Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0C037407.343ON72772737510.0
NCAS0A141107.343ON75372926960.0
CAGL0I03410g7.343ON72472926570.0
TDEL0C020407.343ON70572626520.0
NDAI0A019407.343ON76561226440.0
Smik_4.747.343ON84572226020.0
KAFR0B008307.343ON71061325870.0
Suva_4.827.343ON75573225840.0
YDL164C (CDC9)7.343ON75572525750.0
Skud_4.937.343ON75562625570.0
ZYRO0F11572g7.343ON73171525430.0
Kpol_2001.717.343ON72670925140.0
SAKL0F10912g7.343ON69361025110.0
KLTH0H01408g7.343ON72373124020.0
Kwal_56.246167.343ON71571323980.0
KLLA0D12496g7.343ON70061123200.0
ACL155W7.343ON69771222800.0
TPHA0D045707.343ON73672922560.0
TBLA0E020507.343ON72061522440.0
TPHA0M002606.18ON9664272602e-22
KLLA0D01089g6.18ON9073812485e-21
ACR008W6.18ON9814042486e-21
Smik_15.1746.18ON9454122461e-20
ZYRO0C07854g6.18ON9444162433e-20
Skud_15.1666.18ON9474182389e-20
YOR005C (DNL4)6.18ON9442942371e-19
Kwal_56.224146.18ON9633522352e-19
TBLA0G010406.18ON9722452343e-19
KLTH0C11286g6.18ON9513602334e-19
TDEL0G045106.18ON9694032325e-19
KNAG0F028706.18ON9542682263e-18
NCAS0D026506.18ON9502402237e-18
Suva_15.1806.18ON9484132227e-18
CAGL0E02695g6.18ON9463542173e-17
KAFR0A050506.18ON9482412076e-16
Kpol_1032.76.18ON9652471987e-15
NDAI0I022606.18ON9672101979e-15
KLTH0D17930g4.354ON65245716.8
Kpol_269.98.452ON60750708.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0C03740
         (727 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.3...  1449   0.0  
NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON} Anc_7...  1043   0.0  
CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {...  1028   0.0  
TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {O...  1026   0.0  
NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {O...  1023   0.0  
Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}...  1006   0.0  
KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.3...  1001   0.0  
Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}...   999   0.0  
YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}  ...   996   0.0  
Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}...   989   0.0  
ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} simila...   984   0.0  
Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON} (1951...   972   0.0  
SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {...   971   0.0  
KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {...   929   0.0  
Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL1...   928   0.0  
KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]...   898   0.0  
ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homo...   882   0.0  
TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.3...   873   0.0  
TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.3...   868   0.0  
TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON...   104   2e-22
KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {O...   100   5e-21
ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic ho...   100   6e-21
Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {...    99   1e-20
ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} simila...    98   3e-20
Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {...    96   9e-20
YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON} ...    96   1e-19
Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {...    95   2e-19
TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {O...    95   3e-19
KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} simila...    94   4e-19
TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.1...    94   5e-19
KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.1...    92   3e-18
NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.1...    91   7e-18
Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {...    90   7e-18
CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {...    88   3e-17
KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6...    84   6e-16
Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON...    81   7e-15
NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {O...    80   9e-15
KLTH0D17930g Chr4 (1486259..1488217) [1959 bp, 652 aa] {ON} simi...    32   6.8  
Kpol_269.9 s269 (16643..18466) [1824 bp, 607 aa] {ON} (16643..18...    32   8.0  

>KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.343
           YDL164C
          Length = 727

 Score = 1449 bits (3751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 703/727 (96%), Positives = 703/727 (96%)

Query: 1   MWKSVCKPLLTNRLTTIHPKMKRQMTLNNFFTSVKKSDTNTPASTTPKKMEKDESPQIPA 60
           MWKSVCKPLLTNRLTTIHPKMKRQMTLNNFFTSVKKSDTNTPASTTPKKMEKDESPQIPA
Sbjct: 1   MWKSVCKPLLTNRLTTIHPKMKRQMTLNNFFTSVKKSDTNTPASTTPKKMEKDESPQIPA 60

Query: 61  TKTAEEKHENMDVDTDPVISSSEVSAKRNXXXXXXXXXXXXXKKIKIQDENNDTKEFYST 120
           TKTAEEKHENMDVDTDPVISSSEVSAKRN             KKIKIQDENNDTKEFYST
Sbjct: 61  TKTAEEKHENMDVDTDPVISSSEVSAKRNSPLTSPSPTPVVSKKIKIQDENNDTKEFYST 120

Query: 121 VPYADLCNLFQEIEGISSRLAIIKLCSSFLISVMKLDPRNLIPMTYLFINKLGPDYMPXX 180
           VPYADLCNLFQEIEGISSRLAIIKLCSSFLISVMKLDPRNLIPMTYLFINKLGPDYMP  
Sbjct: 121 VPYADLCNLFQEIEGISSRLAIIKLCSSFLISVMKLDPRNLIPMTYLFINKLGPDYMPGL 180

Query: 181 XXXXXXXXXIKTIAESCGRSLQQIKTKYHEIGDLGQIALEARKVQPTMFKPKPLTVGEVF 240
                    IKTIAESCGRSLQQIKTKYHEIGDLGQIALEARKVQPTMFKPKPLTVGEVF
Sbjct: 181 ELGLGENLLIKTIAESCGRSLQQIKTKYHEIGDLGQIALEARKVQPTMFKPKPLTVGEVF 240

Query: 241 QNLKSIASSQGKDSQTKKIKLIKRMLTSCQGVEAKFLIRSLESKLRIGLAEKTVLISLSK 300
           QNLKSIASSQGKDSQTKKIKLIKRMLTSCQGVEAKFLIRSLESKLRIGLAEKTVLISLSK
Sbjct: 241 QNLKSIASSQGKDSQTKKIKLIKRMLTSCQGVEAKFLIRSLESKLRIGLAEKTVLISLSK 300

Query: 301 ALLVYEYGESDKDIDMETVENAEQKIRDAFCQVPNYEVVIDSCLKHGIMNLDQHCSLRPA 360
           ALLVYEYGESDKDIDMETVENAEQKIRDAFCQVPNYEVVIDSCLKHGIMNLDQHCSLRPA
Sbjct: 301 ALLVYEYGESDKDIDMETVENAEQKIRDAFCQVPNYEVVIDSCLKHGIMNLDQHCSLRPA 360

Query: 361 IPLKPMLAKPTKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDGTMRIYSRNGENMTER 420
           IPLKPMLAKPTKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDGTMRIYSRNGENMTER
Sbjct: 361 IPLKPMLAKPTKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDGTMRIYSRNGENMTER 420

Query: 421 YPEIHIRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDVDINEIKVRVCL 480
           YPEIHIRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDVDINEIKVRVCL
Sbjct: 421 YPEIHIRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDVDINEIKVRVCL 480

Query: 481 FAFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLDQSVKN 540
           FAFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLDQSVKN
Sbjct: 481 FAFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLDQSVKN 540

Query: 541 SCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGKRTGNYG 600
           SCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGKRTGNYG
Sbjct: 541 SCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGKRTGNYG 600

Query: 601 GFLLGCYNQDTGEFETACKIGTGFSDEVLQQLHERLKSTVIDLPKATYVFDPSAEPDVWF 660
           GFLLGCYNQDTGEFETACKIGTGFSDEVLQQLHERLKSTVIDLPKATYVFDPSAEPDVWF
Sbjct: 601 GFLLGCYNQDTGEFETACKIGTGFSDEVLQQLHERLKSTVIDLPKATYVFDPSAEPDVWF 660

Query: 661 EPTLLFEVLTADLSLSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQIVEMYE 720
           EPTLLFEVLTADLSLSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQIVEMYE
Sbjct: 661 EPTLLFEVLTADLSLSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQIVEMYE 720

Query: 721 NQANLQQ 727
           NQANLQQ
Sbjct: 721 NQANLQQ 727

>NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON}
           Anc_7.343 YDL164C
          Length = 753

 Score = 1043 bits (2696), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 510/729 (69%), Positives = 588/729 (80%), Gaps = 22/729 (3%)

Query: 19  PKMKRQMTLNNFFTSVKK---SDTNTPASTTPKKMEK--------------DESPQIPAT 61
           PK ++Q TL  FF+S+K    +D   P  +T    EK              +E    PA+
Sbjct: 26  PKKQKQATLAKFFSSMKNEKPADKKDPEDSTTTTTEKPSLSPYTANSKKTFEEILNRPAS 85

Query: 62  KTAEEKHENMDVDTDPVI---SSSEVSAKRNXXXXXXXXXXXXXKKIKIQDENND-TKEF 117
             A       D+ + P I   S+ E +                 K+  I++   D TK +
Sbjct: 86  NLASSSQGVSDIASTPSIPNISTDESTGPDLKKQKLEESNLEPSKEPTIENVTQDSTKPY 145

Query: 118 YSTVPYADLCNLFQEIEGISSRLAIIKLCSSFLISVMKLDPRNLIPMTYLFINKLGPDYM 177
           +S++PY ++CNLFQEIE  SSRLAIIKLCS F I +MK +P+NLIP+TYLFINKLGPDY 
Sbjct: 146 FSSIPYREVCNLFQEIESTSSRLAIIKLCSDFFIKIMKENPQNLIPVTYLFINKLGPDYE 205

Query: 178 PXXXXXXXXXXXIKTIAESCGRSLQQIKTKYHEIGDLGQIALEARKVQPTMFKPKPLTVG 237
           P           +KTI+ESCG+SL Q++ KY E+GDLGQIA++AR VQPTMFKPKPLTVG
Sbjct: 206 PGLELGLGEGLLMKTISESCGKSLAQVRNKYRELGDLGQIAMDARNVQPTMFKPKPLTVG 265

Query: 238 EVFQNLKSIASSQGKDSQTKKIKLIKRMLTSCQGVEAKFLIRSLESKLRIGLAEKTVLIS 297
           EVF+NL+ IA S+GKDSQT+KIKLIKRMLT+C+G EAKFLIRSLESKLRIGLAEKTVLIS
Sbjct: 266 EVFENLRLIAKSEGKDSQTRKIKLIKRMLTACEGTEAKFLIRSLESKLRIGLAEKTVLIS 325

Query: 298 LSKALLVYEYGESDKDIDMETVENAEQKIRDAFCQVPNYEVVIDSCLKHGIMNLDQHCSL 357
           LSKALLV+E  + +KD DME +E AEQKIRDAFCQVPNYE+VI+SCLK+GIM L+ HCSL
Sbjct: 326 LSKALLVHE-CKDNKDFDMELLETAEQKIRDAFCQVPNYEIVINSCLKYGIMELETHCSL 384

Query: 358 RPAIPLKPMLAKPTKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDGTMRIYSRNGENM 417
           RP IPLKPMLAKPTK+I+EI DRFQ + FT EYKYDGERAQVHLL DGTMRIYSRNGENM
Sbjct: 385 RPGIPLKPMLAKPTKAINEILDRFQGEIFTSEYKYDGERAQVHLLSDGTMRIYSRNGENM 444

Query: 418 TERYPEIHIRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDVDINEIKVR 477
           TERYPEIHIRDF+ D   T +LILDCEAVAWD EQNKILPFQVLSTRKRKDVD+ ++KV+
Sbjct: 445 TERYPEIHIRDFIADPLVTSTLILDCEAVAWDNEQNKILPFQVLSTRKRKDVDLKDVKVK 504

Query: 478 VCLFAFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLDQS 537
           VCLFAFDIL HNDEKLINKSL+ERR IL  +TK VTGEFQ+ATEMT++NL+ELQ FLDQS
Sbjct: 505 VCLFAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTSSNLDELQKFLDQS 564

Query: 538 VKNSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGKRTG 597
           V +SCEGLMVKML+G ESHYEPSKRSRNWLKLKKDYL G+GDSLDLCV+GAY+GRGKRTG
Sbjct: 565 VHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVIGAYYGRGKRTG 624

Query: 598 NYGGFLLGCYNQDTGEFETACKIGTGFSDEVLQQLHERLKSTVIDLPKATYVFDPSAEPD 657
            YGGFLLGCYNQDTGEFET CKIGTGFSDE+LQQL+ RL  TV+D PKAT+V+D SAEPD
Sbjct: 625 MYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQQLYTRLTPTVLDGPKATFVYDSSAEPD 684

