLKDIDI 395

Query: 370 IDKCYRNEIDVLMKPIKNVFGSVKWELNDINPQEVYQFNMYIAGFRGKRYHPIKI 424
           + + Y  E+D+LMKP KNVFGS KWELND++PQEVYQ+NMYIAGFRGKRYH +K+
Sbjct: 396 VQETYGKEVDMLMKPTKNVFGSTKWELNDMDPQEVYQYNMYIAGFRGKRYHAVKV 450

>TBLA0E00500 Chr5 (91769..93082) [1314 bp, 437 aa] {ON} Anc_7.346
           YLR203C
          Length = 437

 Score =  548 bits (1411), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/408 (64%), Positives = 318/408 (77%), Gaps = 18/408 (4%)

Query: 29  RTIMGYVRNAFGLEPRDSPDTPQISNRFHPWEESPCADLRDRAARIKTLARCPVTGKNIN 88
           R +MG+VR+  GL+P  SP+ P   NRFHPWE SPC DLR+RAARIKT+A+CPV+  +IN
Sbjct: 25  RNLMGFVRSTLGLDPPPSPNDPTPENRFHPWETSPCDDLRERAARIKTMAKCPVSNLDIN 84

Query: 89  YTCPISGIPTHHSRKAWEDDTDYHKNKTYEKLKKVNIYEHDLRSGRSFPEFDFPAEQGRD 148
           YTCPISGIPTHHSRK WE DT+YHKN   + LKKVNIYEHDLRSGR FPEFDFP EQ  D
Sbjct: 85  YTCPISGIPTHHSRKEWEMDTNYHKNHIADILKKVNIYEHDLRSGRPFPEFDFPREQEYD 144

Query: 149 RAVNLQNWDLFLYTRQFYSMDTEFHLATVTKMLSYPITIASVLHEFSPYKLQPRGPVTLE 208
             +NL NWDL+ YTR F+SMDTEF LA VTKMLSYP+TIASVLH+FSPY L P+GPVTLE
Sbjct: 145 TVINLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYPMTIASVLHQFSPYSLTPKGPVTLE 204

Query: 209 GLKSIAALRYTL-YPKLGKTSLSN-----------NSPMRIFIVGTRAESQLPGHVWKQL 256
           GLKS+AALRYTL    L  TS  N           N PMRIFI+G RAE+QLP HVWKQL
Sbjct: 205 GLKSLAALRYTLNNNSLSDTSSGNSDSTTITATSKNRPMRIFILGARAEAQLPPHVWKQL 264

Query: 257 QYLFSERIFEIHFIGPECQLKEPKN----TSTPLIKKVDDTLSLIYHPQYFHELHKSGDL 312
           QYLF    FEIHFIGPE  L + K+    ++TP+ K++DD++SL+YH  YFH  HK+ D 
Sbjct: 265 QYLFPNSNFEIHFIGPESLLSKDKSHYVTSTTPITKRIDDSMSLVYHTDYFHVYHKAQDF 324

Query: 313 FPYNPYKDVFFIFHPGFAYPDTRKLWLDETIPNLLETKCAIFHTGFNEGDITNDVTLIDK 372
           +PY+PY D+FF+FHPG A   T++ WL+ET+  LL++KC IF TGF+E DIT D+++++K
Sbjct: 325 YPYDPYFDIFFMFHPGLA--ATKETWLNETMQGLLDSKCPIFMTGFHEKDITADISVLNK 382

Query: 373 CYRNEIDVLMKPIKNVFGSVKWELNDINPQEVYQFNMYIAGFRGKRYH 420
            +  ++D+LMKP+KNVFGS KWELND NPQEVYQFNMYIAG+RGKRYH
Sbjct: 383 NFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFNMYIAGYRGKRYH 430

>ACL152W Chr3 (85701..86987) [1287 bp, 428 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR203C (MSS51)
          Length = 428

 Score =  545 bits (1404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/400 (66%), Positives = 312/400 (78%), Gaps = 4/400 (1%)

Query: 29  RTIMGYVRNAFGLEPRDSPDTPQISNRFHPWEESPCADLRDRAARIKTLARCPVTGKNIN 88
           R IMG+VRNA GL+P  SPD P   NRFH WE+SP  DLR+RAARI+ LARCPVTGK+I 
Sbjct: 29  RPIMGFVRNALGLDPPASPDEPTDENRFHVWEQSPSPDLRERAARIRALARCPVTGKDIR 88

Query: 89  YTCPISGIPTHHSRKAWEDDTDYHKNKTYEKLKKVNIYEHDLRSGRSFPEFDFPAEQGRD 148
           Y+C  SGIPTHHSR+AWE D +YH++K +  L+KVN+YEHDLRSGR F EFDFP EQGRD
Sbjct: 89  YSCERSGIPTHHSREAWEQDEEYHRSKRWATLRKVNVYEHDLRSGRPFAEFDFPQEQGRD 148

Query: 149 RAVNLQNWDLFLYTRQFYSMDTEFHLATVTKMLSYPITIASVLHEFSPYKLQPRGPVTLE 208
           R VN+ NWDLFLYTRQFYSMDT+F LA VTKMLSYPITI S+LH+FSPY L+PRGP+TLE
Sbjct: 149 RMVNMLNWDLFLYTRQFYSMDTDFQLAAVTKMLSYPITIGSLLHQFSPYALEPRGPITLE 208