Query: 658 VWFEPTLLFEVLTADLSLSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQIVE 717
           VWFEPTLLFEVLTADLSLSP+YKAGSSTYDKG+SLRFPRF+R REDKGVEDATSSEQI+E
Sbjct: 685 VWFEPTLLFEVLTADLSLSPIYKAGSSTYDKGISLRFPRFIRTREDKGVEDATSSEQIIE 744

Query: 718 MYENQANLQ 726
           +YENQA+ Q
Sbjct: 745 LYENQAHTQ 753

>CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {ON}
           highly similar to uniprot|P04819 Saccharomyces
           cerevisiae YDL164c CDC9 DNA ligase
          Length = 724

 Score = 1028 bits (2657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/729 (68%), Positives = 586/729 (80%), Gaps = 57/729 (7%)

Query: 21  MKRQMTLNNFFTSVKK----------SDTNTPA----------STTP-KKMEKDESPQIP 59
           MKRQ TL  FF+SVKK          +D  T A          + +P KKM+ + +  + 
Sbjct: 27  MKRQATLARFFSSVKKDADGDKKGEQADVKTAAVDLNSHEVDANKSPLKKMKLESTGSLT 86

Query: 60  ATKTA---EEKHENMDVDTDPVISSSEVSAKRNXXXXXXXXXXXXXKKIKIQDENNDTKE 116
           ATK     +E+HE   + + P     +V +K                             
Sbjct: 87  ATKNGNQGKEEHEGTPIASTP----RQVDSK----------------------------- 113

Query: 117 FYSTVPYADLCNLFQEIEGISSRLAIIKLCSSFLISVMKLDPRNLIPMTYLFINKLGPDY 176
           F+  VPY+DLCNLF+EIEG SSRLAIIKLCS F I +MK DP+NLIP+TYLFINKLGPDY
Sbjct: 114 FFCKVPYSDLCNLFEEIEGTSSRLAIIKLCSDFFIKIMKEDPQNLIPVTYLFINKLGPDY 173

Query: 177 MPXXXXXXXXXXXIKTIAESCGRSLQQIKTKYHEIGDLGQIALEARKVQPTMFKPKPLTV 236
            P           +KTI+ESCG+S+QQIK +Y EIGDLGQIALEAR VQPTMFKPKPL V
Sbjct: 174 EPGLELGLGENLLMKTISESCGKSMQQIKNQYREIGDLGQIALEARNVQPTMFKPKPLVV 233

Query: 237 GEVFQNLKSIASSQGKDSQTKKIKLIKRMLTSCQGVEAKFLIRSLESKLRIGLAEKTVLI 296
           GEVF+NLK+IA SQGKDSQTKK+KLIKRMLT+CQG EAKFLIRSLESKLRIGLAEKTVLI
Sbjct: 234 GEVFENLKTIAKSQGKDSQTKKMKLIKRMLTACQGTEAKFLIRSLESKLRIGLAEKTVLI 293

Query: 297 SLSKALLVYEYGESDKDIDMETVENAEQKIRDAFCQVPNYEVVIDSCLKHGIMNLDQHCS 356
           +LSKALL+++   S+K+  M+ VE AEQKIRDAFCQVPNYE+VI++CL +GIM LD+HC+
Sbjct: 294 ALSKALLIHDEKYSNKEPSMDVVEQAEQKIRDAFCQVPNYELVINACLDYGIMKLDEHCT 353

Query: 357 LRPAIPLKPMLAKPTKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDGTMRIYSRNGEN 416
           ++P IPLKPMLAKPTK+I+E+ DRFQ Q FT EYKYDGERAQVHLL+DGTMRIYSRNGEN
Sbjct: 354 IQPGIPLKPMLAKPTKAINEVLDRFQGQTFTSEYKYDGERAQVHLLKDGTMRIYSRNGEN 413

Query: 417 MTERYPEIHIRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDVDINEIKV 476
           MTERYPEI I+DF+ D + T SLILDCEAVAWDKEQNKILPFQVL+TRKRKDV+INE+KV
Sbjct: 414 MTERYPEIQIKDFLADPASTTSLILDCEAVAWDKEQNKILPFQVLTTRKRKDVNINEVKV 473

Query: 477 RVCLFAFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLDQ 536
           RVCLFAFDILLHND +LIN+ L +RR++LH +TK V GEFQ+AT+MTT+NL+ELQ FLD+
Sbjct: 474 RVCLFAFDILLHNDMRLINEPLSKRREVLHEVTKPVEGEFQYATQMTTSNLDELQKFLDE 533

Query: 537 SVKNSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGKRT 596
           SVKNSCEGLMVKM++G ES+YEPSKRSRNWLKLKKDYL GVGDSLDLCVLGAYFGRGKRT
Sbjct: 534 SVKNSCEGLMVKMMDGVESYYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYFGRGKRT 593

Query: 597 GNYGGFLLGCYNQDTGEFETACKIGTGFSDEVLQQLHERLKSTVIDLPKATYVFDPSAEP 656
           G YGGFLLGCYN D+ +FET CKIGTGFS+E+LQ L+E+L  TVID PK TYVFD SAEP
Sbjct: 594 GTYGGFLLGCYNADSEDFETCCKIGTGFSEEMLQTLYEKLSPTVIDGPKGTYVFDSSAEP 653

Query: 657 DVWFEPTLLFEVLTADLSLSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQIV 716
           DVWFEPT+LFEVLTADLSLSP+YKAGSS YDKG+SLRFPRFLR+R+DK VEDATSSEQI+
Sbjct: 654 DVWFEPTMLFEVLTADLSLSPIYKAGSSVYDKGISLRFPRFLRIRDDKSVEDATSSEQII 713

Query: 717 EMYENQANL 725
           EMY+NQ+++
Sbjct: 714 EMYQNQSHV 722

>TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {ON}
           Anc_7.343 YDL164C
          Length = 705

 Score = 1026 bits (2652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/726 (68%), Positives = 585/726 (80%), Gaps = 23/726 (3%)

Query: 1   MWKSVCKPLLTNRLTTIHPKMKRQMTLNNFFTSVKKSDTNTPASTTPKKMEKDESPQIPA 60
           M++ V +PL+   +       K+Q TL  FF++V+K DT    +   K +E  ++   P 
Sbjct: 1   MFRVVGRPLVELLINKGMSSGKKQATLARFFSAVQKDDTKEKVNGDVKIIESRDNQDEPV 60

Query: 61  TKTAEEKHENMDVDTDPV-ISSSEVSAKRNXXXXXXXXXXXXXKKIKIQDENNDTKEFYS 119
           TK  +         + PV + +S +S  ++               ++  D+      +YS
Sbjct: 61  TKKFK--------SSSPVKLQTSSLSPVKSAG-------------VESGDKPVSPDLYYS 99

Query: 120 TVPYADLCNLFQEIEGISSRLAIIKLCSSFLISVMKLDPRNLIPMTYLFINKLGPDYMPX 179
            VPY+D+CN+FQEIEG SSRL+IIK+CS F   +MK +P+NLIP TYLFIN+LGPDY P 
Sbjct: 100 KVPYSDVCNVFQEIEGTSSRLSIIKICSEFFSRIMKDNPQNLIPTTYLFINRLGPDYEPG 159

Query: 180 XXXXXXXXXXIKTIAESCGRSLQQIKTKYHEIGDLGQIALEARKVQPTMFKPKPLTVGEV 239
                     +KTI+E+CG+SL Q+K +Y E+GDLGQIALEAR VQPTMFKPKPLTVGEV
Sbjct: 160 LELGLGEGLLMKTISEACGKSLVQVKNRYREMGDLGQIALEARNVQPTMFKPKPLTVGEV 219

Query: 240 FQNLKSIASSQGKDSQTKKIKLIKRMLTSCQGVEAKFLIRSLESKLRIGLAEKTVLISLS 299
           F+NL++IA SQGKDSQT+KIKLIKRMLT+C+GVEAKFLIRSLESKLRIGLAEKTVLISLS
Sbjct: 220 FENLRAIAHSQGKDSQTRKIKLIKRMLTACEGVEAKFLIRSLESKLRIGLAEKTVLISLS 279

Query: 300 KALLVYEYGESDKDIDMETVENAEQKIRDAFCQVPNYEVVIDSCLKHGIMNLDQHCSLRP 359
           KALL  E GE+ K+  ME VE AE KIRDAFCQVPNYE+VI++CL +GIM LD+HC LRP
Sbjct: 280 KALLTNE-GETGKEPSMELVEQAEAKIRDAFCQVPNYEIVINACLDYGIMELDKHCRLRP 338

Query: 360 AIPLKPMLAKPTKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDGTMRIYSRNGENMTE 419
            IPLKPMLAKPTKSI+E+ DRFQ Q FT EYKYDGERAQVHLLEDGTMRIYSRNGENMTE
Sbjct: 339 GIPLKPMLAKPTKSITEVLDRFQGQTFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTE 398

Query: 420 RYPEIHIRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDVDINEIKVRVC 479
           RYPEI IRDFV DL HTK+LILDCEAVAWDK Q KILPFQVLSTRKRKDV+  ++KVRVC
Sbjct: 399 RYPEISIRDFVADLEHTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEAKDVKVRVC 458

Query: 480 LFAFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLDQSVK 539
           LFAFDI+ HN E+ INKSL+ERR++L  +TK V GEFQ+A E+TT+++EELQ FLDQSVK
Sbjct: 459 LFAFDIICHNGERQINKSLRERRELLAQVTKPVAGEFQYAVELTTSSVEELQKFLDQSVK 518

Query: 540 NSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGKRTGNY 599
           +SCEGLMVKML+G ESHYEPSKRSRNWLKLKKDYL GVGDSLDLCVLGAY+GRGKRTG Y
Sbjct: 519 DSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAYYGRGKRTGTY 578

Query: 600 GGFLLGCYNQDTGEFETACKIGTGFSDEVLQQLHERLKSTVIDLPKATYVFDPSAEPDVW 659
           GGFLLGCYNQD+GEFET CKIGTGFSDE+LQQL+ER   T +D PKATYVFD SAEPDVW
Sbjct: 579 GGFLLGCYNQDSGEFETCCKIGTGFSDEMLQQLYERFSKTTLDGPKATYVFDSSAEPDVW 638

Query: 660 FEPTLLFEVLTADLSLSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQIVEMY 719
           FEPT LFEVLTADLSLSPVYKAG+STYDKGVSLRFPRF+RLR+DK VEDATSS QIVE+Y
Sbjct: 639 FEPTTLFEVLTADLSLSPVYKAGASTYDKGVSLRFPRFVRLRDDKSVEDATSSAQIVELY 698

Query: 720 ENQANL 725
           ++Q+++
Sbjct: 699 QDQSHV 704

>NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {ON}
           Anc_7.343 YDL164C
          Length = 765

 Score = 1023 bits (2644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/612 (79%), Positives = 543/612 (88%), Gaps = 2/612 (0%)

Query: 114 TKEFYSTVPYADLCNLFQEIEGISSRLAIIKLCSSFLISVMKLDPRNLIPMTYLFINKLG 173
           +K F   +PY ++C LFQEIE  SSRL+IIKLCS FLI +MK DP+NLIP+TYLFINKLG
Sbjct: 152 SKPFLCAIPYKEVCQLFQEIETTSSRLSIIKLCSDFLIKIMKQDPQNLIPVTYLFINKLG 211

Query: 174 PDYMPXXXXXXXXXXXIKTIAESCGRSLQQIKTKYHEIGDLGQIALEARKVQPTMFKPKP 233
           PDY P           +KTI+ESCG+SL QI+ +Y E+GDLGQIALEAR VQPTMFKPKP
Sbjct: 212 PDYEPGLELGLGEGLLMKTISESCGKSLTQIRAQYRELGDLGQIALEARNVQPTMFKPKP 271

Query: 234 LTVGEVFQNLKSIASSQGKDSQTKKIKLIKRMLTSCQ-GVEAKFLIRSLESKLRIGLAEK 292
           LTVGEVF NLK IA + GKDSQTKKIKLIKRMLT+C+ GVEAKFLIRSLESKLRIGLAEK
Sbjct: 272 LTVGEVFNNLKMIAKAAGKDSQTKKIKLIKRMLTACEDGVEAKFLIRSLESKLRIGLAEK 331

Query: 293 TVLISLSKALLVYEYGESDKDIDMETVENAEQKIRDAFCQVPNYEVVIDSCLKHGIMNLD 352
           TVLISLSKALLV E+ +++KD DME +E AE KIRDAFCQVPNYE+VI+SCL++GIMNL+
Sbjct: 332 TVLISLSKALLVKEF-DANKDFDMELLETAEGKIRDAFCQVPNYEIVINSCLQYGIMNLN 390

Query: 353 QHCSLRPAIPLKPMLAKPTKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDGTMRIYSR 412
           +HCSLRP IPLKPMLAKPTK+I+EI DRFQ + FT EYKYDGERAQVHLLEDGTMRIYSR
Sbjct: 391 EHCSLRPGIPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDGTMRIYSR 450

Query: 413 NGENMTERYPEIHIRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDVDIN 472
           NGENMTERYPEIHI DFV D + TK+LILDCEAVAWDKEQ KILPFQVLSTRKRKDV   
Sbjct: 451 NGENMTERYPEIHIGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDVLAK 510

Query: 473 EIKVRVCLFAFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTTNLEELQS 532
           ++KVRVCLFAFDIL HN  KLIN SL+ERR+ILH +T    GEFQ+ATE+TT+NL+ELQ 
Sbjct: 511 DVKVRVCLFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTSNLDELQK 570

Query: 533 FLDQSVKNSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGR 592
           FLDQSV +SCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYL G+GDSLDLCVLGAY+GR
Sbjct: 571 FLDQSVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVLGAYYGR 630

Query: 593 GKRTGNYGGFLLGCYNQDTGEFETACKIGTGFSDEVLQQLHERLKSTVIDLPKATYVFDP 652
           GKRTG YGGFLLGCYN +TGEFET CKIGTGFSDE+LQQLHE+LK+TVID PKATY++D 
Sbjct: 631 GKRTGTYGGFLLGCYNDNTGEFETCCKIGTGFSDEMLQQLHEKLKATVIDGPKATYIYDS 690

Query: 653 SAEPDVWFEPTLLFEVLTADLSLSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSS 712
           SAEPDVWFEP+LLFEVLTADLSLSP+YKAGSS YDKGVSLRFPRF+R+REDKGVEDATSS
Sbjct: 691 SAEPDVWFEPSLLFEVLTADLSLSPIYKAGSSAYDKGVSLRFPRFIRIREDKGVEDATSS 750

Query: 713 EQIVEMYENQAN 724
           EQI+E+YENQ++
Sbjct: 751 EQIIELYENQSH 762

>Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}
           YDL164C (REAL)
          Length = 845

 Score = 1006 bits (2602), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/722 (68%), Positives = 579/722 (80%), Gaps = 15/722 (2%)

Query: 20  KMKRQMTLNNFFTSVKK--SDTNTPASTTPKKM-----EKDESPQIPATKTAEEKHENMD 72
           K  +Q TL  FFTS+K   S   +P   + K M     + D S  +   K +++      
Sbjct: 123 KKPKQATLARFFTSMKNKPSGNTSPPDKSAKHMLQDSVDDDSSVGVRNVKKSQQVAVAQA 182

Query: 73  VDTDPVISSSEVSAKRNXXXXXXXXXXXXXKKI--KIQD---ENNDTKEFYSTVPYADLC 127
               P +SS   S   +             + +  K++D    +ND+  + S +PY+D+C
Sbjct: 183 ATVQPFMSSFPSSLPSSAPSSSGADLSQKFQGLGPKVEDFEMNSNDSDHYSSNIPYSDVC 242

Query: 128 NLFQEIEGISSRLAIIKLCSSFLISVMKLDPRNLIPMTYLFINKLGPDYMPXXXXXXXXX 187
            +F +IE ISSRL II++CS F I VMK   +NLIP TYLFIN+LGPDY           
Sbjct: 243 EVFNQIEAISSRLEIIRICSDFFIKVMKQSSKNLIPTTYLFINRLGPDYEAGLELGLGEN 302

Query: 188 XXIKTIAESCGRSLQQIKTKYHEIGDLGQIALEARKVQPTMFKPKPLTVGEVFQNLKSIA 247
             +KTI+ESCG+S+ QIK KY EIGDLG+IA+ AR VQPTMFKPKPLTVGEVF+NL++IA
Sbjct: 303 LLMKTISESCGKSMSQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLTVGEVFKNLRTIA 362

Query: 248 SSQGKDSQTKKIKLIKRMLTSCQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLVYEY 307
            +QGKDSQ +KIKLIKRMLT+CQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALL+++ 
Sbjct: 363 KTQGKDSQLRKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHDE 422

Query: 308 GE---SDKDIDMETVENAEQKIRDAFCQVPNYEVVIDSCLKHGIMNLDQHCSLRPAIPLK 364
                +DKDI M+ +E+A+QKIRDAFCQVPNYE+VI+SCL+HGIMNLD++C+LRP IPLK
Sbjct: 423 NRENSADKDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLK 482

Query: 365 PMLAKPTKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEI 424
           PMLAKPTK+I+E+ DRFQ + FT EYKYDGERAQVHLL DGTMRIYSRNGENMTERYPEI
Sbjct: 483 PMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYPEI 542

Query: 425 HIRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDVDINEIKVRVCLFAFD 484
            I DF+ DL  TK+LILDCEAVAWDK+Q KILPFQVLSTRKRKDV++N++KVRVCLFAFD
Sbjct: 543 KITDFIQDLDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDVELNDVKVRVCLFAFD 602

Query: 485 ILLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLDQSVKNSCEG 544
           IL HNDE+LIN SL+ERR+ L  +TK V GEFQ+AT++ T NL+ELQ FLD+SV +SCEG
Sbjct: 603 ILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNNLDELQKFLDESVNHSCEG 662

Query: 545 LMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGKRTGNYGGFLL 604
           LMVKML+G ESHYEPSKRSRNWLKLKKDYL GVGDSLDLCVLGAY+GRGKRTG YGGFLL
Sbjct: 663 LMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLL 722

Query: 605 GCYNQDTGEFETACKIGTGFSDEVLQQLHERLKSTVIDLPKATYVFDPSAEPDVWFEPTL 664
           GCYNQDTGEFET CKIGTGFSDE+LQ LH RL  T+ID PKATYVFD SAEPDVWFEPT 
Sbjct: 723 GCYNQDTGEFETCCKIGTGFSDEMLQLLHARLTPTIIDGPKATYVFDSSAEPDVWFEPTT 782

Query: 665 LFEVLTADLSLSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQIVEMYENQAN 724
           LFEVLTADLSLSP+YKAGS+T+DKGVSLRFPRFLR+REDKGVEDATSS+QIVE+YENQ++
Sbjct: 783 LFEVLTADLSLSPIYKAGSTTFDKGVSLRFPRFLRIREDKGVEDATSSDQIVELYENQSH 842

Query: 725 LQ 726
           +Q
Sbjct: 843 VQ 844

>KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.343
           YDL164C
          Length = 710

 Score = 1001 bits (2587), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/613 (76%), Positives = 541/613 (88%), Gaps = 1/613 (0%)

Query: 115 KEFYSTVPYADLCNLFQEIEGISSRLAIIKLCSSFLISVMKLDPRNLIPMTYLFINKLGP 174
           +EF   +PYAD+C LFQEIE ISSRL IIKLCS F    MK +  NLIP+TYLFINKLGP
Sbjct: 99  QEFVCDIPYADVCVLFQEIENISSRLQIIKLCSEFFTKAMKQNTANLIPLTYLFINKLGP 158

Query: 175 DYMPXXXXXXXXXXXIKTIAESCGRSLQQIKTKYHEIGDLGQIALEARKVQPTMFKPKPL 234
           DY             +KTI+ESCG+SLQQ+K  Y +IGDLG IA+ AR VQPTMFKPKPL
Sbjct: 159 DYEMGLELGLGENLLMKTISESCGKSLQQVKLDYKDIGDLGTIAMNARNVQPTMFKPKPL 218

Query: 235 TVGEVFQNLKSIASSQGKDSQTKKIKLIKRMLTSCQGVEAKFLIRSLESKLRIGLAEKTV 294
           TVG VFQNLK IA S GKDSQ KKI+LIK++LT+C+G+EAK+LIRSLESKLRIGLAEK+V
Sbjct: 219 TVGYVFQNLKLIAKSSGKDSQLKKIRLIKKLLTACKGIEAKYLIRSLESKLRIGLAEKSV 278

Query: 295 LISLSKALLVYEYGESDKDIDMETVENAEQKIRDAFCQVPNYEVVIDSCLKHGIMNLDQH 354
           LISLSKALL+ EY  +  D DME +E AEQKIRDAFCQ+PNYE+VI+SCLK+GIMNLD+H
Sbjct: 279 LISLSKALLINEYNNT-LDPDMELIEKAEQKIRDAFCQIPNYEIVINSCLKYGIMNLDEH 337

Query: 355 CSLRPAIPLKPMLAKPTKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDGTMRIYSRNG 414
           CSLRP IPLKPMLAKPTK+I E+FDRFQ+  FT EYKYDGERAQVHL+ DG+MRIYSRNG
Sbjct: 338 CSLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTSEYKYDGERAQVHLMNDGSMRIYSRNG 397

Query: 415 ENMTERYPEIHIRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDVDINEI 474
           ENMTERYPEI++ DF+ DL+ TKSLI+DCEAVAWD+E+ KILPFQVLSTRKRKDVDI +I
Sbjct: 398 ENMTERYPEINVTDFIKDLNLTKSLIIDCEAVAWDREEKKILPFQVLSTRKRKDVDIKDI 457

Query: 475 KVRVCLFAFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFL 534
           KVR+CLFAFDIL HNDEKLINKSL+ERR+ILHS+T+EV GEF +A E++T NL+ELQ FL
Sbjct: 458 KVRICLFAFDILCHNDEKLINKSLRERREILHSVTREVHGEFTYAKELSTNNLDELQLFL 517

Query: 535 DQSVKNSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGK 594
           DQSVK+SCEGLMVK+L+GE+SHYEPSKRSRNWLKLKKDYL GVGDSLDLCVLGA++GRGK
Sbjct: 518 DQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAFYGRGK 577

Query: 595 RTGNYGGFLLGCYNQDTGEFETACKIGTGFSDEVLQQLHERLKSTVIDLPKATYVFDPSA 654
           RTG YGGFLLGCYNQDTGEFETACKIGTGFSDEVLQ L++RLKST ID PKATY++D SA
Sbjct: 578 RTGTYGGFLLGCYNQDTGEFETACKIGTGFSDEVLQSLYDRLKSTTIDGPKATYIYDSSA 637

Query: 655 EPDVWFEPTLLFEVLTADLSLSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQ 714
           +PDVWFEPTLLFEVLTADLS+SP+YKAG+STY KG+SLRFPRF+RLREDK VE+ATSSEQ
Sbjct: 638 QPDVWFEPTLLFEVLTADLSMSPIYKAGASTYSKGISLRFPRFIRLREDKSVEEATSSEQ 697

Query: 715 IVEMYENQANLQQ 727
           I+E+YENQ+++ +
Sbjct: 698 IIELYENQSHVAK 710

>Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  999 bits (2584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/732 (66%), Positives = 580/732 (79%), Gaps = 14/732 (1%)

Query: 9   LLTNRLTTIHPKMKRQMTLNNFFTSVKK---SDTNTPASTTPKKMEKDESPQIPATKTAE 65
            +++ L +   K  +Q TL  FFTS+K      +++P      K+E   +       +A 
Sbjct: 23  FMSSSLPSSAGKKPKQATLARFFTSMKNKPSGGSSSPEKAVKHKIENGTNEISSEGASAI 82

Query: 66  EKHENMDVDTDPVISSSEVSAKRNXXXXXXXXXXXXXKK------IKIQDENN--DTKEF 117
           +K +++     PV  S   S+                 +       K+++E    D   +
Sbjct: 83  KKLKHLSAVQTPVEQSDMSSSSSPLPSSAPSSSGVDASQKSRELTPKVEEEQGPIDNDHY 142

Query: 118 YSTVPYADLCNLFQEIEGISSRLAIIKLCSSFLISVMKLDPRNLIPMTYLFINKLGPDYM 177
            S +PY+++C +F EIE ISSRL II++CS F I +MK   +NLIP TYLFIN+LGPDY 
Sbjct: 143 SSNIPYSEVCEVFNEIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRLGPDYE 202