Query: 209 GLKSIAALRYTLYPKLGKTSLSNNSPMRIFIVGTRAESQLPGHVWKQLQYLFSERIFEIH 268
           GLKS+AALRYTLYP+        + PMRIFI+G RAE+QLPGHVWKQLQYLF     EIH
Sbjct: 209 GLKSLAALRYTLYPESESARAVRSKPMRIFILGARAEAQLPGHVWKQLQYLFPGSNMEIH 268

Query: 269 FIGPEC----QLKEPKNTSTPLIKKVDDTLSLIYHPQYFHELHKSGDLFPYNPYKDVFFI 324
           FIGPE     Q KE  ++STP+ K+VD TL L++H  Y H  H++ D FPY+PY DVFF 
Sbjct: 269 FIGPEALYDRQRKEYVHSSTPVSKRVDGTLKLVHHTDYLHVFHEAQDFFPYDPYNDVFFC 328

Query: 325 FHPGFAYPDTRKLWLDETIPNLLETKCAIFHTGFNEGDITNDVTLIDKCYRNEIDVLMKP 384
           FHPGFA  + R  W+D+T+P LLETKCAIF TGF+  D+  D   +   +  E+DVLM P
Sbjct: 329 FHPGFASAEGRSSWMDKTVPALLETKCAIFVTGFHRDDMFGDFEALRASHDAEMDVLMHP 388

Query: 385 IKNVFGSVKWELNDINPQEVYQFNMYIAGFRGKRYHPIKI 424
            KN+FGS KWELND+NP EVYQFNMYIAGFRGKRYH I++
Sbjct: 389 TKNIFGSTKWELNDMNPHEVYQFNMYIAGFRGKRYHAIQV 428

>KLTH0G11418g Chr7 (962267..964960) [2694 bp, 897 aa] {ON} similar
           to uniprot|P89102 Saccharomyces cerevisiae YDR166C SEC5
           Essential 107kDa subunit of the exocyst complex (Sec3p
           Sec5p Sec6p Sec8p Sec10p Sec15p Exo70p and Exo84p) which
           has the essential function of mediating polarized
           targeting of secretory vesicles to active sites of
           exocytosis
          Length = 897

 Score = 35.0 bits (79), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 24/106 (22%), Positives = 53/106 (50%), Gaps = 12/106 (11%)

Query: 177 VTKMLSYPITIASVLHEFSPYKLQPRGPVTLEGLKSIAALRYTLYPKLGK-------TSL 229
           V +++S    + S+L E +  K  PR P T+  L ++  ++ +++P++ +       T L
Sbjct: 661 VQQIVSMEAVLESILKEAAKEKENPRNPRTILTLTNLQYIKGSVFPQVLRYFDESFETQL 720

Query: 230 SNNSPMRIFIVGTRAESQLPGHVWKQLQY----LFSERIFEIHFIG 271
           S  + + IF +  + E+ + G+    L+     +  ER +EI++  
Sbjct: 721 SRKN-LEIFTLLAKMETSILGNYLSDLKVTLRDILEERFYEINWAA 765

>Kwal_27.11335 s27 complement(756212..758908) [2697 bp, 898 aa] {ON}
           YDR166C (SEC5) - 107 kDa component of the Exocyst
           complex; required for exocytosis. [contig 28] FULL
          Length = 898

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 52/104 (50%), Gaps = 12/104 (11%)

Query: 177 VTKMLSYPITIASVLHEFSPYKLQPRGPVTLEGLKSIAALRYTLYPKLGK-------TSL 229
           V +++S    + SVL + +  K  PR P T+  L ++  +R  ++P++ +       T L
Sbjct: 662 VQQIISMEAVLESVLKDAAKEKEHPRNPRTILTLTNLQYIRERIFPQILQCFDECFETQL 721

Query: 230 SNNSPMRIFIVGTRAESQLPGHVWKQLQY----LFSERIFEIHF 269
           S+ + + IF +  + E+ + G+    L+     +   R +EI++
Sbjct: 722 SSKN-LEIFTLLAKMETSIFGNYLSDLKVNLRDILEARFYEINW 764

>Skud_12.171 Chr12 complement(327077..329029) [1953 bp, 650 aa] {ON}
           YLR103C (REAL)
          Length = 650

 Score = 30.4 bits (67), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 49/104 (47%), Gaps = 16/104 (15%)

Query: 210 LKSIAALRYTLYPKLGKTSLSNNSPMRIFIVGTRAESQLPGHVWKQLQYLFSERIFEIHF 269
           + SI+A  Y+L+  +G+T+LSN   + + I+GT +       V+ +L  +  +       
Sbjct: 248 VNSISAQIYSLFSSIGETNLSN---LWLNILGTTSLDIAYAQVYNRLYPILQD------- 297

Query: 270 IGPECQLKEPKNTSTPLIKKVDDTLSLIYHPQYFHELHKSGDLF 313
              E +   P N ++    K  DTLSL   P Y+  L +   L+
Sbjct: 298 ---EVKRLTPSNRNSV---KTPDTLSLNIQPDYYLFLLRHSSLY 335

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.139    0.438 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,861,905
Number of extensions: 2319782
Number of successful extensions: 5213
Number of sequences better than 10.0: 35
Number of HSP's gapped: 5305
Number of HSP's successfully gapped: 35
Length of query: 424
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 312
Effective length of database: 40,638,807
Effective search space: 12679307784
Effective search space used: 12679307784
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)