Query: 178 PXXXXXXXXXXXIKTIAESCGRSLQQIKTKYHEIGDLGQIALEARKVQPTMFKPKPLTVG 237
           P           +KTI+ESCG+S+ QIK KY EIGDLG+IA+ AR VQPTMFKPKPLTVG
Sbjct: 203 PGLELGLGENLLMKTISESCGKSMNQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLTVG 262

Query: 238 EVFQNLKSIASSQGKDSQTKKIKLIKRMLTSCQGVEAKFLIRSLESKLRIGLAEKTVLIS 297
           EVF+NL+SIA +QGKDSQ +K+KLIKRMLT+CQGVEAKFLIRSLESKLRIGLAEKTVLIS
Sbjct: 263 EVFKNLRSIAKTQGKDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLIS 322

Query: 298 LSKALLVYE-YGESD--KDIDMETVENAEQKIRDAFCQVPNYEVVIDSCLKHGIMNLDQH 354
           LSKALL++   GE+    DI M+ +E+A+QKIRDAFCQVPNYE+VI+SCL+HGIMNLD+ 
Sbjct: 323 LSKALLLHGGNGENSHVNDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKF 382

Query: 355 CSLRPAIPLKPMLAKPTKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDGTMRIYSRNG 414
           C+L+P IPLKPMLAKPTK+I+E+ DRFQ + FT EYKYDGERAQVHLL+DGTMRIYSRNG
Sbjct: 383 CTLKPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDGTMRIYSRNG 442

Query: 415 ENMTERYPEIHIRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDVDINEI 474
           ENMTERYPEI I DF+ DL  TK+LILDCEAVAWDKEQ KILPFQVLSTRKRKDV+++++
Sbjct: 443 ENMTERYPEIKITDFIQDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDVELSDV 502

Query: 475 KVRVCLFAFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFL 534
           KVRVCLFAFD+L HN E+LINKSL+ERR+ L  +TK V GEFQ+AT++ T NL+ELQ FL
Sbjct: 503 KVRVCLFAFDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTDNLDELQKFL 562

Query: 535 DQSVKNSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGK 594
           D+SV  SCEGLMVKMLEG ESHYEPSKRSRNWLKLKKDYL GVGDSLDLCVLGAY+GRGK
Sbjct: 563 DESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGK 622

Query: 595 RTGNYGGFLLGCYNQDTGEFETACKIGTGFSDEVLQQLHERLKSTVIDLPKATYVFDPSA 654
           RTG YGGFLLGCYNQDTGEFET CKIGTGFSDE LQQLHERL  T+ID PKAT+VFD SA
Sbjct: 623 RTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDESLQQLHERLTPTIIDGPKATFVFDSSA 682

Query: 655 EPDVWFEPTLLFEVLTADLSLSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQ 714
           EPDVWFEPT LFEVLTADLSLSP+YKAGS+T+ KGVSLRFPRFLR+REDKGVEDATSSEQ
Sbjct: 683 EPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFAKGVSLRFPRFLRIREDKGVEDATSSEQ 742

Query: 715 IVEMYENQANLQ 726
           IVE+YENQ+++Q
Sbjct: 743 IVELYENQSHVQ 754

>YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}
           CDC9DNA ligase found in the nucleus and mitochondria, an
           essential enzyme that joins Okazaki fragments during DNA
           replication; also acts in nucleotide excision repair,
           base excision repair, and recombination
          Length = 755

 Score =  996 bits (2575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/725 (66%), Positives = 582/725 (80%), Gaps = 22/725 (3%)

Query: 20  KMKRQMTLNNFFTSVKKSDTNTPASTTP------KKMEKDESPQIP-----ATKTAEEKH 68
           K  +Q TL  FFTS+K    N P   TP      K M +D    +      ATK  ++  
Sbjct: 34  KKPKQATLARFFTSMK----NKPTEGTPSPKKSSKHMLEDRMDNVSGEEEYATKKLKQTA 89

Query: 69  ENMDVDTDPVISSSEVSAKRNXXXXXXXXXXXXXKKI--KIQD--ENNDTKEFYSTVPYA 124
               V     + S+  S   +             +++  +++D   +N+   + S +PY+
Sbjct: 90  VTHTVAAPSSMGSNFSSIPSSAPSSGVADSPQQSQRLVGEVEDALSSNNNDHYSSNIPYS 149

Query: 125 DLCNLFQEIEGISSRLAIIKLCSSFLISVMKLDPRNLIPMTYLFINKLGPDYMPXXXXXX 184
           ++C +F +IE ISSRL II++CS F I +MK   +NLIP TYLFIN+LGPDY        
Sbjct: 150 EVCEVFNKIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRLGPDYEAGLELGL 209

Query: 185 XXXXXIKTIAESCGRSLQQIKTKYHEIGDLGQIALEARKVQPTMFKPKPLTVGEVFQNLK 244
                +KTI+E+CG+S+ QIK KY +IGDLG+IA+ AR VQPTMFKPKPLTVGEVF+NL+
Sbjct: 210 GENLLMKTISETCGKSMSQIKLKYKDIGDLGEIAMGARNVQPTMFKPKPLTVGEVFKNLR 269

Query: 245 SIASSQGKDSQTKKIKLIKRMLTSCQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLV 304
           +IA +QGKDSQ KK+KLIKRMLT+C+G+EAKFLIRSLESKLRIGLAEKTVLISLSKALL+
Sbjct: 270 AIAKTQGKDSQLKKMKLIKRMLTACKGIEAKFLIRSLESKLRIGLAEKTVLISLSKALLL 329

Query: 305 YEYGESD---KDIDMETVENAEQKIRDAFCQVPNYEVVIDSCLKHGIMNLDQHCSLRPAI 361
           ++    D   KD+ M+ +E+A+QKIRDAFCQVPNYE+VI+SCL+HGIMNLD++C+LRP I
Sbjct: 330 HDENREDSPDKDVPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGI 389

Query: 362 PLKPMLAKPTKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDGTMRIYSRNGENMTERY 421
           PLKPMLAKPTK+I+E+ DRFQ + FT EYKYDGERAQVHLL DGTMRIYSRNGENMTERY
Sbjct: 390 PLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERY 449

Query: 422 PEIHIRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDVDINEIKVRVCLF 481
           PEI+I DF+ DL  TK+LILDCEAVAWDK+Q KILPFQVLSTRKRKDV++N++KV+VCLF
Sbjct: 450 PEINITDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVELNDVKVKVCLF 509

Query: 482 AFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLDQSVKNS 541
           AFDIL +NDE+LINKSL+ERR+ L  +TK V GEFQ+AT++TT NL+ELQ FLD+SV +S
Sbjct: 510 AFDILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNNLDELQKFLDESVNHS 569

Query: 542 CEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGKRTGNYGG 601
           CEGLMVKMLEG ESHYEPSKRSRNWLKLKKDYL GVGDSLDLCVLGAY+GRGKRTG YGG
Sbjct: 570 CEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGKRTGTYGG 629

Query: 602 FLLGCYNQDTGEFETACKIGTGFSDEVLQQLHERLKSTVIDLPKATYVFDPSAEPDVWFE 661
           FLLGCYNQDTGEFET CKIGTGFSDE+LQ LH+RL  T+ID PKAT+VFD SAEPDVWFE
Sbjct: 630 FLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHDRLTPTIIDGPKATFVFDSSAEPDVWFE 689

Query: 662 PTLLFEVLTADLSLSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQIVEMYEN 721
           PT LFEVLTADLSLSP+YKAGS+T+DKGVSLRFPRFLR+REDKGVEDATSS+QIVE+YEN
Sbjct: 690 PTTLFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQIVELYEN 749

Query: 722 QANLQ 726
           Q+++Q
Sbjct: 750 QSHMQ 754

>Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  989 bits (2557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/626 (73%), Positives = 545/626 (87%), Gaps = 3/626 (0%)

Query: 104 KIKIQDENNDTKEFYSTVPYADLCNLFQEIEGISSRLAIIKLCSSFLISVMKLDPRNLIP 163
           +++ +  +ND   + S +PY+++C +F +IE ISSRL II++CS F I +M    +NLIP
Sbjct: 129 QVEKEPSSNDNDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMNQSSKNLIP 188

Query: 164 MTYLFINKLGPDYMPXXXXXXXXXXXIKTIAESCGRSLQQIKTKYHEIGDLGQIALEARK 223
            TYLFIN+LGPDY             +KTI+ESCG+S+ QIK KY E+GDLG+IA+ AR 
Sbjct: 189 TTYLFINRLGPDYEAGLELGLGENLLMKTISESCGKSMSQIKLKYKEMGDLGEIAMGARN 248

Query: 224 VQPTMFKPKPLTVGEVFQNLKSIASSQGKDSQTKKIKLIKRMLTSCQGVEAKFLIRSLES 283
           VQPTMFKPK LTVGEVF+NL++IA +QGKDSQ +K+KLIKRMLT+CQGVEAKFLIRSLES
Sbjct: 249 VQPTMFKPKALTVGEVFKNLRTIAKTQGKDSQLRKMKLIKRMLTACQGVEAKFLIRSLES 308

Query: 284 KLRIGLAEKTVLISLSKALLVYEYGES---DKDIDMETVENAEQKIRDAFCQVPNYEVVI 340
           KLRIGLAEKTVLISLSKALL+++  +    DK+I M+ +E+A+Q+IRDAFCQVPNYE+VI
Sbjct: 309 KLRIGLAEKTVLISLSKALLLHDENKENSPDKEIPMDVLESAQQRIRDAFCQVPNYEIVI 368

Query: 341 DSCLKHGIMNLDQHCSLRPAIPLKPMLAKPTKSISEIFDRFQDQKFTCEYKYDGERAQVH 400
           +SCL HGIMNLD++C+LRP IPLKPMLAKPTK+I+E+ DRFQ + FT EYKYDGERAQVH
Sbjct: 369 NSCLNHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVH 428

Query: 401 LLEDGTMRIYSRNGENMTERYPEIHIRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQV 460
           LL DGTMRIYSRNGENMTERYPEI I DF+ DL+ TK+LILDCEAVAWDKEQ KILPFQ+
Sbjct: 429 LLNDGTMRIYSRNGENMTERYPEIKITDFIQDLNSTKNLILDCEAVAWDKEQKKILPFQI 488

Query: 461 LSTRKRKDVDINEIKVRVCLFAFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFAT 520
           LSTRKRKDV+++++KV+VCLFAFDIL +NDE+LINKSL+ERR+ L  +TK V GEFQ+AT
Sbjct: 489 LSTRKRKDVELHDVKVKVCLFAFDILCYNDERLINKSLRERREHLAKVTKVVPGEFQYAT 548

Query: 521 EMTTTNLEELQSFLDQSVKNSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDS 580
           ++ T NL+ELQ FLD+SV NSCEGLMVKML+G ESHYEPSKRSRNWLKLKKDYL GVGDS
Sbjct: 549 QIITNNLDELQKFLDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDS 608

Query: 581 LDLCVLGAYFGRGKRTGNYGGFLLGCYNQDTGEFETACKIGTGFSDEVLQQLHERLKSTV 640
           LDLCVLGAY+GRGKRTG YGGFLLGCYNQDTGEFET CKIGTGFSDE+LQ LHERL  T+
Sbjct: 609 LDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHERLTPTI 668

Query: 641 IDLPKATYVFDPSAEPDVWFEPTLLFEVLTADLSLSPVYKAGSSTYDKGVSLRFPRFLRL 700
           ID PKAT+VFD SAEPDVWFEPT LFEVLTADLSLSP+YKAGS+T+DKGVSLRFPRFLR+
Sbjct: 669 IDGPKATFVFDASAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRI 728

Query: 701 REDKGVEDATSSEQIVEMYENQANLQ 726
           REDKGVEDATSS+QI+E+YENQ+++Q
Sbjct: 729 REDKGVEDATSSDQIIELYENQSHVQ 754

>ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} similar
           to uniprot|P04819 Saccharomyces cerevisiae YDL164C CDC9
           DNA ligase found in the nucleus and mitochondria an
           essential enzyme that joins Okazaki fragments during DNA
           replication also acts in nucleotide excision repair base
           excision repair and recombination
          Length = 731

 Score =  984 bits (2543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/715 (66%), Positives = 567/715 (79%), Gaps = 20/715 (2%)

Query: 20  KMKRQMTLNNFFTSVKKSDTNTPASTTPKKMEKDESPQIPATKTAEE----KHENMDVDT 75
           K  +Q TL  FF+SVK  D N+P        +K+ +P  P T   +     +  + + ++
Sbjct: 27  KQAKQATLAKFFSSVK--DRNSPT-------KKNATPAFPTTTNVKRESPVRSNSNEKES 77

Query: 76  DPVISSSEVSAKRNXXXXXXXXXXXXXKKIKIQDENNDTK-----EFYSTVPYADLCNLF 130
            P+   S   +                KK+K++ ++N T      + +STVPYAD+CN+F
Sbjct: 78  SPMFDDSNGRSSACSSAGLEMESAPAPKKLKMESDSNSTSKNNQDDHFSTVPYADVCNIF 137

Query: 131 QEIEGISSRLAIIKLCSSFLISVMKLDPRNLIPMTYLFINKLGPDYMPXXXXXXXXXXXI 190
           QEIE  SSRL+IIK+CS F   ++K D RNL+P TYLFINKLGPDY P           +
Sbjct: 138 QEIESTSSRLSIIKICSDFFTQIVKEDSRNLVPTTYLFINKLGPDYEPGMELGLGEGLLM 197

Query: 191 KTIAESCGRSLQQIKTKYHEIGDLGQIALEARKVQPTMFKPKPLTVGEVFQNLKSIASSQ 250
           KTI+ESCG+SL Q+K +Y E+GDLGQIA+EAR VQPTMFKPKPLTVGEVF NL++IA++Q
Sbjct: 198 KTISESCGKSLAQVKNRYREMGDLGQIAMEARNVQPTMFKPKPLTVGEVFVNLRNIANAQ 257

Query: 251 GKDSQTKKIKLIKRMLTSCQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLVYEYGES 310
           GKDSQ KKIKLIKRMLT+CQGVEAKFLIRSLESKLRIGLAEKTVLISLS ALL +E G  
Sbjct: 258 GKDSQNKKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSNALLRHEQG-L 316

Query: 311 DKDIDMETVENAEQKIRDAFCQVPNYEVVIDSCLKHGIMNLDQHCSLRPAIPLKPMLAKP 370
           D +   E V+ AEQ IRDAFCQVPNYE+VI++CL+HGI  L +HC L P IPLKPMLAKP
Sbjct: 317 DVEPSDEAVDKAEQSIRDAFCQVPNYEIVINTCLEHGISQLHKHCQLTPGIPLKPMLAKP 376

Query: 371 TKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEIHIRDFV 430
           TK+I+E+ DRFQ Q F  EYKYDGERAQ+HLL DGTMRIYSRNGENMTERYPEI IRDF+
Sbjct: 377 TKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDGTMRIYSRNGENMTERYPEIDIRDFL 436

Query: 431 TDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDVDINEIKVRVCLFAFDILLHND 490
           +D S T+SLILDCEAVAWDKEQ KILPFQVLSTRKRKDVD  ++KVRVCLFAFD+L HN 
Sbjct: 437 SDPS-TESLILDCEAVAWDKEQGKILPFQVLSTRKRKDVDAKDVKVRVCLFAFDLLCHNG 495

Query: 491 EKLINKSLQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLDQSVKNSCEGLMVKML 550
           E LINKSL+ER+D L  +TK V GEF++A ++ T N+EELQ FLDQSVK+SCEGLMVKML
Sbjct: 496 EPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEELQHFLDQSVKDSCEGLMVKML 555

Query: 551 EGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGKRTGNYGGFLLGCYNQD 610
           +G ESHYEPSKRSRNWLKLKKDYL GVGDSLDLCVLGAY+GRGKRTG YGGFLLGCYNQD
Sbjct: 556 DGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQD 615

Query: 611 TGEFETACKIGTGFSDEVLQQLHERLKSTVIDLPKATYVFDPSAEPDVWFEPTLLFEVLT 670
           TGE+ET CKIGTGFS+E+LQQL++RLK T ++ P A YV+D + +PDVWFEPTLLFEVL 
Sbjct: 616 TGEYETCCKIGTGFSEELLQQLYDRLKPTAMEAPAAFYVYDSAQQPDVWFEPTLLFEVLA 675

Query: 671 ADLSLSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQIVEMYENQANL 725
           ADLSLSPVYKAGS+ YDKG+SLRFPRFLR+R+DK VE+ATSSEQ+V++YE QA+L
Sbjct: 676 ADLSLSPVYKAGSAQYDKGISLRFPRFLRIRDDKSVEEATSSEQVVDLYEAQAHL 730

>Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON}
           (195103..197283) [2181 nt, 727 aa]
          Length = 726

 Score =  972 bits (2514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/709 (66%), Positives = 565/709 (79%), Gaps = 14/709 (1%)

Query: 22  KRQMTLNNFFTSVKKSDTNTPASTTPKKMEKDESPQIPATKTAEEKHENMDVDTDPVISS 81
           K+Q TL  FF+S+ K   +  +ST    + KD+        +   K   ++ D  P  S+
Sbjct: 27  KKQATLARFFSSMPKRKIDDDSSTDSTTINKDDD-------SDTSKKIKLNSDETPTTSA 79

Query: 82  SEVSAKRNXXXXXXXXXXXXXKKIKIQDENNDTKEFYSTVPYADLCNLFQEIEGISSRLA 141
             V++K +                K+       K F+STVPYADLC +FQE+E  SSRL+
Sbjct: 80  GSVTSK-DEPSLTSSPQKPIVTPAKVPSNTKPVK-FFSTVPYADLCEVFQEVESTSSRLS 137

Query: 142 IIKLCSSFLISVMKLDPRNLIPMTYLFINKLGPDYMPXXXXXXXXXXXIKTIAESCGRSL 201
           IIK+CS FLI VMK DP+NL+P+TYLFINKLGPDY P           +KTI+ESCG+S+
Sbjct: 138 IIKICSDFLIKVMKQDPQNLVPITYLFINKLGPDYEPGLELGLGEGLLMKTISESCGKSM 197

Query: 202 QQIKTKYHEIGDLGQIALEARKVQPTMFKPKPLTVGEVFQNLKSIASSQGKDSQTKKIKL 261
           QQ+K +Y EIGDLGQIA +AR VQPTMFKPKPLTVGEVFQNLK IA SQGKDSQ +K++L
Sbjct: 198 QQLKNQYREIGDLGQIAQDARNVQPTMFKPKPLTVGEVFQNLKDIAQSQGKDSQQRKMRL 257

Query: 262 IKRMLTSCQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLVYEYGESDKDIDMETVEN 321
           IKRMLT+C+GVEAKFLIRSLESKLRIGLAEKTVLISLSKALL+ EY E+ KD  ME +E 
Sbjct: 258 IKRMLTACKGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLNEY-ETSKDPSMELIET 316

Query: 322 AEQKIRDAFCQVPNYEVVIDSCLKHGIMNLDQHCSLRPAIPLKPMLAKPTKSISEIFDRF 381
           AE+KIRDAFCQVPNYE++I SCL  GIM LD +C LRP IPLKPMLAKPTK+I+E+ D F
Sbjct: 317 AEEKIRDAFCQVPNYEIIIQSCLNDGIMELDNNCKLRPGIPLKPMLAKPTKAINEVLDAF 376

Query: 382 QDQKFTCEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEIHIRDF-VTDLSHTK--- 437
           Q ++FTCEYKYDGER QVHLL +G MRIYSRNGENMTERYPE+HI DF V D S+T    
Sbjct: 377 QGEEFTCEYKYDGERGQVHLLSNGEMRIYSRNGENMTERYPELHIEDFLVKDESNTDKEV 436

Query: 438 SLILDCEAVAWDKEQNKILPFQVLSTRKRKDVDINEIKVRVCLFAFDILLHNDEKLINKS 497
           SLILDCE VAWD EQNKILPFQVLSTRKRK V++ ++KVRVCLFAFDIL +N E LI K+
Sbjct: 437 SLILDCEVVAWDNEQNKILPFQVLSTRKRKGVELKDVKVRVCLFAFDILYYNGEGLITKT 496

Query: 498 LQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLDQSVKNSCEGLMVKMLEGEESHY 557
           L+ERR ILH +TK V GEFQ+AT + T  L+E+Q FLDQ++K+SCEGLMVK+L+GEES Y
Sbjct: 497 LRERRKILHEVTKCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLMVKILDGEESRY 556

Query: 558 EPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGKRTGNYGGFLLGCYNQDTGEFETA 617
           EPSKRSRNWLKLKKDYLAGVGDSLDLCV+GAY+G+GKRTG YGGFLLGCYNQD+GE+ET 
Sbjct: 557 EPSKRSRNWLKLKKDYLAGVGDSLDLCVMGAYYGKGKRTGTYGGFLLGCYNQDSGEYETC 616

Query: 618 CKIGTGFSDEVLQQLHERLKSTVIDLPKATYVFDPSAEPDVWFEPTLLFEVLTADLSLSP 677
           CKIGTGFSDE+L +L+E  +   I++PK+ Y FD SAEPD+WFEP +LFEVLTADLSLSP
Sbjct: 617 CKIGTGFSDEMLTKLYELFREEEIEVPKSFYNFDSSAEPDIWFEPKVLFEVLTADLSLSP 676

Query: 678 VYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQIVEMYENQANLQ 726
           +YKAGS+TYDKG+SLRFPRFLR+R+DK VEDATSS+QI+EMYENQ+++Q
Sbjct: 677 IYKAGSATYDKGISLRFPRFLRIRDDKSVEDATSSDQIIEMYENQSHIQ 725

>SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 693

 Score =  971 bits (2511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/610 (73%), Positives = 530/610 (86%), Gaps = 2/610 (0%)

Query: 118 YSTVPYADLCNLFQEIEGISSRLAIIKLCSSFLISVMKLDPRNLIPMTYLFINKLGPDYM 177
           +S +PY+D+CN+F EIE  SSRL+I+K+CS+F  SV+K +P NL+P+TYLFIN+LGPDY 
Sbjct: 86  HSKIPYSDVCNIFSEIESTSSRLSIVKICSNFFYSVLKQNPSNLVPITYLFINRLGPDYE 145

Query: 178 PXXXXXXXXXXXIKTIAESCGRSLQQIKTKYHEIGDLGQIALEARKVQPTMFKPKPLTVG 237
           P           +KTIAESCG+SLQQ++ KY EIGDLG++A EAR VQPTMFKPKPLTVG
Sbjct: 146 PGLELGLGEGLLMKTIAESCGKSLQQVRAKYREIGDLGEVAQEARAVQPTMFKPKPLTVG 205

Query: 238 EVFQNLKSIASSQGKDSQTKKIKLIKRMLTSCQGVEAKFLIRSLESKLRIGLAEKTVLIS 297
           EVF NLKSIA SQGKDSQT+KI+LIKRMLT+CQGVEAKFLIRSLESKLRIGLAEKTVLIS
Sbjct: 206 EVFNNLKSIAKSQGKDSQTRKIQLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLIS 265

Query: 298 LSKALLVYEYGESDKDIDMETVENAEQKIRDAFCQVPNYEVVIDSCLKHGIMNLDQHCSL 357
           LSKALL YE+    ++   E VENAEQ++RDAFCQVPNYE+VI++CL+HGIM +++HC L
Sbjct: 266 LSKALLSYEH--DGEEPSSELVENAEQRVRDAFCQVPNYEIVINTCLEHGIMEVNKHCVL 323

Query: 358 RPAIPLKPMLAKPTKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDGTMRIYSRNGENM 417
           +P IPLKPMLAKP+KSI+E+ DRF  +KFTCEYKYDGERAQVHLL DG+M IYSRNGENM
Sbjct: 324 KPGIPLKPMLAKPSKSITEVLDRFHGEKFTCEYKYDGERAQVHLLPDGSMNIYSRNGENM 383

Query: 418 TERYPEIHIRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDVDINEIKVR 477
           TERYPE+HIRD++ D   T SLILDCEAVAWD EQ KILPFQ+LSTRKRK V+  ++KVR
Sbjct: 384 TERYPELHIRDYLADPETTHSLILDCEAVAWDTEQGKILPFQILSTRKRKGVEAKDVKVR 443

Query: 478 VCLFAFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLDQS 537
           VCLFAFD+L +N + LIN SL ERR+ L  + K VTG+FQFA E+ ++NLE++Q +L+QS
Sbjct: 444 VCLFAFDMLCYNGQSLINNSLLERREYLQRVLKPVTGQFQFANELNSSNLEDVQKYLEQS 503

Query: 538 VKNSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGKRTG 597
           VK++CEGLMVK+LEGEESHYEPSKRSRNWLKLKKDYL GVGDSLDLCVLGAY+GRGKRTG
Sbjct: 504 VKDACEGLMVKVLEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTG 563

Query: 598 NYGGFLLGCYNQDTGEFETACKIGTGFSDEVLQQLHERLKSTVIDLPKATYVFDPSAEPD 657
            YGGFLLGCYNQDTGEFET CKIGTGFSDE+L  L+E+LK + ++ PKA YV+D SAEPD
Sbjct: 564 TYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLVSLYEKLKPSSLEQPKAFYVYDSSAEPD 623

Query: 658 VWFEPTLLFEVLTADLSLSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQIVE 717
           VWFEPT+LFEVLTADLSLSP+YKAG+S Y KG+SLRFPRF+R+R+DK VEDATSSEQIVE
Sbjct: 624 VWFEPTMLFEVLTADLSLSPIYKAGNSAYGKGISLRFPRFIRIRDDKDVEDATSSEQIVE 683

Query: 718 MYENQANLQQ 727
           +YE+Q NLQ+
Sbjct: 684 LYESQVNLQK 693

>KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 723

 Score =  929 bits (2402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/731 (62%), Positives = 546/731 (74%), Gaps = 46/731 (6%)

Query: 21  MKRQMTLNNFFTSVKKSDTNTPASTTPKKMEKD--------------------ESPQIPA 60
           +K+Q TL  FF+S K+S     +    KK+  D                    ++  +  
Sbjct: 12  IKKQATLAKFFSSKKRSVEEEKSHEPAKKLHSDPIGAGSGSPSSSPPLATGSSDAGSVKV 71

Query: 61  TKTAEEKHENMDVDTDPVISSSEVSAKRNXXXXXXXXXXXXXKKIKIQDENNDTKEFYST 120
             +A    EN    T P +  S+  AKR                  +     D  +  ++
Sbjct: 72  ETSATSTGENTKAGT-PTLPDSDEPAKR-----------------AVAATKGDPAKLGAS 113

Query: 121 VP------YADLCNLFQEIEGISSRLAIIKLCSSFLISVMKLDPRNLIPMTYLFINKLGP 174
            P      YA++CN+F EIEG SSRL I+KLC  FL SV+    ++++P+TYL INKLGP
Sbjct: 114 APKDSKILYAEMCNVFNEIEGTSSRLQIVKLCGDFLYSVLLKARKDIVPITYLLINKLGP 173

Query: 175 DYMPXXXXXXXXXXXIKTIAESCGRSLQQIKTKYHEIGDLGQIALEARKVQPTMFKPKPL 234
           DY P           +KTI+ESCG+SLQQIK +Y E+GDLG+IA EAR VQPTMFKPKPL
Sbjct: 174 DYQPGLELGLGEGLLMKTISESCGKSLQQIKARYRELGDLGRIAQEARAVQPTMFKPKPL 233

Query: 235 TVGEVFQNLKSIASSQGKDSQTKKIKLIKRMLTSCQGVEAKFLIRSLESKLRIGLAEKTV 294
           T GEVF NL++IA SQGKDSQ +K++LIKRMLT+CQG+EAKFLIRSLESKLRIGLAEK+V
Sbjct: 234 TTGEVFSNLQAIARSQGKDSQLRKVQLIKRMLTACQGLEAKFLIRSLESKLRIGLAEKSV 293

Query: 295 LISLSKALLVYEYGESDKDIDMETVENAEQKIRDAFCQVPNYEVVIDSCLKHGIMNLDQH 354
           L++LSKALL YE+  + K+   E V+ AEQKIRDAFCQVPNY++VI++ L+HGIM LD+H
Sbjct: 294 LVALSKALLTYEH--NGKEPSSELVDTAEQKIRDAFCQVPNYQIVIETALEHGIMELDKH 351

Query: 355 CSLRPAIPLKPMLAKPTKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDGTMRIYSRNG 414
           C L P IPLKPMLAKP+KSISE+ DRFQ Q+FTCEYKYDGERAQVHLL DG+MRIYSRNG
Sbjct: 352 CVLTPGIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNG 411

Query: 415 ENMTERYPEIHIRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDVDINEI 474
           ENMTERYPEI I DF+ D + T +LILDCEAVAWDKE+N ILPFQVLSTRKRK V + ++
Sbjct: 412 ENMTERYPEIRISDFIADPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVEDV 471

Query: 475 KVRVCLFAFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFL 534
           KVRVCLFAFDIL +NDE LI + L ERR  L      V GE Q A+E+TT +L+ELQ +L
Sbjct: 472 KVRVCLFAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQHYL 531

Query: 535 DQSVKNSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGK 594
           DQ+V++ CEGLMVK+LEGEESHYEPSKRSRNWLKLKKDYL GVGDSLDLCVLGAY+GRGK
Sbjct: 532 DQAVRDCCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGK 591

Query: 595 RTGNYGGFLLGCYNQDTGEFETACKIGTGFSDEVLQQLHERLKSTVIDLPKATYVFDPSA 654
           RTG YGGFLLGCYNQD+GE+ET CKIGTGFS+E+LQ L +RL  T I  PKA YV   SA
Sbjct: 592 RTGTYGGFLLGCYNQDSGEYETCCKIGTGFSEEMLQTLFDRLSPTAIPTPKAFYVHSESA 651

Query: 655 EPDVWFEPTLLFEVLTADLSLSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQ 714
            PDVWFEPTLLFEVLTADLSLSPVYKAG+S+Y KG+SLRFPRF+RLR+DK  E+ATSSEQ
Sbjct: 652 PPDVWFEPTLLFEVLTADLSLSPVYKAGTSSYGKGISLRFPRFIRLRDDKTPEEATSSEQ 711

Query: 715 IVEMYENQANL 725
           +VE YE+Q+++
Sbjct: 712 VVEFYESQSHV 722

>Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL164C
           (CDC9) - DNA ligase [contig 161] FULL
          Length = 715

 Score =  928 bits (2398), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/713 (64%), Positives = 549/713 (76%), Gaps = 20/713 (2%)

Query: 22  KRQMTLNNFFTSVKKS-DTNTPASTTPKKME------KDESPQIPATKTAEEKHENMDVD 74
           K+Q TL  FF+S K+S D       + KK +      K ES +       E  HE +   
Sbjct: 13  KKQATLAKFFSSKKRSNDEKEGPQESAKKSQLNAIDAKPESSKGSQPNVDETNHETLQ-- 70

Query: 75  TDPVISSSEVSAK--RNXXXXXXXXXXXXXKKIKIQDENNDTKEFYSTVPYADLCNLFQE 132
             P +S++E   +   N              KI I    +      S V Y+++C++F E
Sbjct: 71  -KPQLSAAEPKTEFAMNPAKLAVEKSHGDVAKIGISAPKD------SNVMYSEMCSVFNE 123

Query: 133 IEGISSRLAIIKLCSSFLISVMKLDPRNLIPMTYLFINKLGPDYMPXXXXXXXXXXXIKT 192
           IEG SSRL I+KLCS FL SV+    ++L+P+TYL INKLGPDY P           +KT
Sbjct: 124 IEGTSSRLQIVKLCSDFLYSVLTKTRKDLVPITYLLINKLGPDYQPGLELGLGEGLLMKT 183

Query: 193 IAESCGRSLQQIKTKYHEIGDLGQIALEARKVQPTMFKPKPLTVGEVFQNLKSIASSQGK 252
           I+ESCG+SLQQ+K +Y E+GDLG+IA EAR VQPTMFKPKPLT G VF NL+ IA +QGK
Sbjct: 184 ISESCGKSLQQVKARYRELGDLGRIAQEARSVQPTMFKPKPLTTGMVFANLQDIARAQGK 243

Query: 253 DSQTKKIKLIKRMLTSCQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLVYEYGESDK 312
           DSQ +K++LIK+MLT+C+GVEAKFLIRSLESKLRIGLAEK+VL++LSKA+L +E+G  + 
Sbjct: 244 DSQLRKVQLIKKMLTACEGVEAKFLIRSLESKLRIGLAEKSVLVALSKAILTHEHGGKEP 303

Query: 313 DIDMETVENAEQKIRDAFCQVPNYEVVIDSCLKHGIMNLDQHCSLRPAIPLKPMLAKPTK 372
             D+  V+ AEQKIRDAFCQVPNYE+VI++ L+HGIM L++HC L P IPLKPMLAKP+K
Sbjct: 304 SSDL--VDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHCVLTPGIPLKPMLAKPSK 361

Query: 373 SISEIFDRFQDQKFTCEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEIHIRDFVTD 432
           SISE+ DRFQ Q+FTCEYKYDGERAQVHLL DG+MRIYSRNGENMTERYPEI+I DFV  
Sbjct: 362 SISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYPEINISDFVAH 421

Query: 433 LSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDVDINEIKVRVCLFAFDILLHNDEK 492
              T +LILDCEAVAWDK++N ILPFQVLSTRKRK V   ++KVRVCLFAFDIL +NDE 
Sbjct: 422 PDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDVKVRVCLFAFDILCYNDEP 481

Query: 493 LINKSLQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLDQSVKNSCEGLMVKMLEG 552
           LINKSL ERR  L  I K V GE Q A+E+TT +L+E+Q +LDQSVK+ CEGLMVK+L+G
Sbjct: 482 LINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEMQLYLDQSVKDCCEGLMVKVLDG 541

Query: 553 EESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGKRTGNYGGFLLGCYNQDTG 612
           EESHYEPSKRSRNWLKLKKDYL GVGDSLDLCVLGAY+GRGKRTG YGGFLLGCYNQDTG
Sbjct: 542 EESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTG 601

Query: 613 EFETACKIGTGFSDEVLQQLHERLKSTVIDLPKATYVFDPSAEPDVWFEPTLLFEVLTAD 672
           EFET CKIGTGFSDE+LQ L+E+L  T I  PKA YV+  SA+PDVW EP++LFEVLTAD
Sbjct: 602 EFETCCKIGTGFSDEMLQNLYEKLSPTEIPEPKAFYVYSESAQPDVWLEPSMLFEVLTAD 661

Query: 673 LSLSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQIVEMYENQANL 725
           LSLSPVYKAG S+Y KG+SLRFPRF+R+R+DK VEDATSSEQ++E YE+Q+++
Sbjct: 662 LSLSPVYKAGGSSYGKGISLRFPRFIRIRDDKSVEDATSSEQVIEFYESQSHI 714

>KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]
           {ON} similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination,
          Length = 700

 Score =  898 bits (2320), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/611 (69%), Positives = 503/611 (82%), Gaps = 2/611 (0%)

Query: 116 EFYSTVPYADLCNLFQEIEGISSRLAIIKLCSSFLISVMKLDPRNLIPMTYLFINKLGPD 175
           +F+S +P+A+LC+ FQ IE  SSRLAI  +CS FL SV++ DP +L+P+TYLFI+KLGPD
Sbjct: 92  KFHSNIPFAELCDTFQAIEVTSSRLAITAICSKFLYSVLERDPESLVPITYLFIHKLGPD 151

Query: 176 YMPXXXXXXXXXXXIKTIAESCGRSLQQIKTKYHEIGDLGQIALEARKVQPTMFKPKPLT 235
           Y P           IKTI+E+CG+S+QQI+ KY EIGDLG+IA++AR VQPTMFKPKPLT
Sbjct: 152 YEPGLELGLGESLLIKTISEACGKSIQQIRNKYREIGDLGEIAMQARNVQPTMFKPKPLT 211

Query: 236 VGEVFQNLKSIASSQGKDSQTKKIKLIKRMLTSCQGVEAKFLIRSLESKLRIGLAEKTVL 295
           VGEVF NL SIA S GKDSQ++K  LIK+MLT+C+G EAKFLIRSLESKLRIGLAEKTVL
Sbjct: 212 VGEVFNNLVSIAKSNGKDSQSRKGSLIKKMLTACKGYEAKFLIRSLESKLRIGLAEKTVL 271

Query: 296 ISLSKALLVYEYGESDKDIDMETVENAEQKIRDAFCQVPNYEVVIDSCLKHGIMNLDQHC 355
           IS+SKA+L +E+   +   +M  VE AE  IRDAFCQVPNYE++I+  L++GIMNL+QH 
Sbjct: 272 ISVSKAILTHEHNGQEPSTEM--VEQAESLIRDAFCQVPNYEMIINVALQYGIMNLNQHI 329

Query: 356 SLRPAIPLKPMLAKPTKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDGTMRIYSRNGE 415
            LRP IPL+PMLAKPTKSISE+ DRFQ  KFTCEYKYDGERAQVHL  DG+M+IYSRNGE
Sbjct: 330 KLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDGSMKIYSRNGE 389

Query: 416 NMTERYPEIHIRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDVDINEIK 475
           +MTERYPEI ++ +V DL  TKS I+D EAVAWD+EQ KILPFQVLSTRKRK V++ ++K
Sbjct: 390 DMTERYPEIDVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKRKGVELKDVK 449

Query: 476 VRVCLFAFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLD 535
           VRVCL+AFDIL  NDE LINKS  ERR IL        G+F FA E+TTTN +ELQ +LD
Sbjct: 450 VRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELTTTNFDELQKYLD 509

Query: 536 QSVKNSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGKR 595
           QSVK+SCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYL GVGDSLDL VLGAY+GRGKR
Sbjct: 510 QSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDLVVLGAYYGRGKR 569

Query: 596 TGNYGGFLLGCYNQDTGEFETACKIGTGFSDEVLQQLHERLKSTVIDLPKATYVFDPSAE 655
           TG YGGFLLGCYN D+ EFET CKIGTGFSDE+LQ L+ +LK T ++ P    ++D SA 
Sbjct: 570 TGTYGGFLLGCYNLDSEEFETCCKIGTGFSDEMLQDLYTKLKDTTVEHPSTNVIYDSSAP 629

Query: 656 PDVWFEPTLLFEVLTADLSLSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQI 715
            DVWFEP++LFEVLTADLSLSPVYKAG   + KG+SLRFPRF+R+R+DK V DATSS+Q+
Sbjct: 630 ADVWFEPSMLFEVLTADLSLSPVYKAGFEAFGKGISLRFPRFVRIRDDKNVTDATSSDQV 689

Query: 716 VEMYENQANLQ 726
           +E YE+QA+++
Sbjct: 690 IEFYESQAHMK 700

>ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL164C (CDC9)
          Length = 697

 Score =  882 bits (2280), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/712 (61%), Positives = 532/712 (74%), Gaps = 31/712 (4%)

Query: 22  KRQMTLNNFFTSVKK-SDTNTPASTTPK-KMEKDESPQIPAT--KTAEEKHENMDVDTDP 77
           K+Q TL  FFT++K+  D  T A+T  K K+E  E    PA   + AE K+   ++   P
Sbjct: 5   KKQATLGRFFTALKRPQDGATAAATVKKSKVEAAECLAAPAGHEQDAEVKNSLPELADKP 64

Query: 78  ----VISSSEVSAKRNXXXXXXXXXXXXXKKIKIQDENNDTKEFYST-VPYADLCNLFQE 132
               V+  +  +  R                     +++  K   ST V YADLC +F+ 
Sbjct: 65  APGGVLPQAASAVPRA--------------------QSSPVKPAASTSVMYADLCAVFEA 104

Query: 133 IEGISSRLAIIKLCSSFLISVMKLDPRNLIPMTYLFINKLGPDYMPXXXXXXXXXXXIKT 192
           +E  SSRL+I KLC+ F+ SV+K DP +LIP+TYLFIN+LGPDY P           IKT
Sbjct: 105 VEATSSRLSITKLCADFMYSVLKCDPGHLIPVTYLFINRLGPDYEPGLELGLGEGILIKT 164

Query: 193 IAESCGRSLQQIKTKYHEIGDLGQIALEARKVQPTMFKPKPLTVGEVFQNLKSIASSQGK 252
           I+++CG+S  Q+++ Y E GDLG +A +AR VQPTMFKPKPLTV +VF  L++IA ++GK
Sbjct: 165 ISDACGKSAAQVRSSYRECGDLGTVAQQARVVQPTMFKPKPLTVRDVFSTLQAIAQAEGK 224

Query: 253 DSQTKKIKLIKRMLTSCQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLVYEYGESDK 312
           DSQ KKI+LIK+MLT+CQG+EAK+LIRSLESKLRIGLAEKTVL++LSKA+L +E+    K
Sbjct: 225 DSQGKKIRLIKKMLTACQGMEAKYLIRSLESKLRIGLAEKTVLVALSKAILTHEH--DGK 282

Query: 313 DIDMETVENAEQKIRDAFCQVPNYEVVIDSCLKHGIMNLDQHCSLRPAIPLKPMLAKPTK 372
           +   E V+ AE  +RD FCQVPNYE++I++ L++GIMNL QHC L P IPLKPMLAKPTK
Sbjct: 283 EPSPEQVDAAEALVRDTFCQVPNYEMIINAALQYGIMNLPQHCVLTPGIPLKPMLAKPTK 342

Query: 373 SISEIFDRFQDQKFTCEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEIHIRDFVTD 432
           SI+E+ DRFQ Q+FTCEYKYDGERAQVHL+EDGT+RIYSRN ENMTERYPEI    F+ +
Sbjct: 343 SITEVLDRFQGQRFTCEYKYDGERAQVHLMEDGTIRIYSRNSENMTERYPEIQFHQFLAN 402

Query: 433 LSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDVDINEIKVRVCLFAFDILLHNDEK 492
              T+SLI+DCEAVAWD E+ KILPFQVLSTRKRK V++ ++KVRVCLFAFD+L  N E 
Sbjct: 403 PQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVELKDVKVRVCLFAFDLLYLNGES 462

Query: 493 LINKSLQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLDQSVKNSCEGLMVKMLEG 552
           L+  SL +RR  L+S+ K V GE QFA E+TT  L ELQ++L+QSV  SCEGLMVKML+G
Sbjct: 463 LLKCSLADRRKHLYSVLKVVPGELQFANEITTMELSELQTYLEQSVSASCEGLMVKMLDG 522

Query: 553 EESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGKRTGNYGGFLLGCYNQDTG 612
           EES YEPSKRSRNWLKLKKDYL GVGDSLDL VLGAY+GRGKRTG YGGFLLGCYN D  
Sbjct: 523 EESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVLGAYYGRGKRTGTYGGFLLGCYNPDLE 582

Query: 613 EFETACKIGTGFSDEVLQQLHERLKSTVIDLPKATYVFDPSAEPDVWFEPTLLFEVLTAD 672
           EFET CKIGTGFS+EVLQ LH +LK TVI  P+    +D S+ PDVWFEP +LFEVLTAD
Sbjct: 583 EFETCCKIGTGFSEEVLQSLHAQLKDTVIAAPRGDVSYDDSSPPDVWFEPAMLFEVLTAD 642

Query: 673 LSLSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQIVEMYENQAN 724
           LSLSPVYKAG   Y KG+SLRFPRFLR+REDK V DATSS+QIVE Y+ QAN
Sbjct: 643 LSLSPVYKAGRDVYGKGISLRFPRFLRIREDKSVTDATSSDQIVEFYQRQAN 694

>TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.343
           YDL164C
          Length = 736

 Score =  873 bits (2256), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/729 (60%), Positives = 548/729 (75%), Gaps = 62/729 (8%)

Query: 22  KRQMTLNNFFTSVKKSDTNTPASTTPKKME---KDESPQIPATKTAEEKHENMDVDTDPV 78
           K+Q TL  FFTS+ K         TP  +E   K ESP+        +K   ++V     
Sbjct: 45  KKQATLARFFTSMGKK--------TPPAVEVATKQESPE-----NHVDKKRKVEVHPSQS 91

Query: 79  ISSSEVSAKRNXXXXXXXXXXXXXKKIKIQDENNDTKEFYSTVPYADLCNLFQEIEGISS 138
           + +SE                      K +   + TK   STV Y+++CNLFQ+IE  SS
Sbjct: 92  VGASE----------------------KAESPPDQTK---STVLYSEVCNLFQQIEETSS 126

Query: 139 RLAIIKLCSSFLISVMKLDPRNLIPMTYLFINKLGPDYMPXXXXXXXXXXXIKTIAESCG 198
           RLAIIKLCS F I V+K +P ++I + YLFIN+LGPDY P           IKTI+E+ G
Sbjct: 127 RLAIIKLCSEFFIRVIKNNPSDIIIVAYLFINRLGPDYEPGLELGLGENLLIKTISEAYG 186

Query: 199 RSLQQIKTKYHEIGDLGQIALEARKVQPTMFKPKPLTVGEVFQNLKSIASSQGKDSQTKK 258
           +S++QIK +  E GDLG IA +AR +QPTMFKPKPLT+ +VF NLK IAS+ GKDSQ +K
Sbjct: 187 KSIKQIKLELKETGDLGTIARDARNIQPTMFKPKPLTISDVFNNLKKIASATGKDSQLRK 246

Query: 259 IKLIKRMLTSCQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLVYEY----GES---D 311
           IKLIK+ML++ +G+EAKFLIRSLESKLRIGLAEKTVLISLSKALL++E+    GES   +
Sbjct: 247 IKLIKQMLSASKGLEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHEHWKEKGESKFDE 306

Query: 312 KDID-METVENAEQKIRDAFCQVPNYEVVIDSCLKHGIMNLDQHCSLRPAIPLKPMLAKP 370
           +D++ M+ +E AE K+R+A CQVPNYE+VI+ CL+ GI+N+D+ C+LRP IPLKPMLAKP
Sbjct: 307 EDVESMDLIEQAEAKLREAHCQVPNYEIVINLCLQDGILNIDKTCTLRPGIPLKPMLAKP 366

Query: 371 TKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEIHIRDFV 430
           TK+I+E+ + FQ ++F  EYKYDGERAQVHLLE G MRIYSRNGENMTERYPE+ ++DF+
Sbjct: 367 TKAITEVLNAFQGKEFISEYKYDGERAQVHLLEGGEMRIYSRNGENMTERYPELDVKDFL 426

Query: 431 -------------TDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDVDINEIKVR 477
                          +   K +ILDCE VAWD EQ KILPFQVL+TRKRK+VD+ ++KVR
Sbjct: 427 CVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILPFQVLTTRKRKNVDLKDVKVR 486

Query: 478 VCLFAFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLDQS 537
           VCLFAFD+L  N+E +INKSL+ER++IL  +T  V GEFQ+AT + T++++ELQ+FLDQ+
Sbjct: 487 VCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGEFQYATSLITSDMDELQTFLDQA 546

Query: 538 VKNSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGKRTG 597
           VKNSCEGLMVKML+GEESHYEPSKRSRNWLKLKKDYL GVGDSLDL V+GAYFG+GKRTG
Sbjct: 547 VKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDGVGDSLDLVVMGAYFGKGKRTG 606

Query: 598 NYGGFLLGCYNQDTGEFETACKIGTGFSDEVLQQLHERLKSTVIDLPKATYVFDPSAEPD 657
           +YGGFLLGCYN+DT EFET CKIGTGFSDE+L  LH  L+ T ID P  TY++D SAEPD
Sbjct: 607 SYGGFLLGCYNEDTQEFETCCKIGTGFSDEMLGNLHTLLQPTEIDNPPMTYIYDSSAEPD 666

Query: 658 VWFEPTLLFEVLTADLSLSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQIVE 717
           VWF+  +LFEVLTADLSLSPVYKAG+S YDKG+SLRFPRFLR+REDK V D T+SE I+E
Sbjct: 667 VWFQAKVLFEVLTADLSLSPVYKAGNSRYDKGISLRFPRFLRIREDKDVTDGTTSEDIIE 726

Query: 718 MYENQANLQ 726
            YE+Q+++Q
Sbjct: 727 FYESQSHIQ 735

>TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.343
           YDL164C
          Length = 720

 Score =  868 bits (2244), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/615 (66%), Positives = 501/615 (81%), Gaps = 5/615 (0%)

Query: 114 TKEFYSTVPYADLCNLFQEIEGISSRLAIIKLCSSFLISVMKLDPRNLIPMTYLFINKLG 173
           +K   S++PYADLC LF+ IE  SSRL I  LC++F    ++LDP  L+P+TYL INKLG
Sbjct: 108 SKPATSSLPYADLCQLFETIESESSRLTITNLCTAFFSRTLQLDPSLLVPVTYLCINKLG 167

Query: 174 PDYMPXXXXXXXXXXXIKTIAESCGRSLQQIKTKYHEIGDLGQIALEARKVQPT--MFKP 231
           PDY             +K I  +CG S QQ+K +Y ++GDLGQ+A+  R +QPT  MFK 
Sbjct: 168 PDY-SGVELGLGEGLLLKAIGSACGVSQQQLKLQYRKLGDLGQLAMSTRVLQPTITMFKL 226

Query: 232 KPLTVGEVFQNLKSIASSQGKDSQTKKIKLIKRMLTSCQGVEAKFLIRSLESKLRIGLAE 291
           +PLT+ +VF  L  IA+SQGKDSQ +KI +IKR+LTSCQGVEAKFLIRSLESKLRIGLAE
Sbjct: 227 EPLTITKVFDTLAKIAASQGKDSQNQKINMIKRLLTSCQGVEAKFLIRSLESKLRIGLAE 286

Query: 292 KTVLISLSKALLVYEYGESDKDIDMETVENAEQKIRDAFCQVPNYEVVIDSCLKHGIMNL 351
           KTVL SL++AL+++E G  + +I  +   NAEQ I+D+FCQ+PNYE++I + L++G+  L
Sbjct: 287 KTVLTSLARALVIHEKG--NDNIQDDDYSNAEQIIKDSFCQIPNYEIIITTSLQYGVSQL 344

Query: 352 DQHCSLRPAIPLKPMLAKPTKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDGTMRIYS 411
             H  L P IPLKPMLAKPTKSISE+ D FQ+ +FT EYKYDGERAQVHLL DG+MRIYS
Sbjct: 345 ASHIKLTPGIPLKPMLAKPTKSISEVLDTFQNIQFTSEYKYDGERAQVHLLPDGSMRIYS 404

Query: 412 RNGENMTERYPEIHIRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDVDI 471
           RNGE+MT+RYPE++I+D++ D + T  LILDCEAVAWD E  KILPFQVLSTRKRK VD+
Sbjct: 405 RNGEDMTQRYPELNIQDYLVDSTTTTQLILDCEAVAWDVELQKILPFQVLSTRKRKSVDL 464

Query: 472 NEIKVRVCLFAFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTTNLEELQ 531
            +IKVRVCLFAFDIL HN++ LIN +L+ERRDILHSITK   G+FQFATE+TT+NL+ELQ
Sbjct: 465 KDIKVRVCLFAFDILRHNNDSLINNTLRERRDILHSITKPCPGQFQFATELTTSNLDELQ 524

Query: 532 SFLDQSVKNSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFG 591
           +FLD+++K+SCEGLMVK L+G +SHYEPSKRSRNWLKLKKDYL G+GDSLDLCVLGAY+G
Sbjct: 525 TFLDKAIKDSCEGLMVKSLDGTDSHYEPSKRSRNWLKLKKDYLQGMGDSLDLCVLGAYYG 584

Query: 592 RGKRTGNYGGFLLGCYNQDTGEFETACKIGTGFSDEVLQQLHERLKSTVIDLPKATYVFD 651
           RGKRTG YGGFLL CYNQDT EFET CKIGTGFSDE+LQ L+  LK T I+ P+A +VFD
Sbjct: 585 RGKRTGTYGGFLLACYNQDTEEFETCCKIGTGFSDEMLQTLYNGLKETAIESPRANFVFD 644

Query: 652 PSAEPDVWFEPTLLFEVLTADLSLSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATS 711
            SAEPDVWF PT++FEVLTADLSLSP+YKAGS+ Y KG+SLRFPRF+R+R DK V DATS
Sbjct: 645 SSAEPDVWFNPTMVFEVLTADLSLSPIYKAGSTVYGKGISLRFPRFIRIRTDKSVNDATS 704

Query: 712 SEQIVEMYENQANLQ 726
           SEQ+++ YENQ++LQ
Sbjct: 705 SEQVIDFYENQSHLQ 719

>TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON}
           Anc_6.18 YOR005C
          Length = 966

 Score =  104 bits (260), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 104/427 (24%), Positives = 181/427 (42%), Gaps = 75/427 (17%)

Query: 363 LKPMLAKPTKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDG-TMRIYSRNGENMTERY 421
            +P LAK      E+  R  + KFT E K DGER Q+H ++ G  ++ +SR G + T  Y
Sbjct: 264 FEPQLAKKVNLSYEVLSRRMNNKFTIEEKMDGERIQIHYMDYGHQIKYFSRRGNDYTYLY 323

Query: 422 PE----IHIRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDVDINEIKVR 477
            +      I  ++      K  ILD E V++DK +N ILPF ++ +     + I+ ++  
Sbjct: 324 GKDKSTATISKYLQLNEDVKECILDGEMVSYDKSRNCILPFGMVKSGAANSLKIDGLEND 383

Query: 478 VC---LFAFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFL 534
           +C      FD+L  N   L N  L +R++ L +I        +        + E ++S L
Sbjct: 384 LCSPLFIVFDVLFLNGSPLTNLPLYQRKEYLSNILTPKKSHIEILKFSIAHDSESIRSAL 443

Query: 535 DQSVKNSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGK 594
             ++    EG+++K     +S Y    R+ +W+K+K +YL   G++LDL V+G     GK
Sbjct: 444 QAAISVGSEGIVLKKY---DSLYSVGDRNNDWIKVKPEYLEQFGENLDLIVIGR--DPGK 498

Query: 595 RTGNYGGFLLGCYNQDTGE----------------------------------FETACKI 620
           +     G  +   N+++ E                                  F + C I
Sbjct: 499 KDSLMCGVAV-LENEESYEKILQEEVITLTSDDDDSQNNIPEDKPIRTKRITKFISFCVI 557

Query: 621 GTGFSDEVLQQLHER----LKSTVIDLPKATYVFDPSAEPDVWFEP--TLLFEV----LT 670
             G S+E  +++  +     K    + P   Y+   +  P  W  P  +++ EV    L 
Sbjct: 558 ANGISNEEFKEIDRKTFGCWKKFSDEAPPTDYLEFGTRLPVEWINPHDSVVLEVKARSLE 617

Query: 671 ADLSLSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQIV----------EMYE 720
            + +L   +K G + Y  G   R     R+R DK   D  +   +V          E+Y 
Sbjct: 618 NNEALRDKFKTGYTLY--GAYCR-----RIRTDKDFNDCYTFSDLVIATNKKRSSSELYG 670

Query: 721 NQANLQQ 727
           N +++++
Sbjct: 671 NHSHIKK 677

>KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005C DNL4 DNA ligase required for nonhomologous end-
           joining (NHEJ) forms stable heterodimer with required
           cofactor Lif1p catalyzes DNA ligation as part of a
           complex with Lif1p and Nej1p involved in meiosis not
           essential for vegetative growth
          Length = 907

 Score =  100 bits (248), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 96/381 (25%), Positives = 169/381 (44%), Gaps = 39/381 (10%)

Query: 363 LKPMLAKPTK-SISEIFDRFQDQKFTCEYKYDGERAQVHLLEDG-TMRIYSRNGENMTER 420
            +P LAK T  S   +  + Q   F  E K DGER Q+H +  G  ++  SR G + +  
Sbjct: 247 FEPQLAKRTHLSYERVASKLQ-HDFIIEEKMDGERLQIHYINYGEQIKYLSRRGVDFSYL 305

Query: 421 YPEIH----IRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDVDINEIKV 476
           Y E      I   +    + K  ILD E + +D E++ +LPF ++     K   +N+I+ 
Sbjct: 306 YGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLV-----KSSAMNQIQS 360

Query: 477 RVC-----------LFAFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTT 525
            +              AFD++  N + L N +L+ R+D L  I   V    +    M   
Sbjct: 361 ELAGIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAI 420

Query: 526 NLEELQSFLDQSVKNSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCV 585
           N E ++  L+Q++    EG+++K L    S Y    R+ +W+K+K +YL   G+++DL +
Sbjct: 421 NAEAIKDSLEQAISMGSEGIVLKHL---HSKYFVGSRNTDWIKIKPEYLEQFGENMDLLI 477

Query: 586 LGAYFGRGKRTGNYGGFLLGCYNQ--DTGEFETACKIGTGFSDEVLQQLHERL--KSTVI 641
           +G    +GK+   + G  +   N+  +   F + C I  G S+E  + +  +   K  + 
Sbjct: 478 IGR--EQGKKDSFFCGLSISDPNEVAEKPRFISFCTIANGLSNEEFKDIERKTWGKWHIF 535

Query: 642 --DLPKATYVFDPSAEPDVWFEP--TLLFEVLTADLSLSPVYKAGSSTYDKGVSLRFPRF 697
             D P    +   +  P  W  P  +++ EV    +      ++    Y  G +L F   
Sbjct: 536 SEDPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTK---ESEKRKYRSGCTLHFGYC 592

Query: 698 LRLREDKGVEDATSSEQIVEM 718
            ++R DK  +   S  +  +M
Sbjct: 593 KQIRYDKDWKTVASFSEFEDM 613

>ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR005C (DNL4)
          Length = 981

 Score =  100 bits (248), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 98/404 (24%), Positives = 163/404 (40%), Gaps = 64/404 (15%)

Query: 356 SLRPAIPLKPMLAKPTKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDG-TMRIYSRNG 414
           S+R      P +A+  K   E         F  E K DG+R QVH ++ G ++  +SRNG
Sbjct: 287 SVRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNG 346

Query: 415 ENMTERYPEIHIRDFVTD----LSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDVD 470
            N T  Y E   +  +++    +   K  ILD E V++DKE   ILPF +  +     V+
Sbjct: 347 INYTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVN 406

Query: 471 I-----NEIKVRVCLFAFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTT 525
                  E   R     FD+L  N + L N+ + +R++ L  I           +    +
Sbjct: 407 FETTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCS 466

Query: 526 NLEELQSFLDQSVKNSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCV 585
           + E + + L  +V +  EG+++K      S Y   KR  +W+K+K +YL   G+++DL V
Sbjct: 467 DAEAITAALGAAVAHGSEGIVLKK---ARSKYSVGKRDDSWIKIKPEYLENFGENMDLVV 523

Query: 586 LGAYFGRGKRTGNYGGFLLGCYNQDTGE----------------------------FETA 617
           +      G+  G    F+      D  E                            F + 
Sbjct: 524 I------GRDKGRKDSFICALAVTDDSEKNNPSSYESGSDSDSDSEPIIVQPKIEKFISF 577

Query: 618 CKIGTGFSDEVLQQLHERLKSTVIDL----PKATYVFDPSAEPDVWFEP--TLLFEVLTA 671
           C I  G S+E  +++    +          P   +V   +  P  W +P  +++ EV   
Sbjct: 578 CSIANGISNEEFKEIDRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKAR 637

Query: 672 DL----SLSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATS 711
            +    S S +YK GS+ Y+           R+R DK    A++
Sbjct: 638 SIDNEESKSDLYKTGSTLYNAYCK-------RIRHDKNWSTAST 674

>Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {ON}
           YOR005C (REAL)
          Length = 945

 Score = 99.4 bits (246), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 101/412 (24%), Positives = 169/412 (41%), Gaps = 59/412 (14%)

Query: 356 SLRPAIPLKPMLAKPTKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDG-TMRIYSRNG 414
           +++      P LAK      E   R     F  E K DGER QVH +  G ++R YSR G
Sbjct: 247 TIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFYSRRG 306

Query: 415 ENMTERYPEI-------HIRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRK 467
            + T  Y          H  DF  ++   +  +LD E V +D  +  ILPF ++    + 
Sbjct: 307 IDYTYLYGASLSSGTISHHLDFTDNV---RECVLDGEMVTFDARRKVILPFGLVKGSAKD 363

Query: 468 DVD---INEIKVRVCLFAFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTT 524
            +    IN +        FD+L  N   L    L +R++ L SI   V    +       
Sbjct: 364 ALSFNSINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSRC 423

Query: 525 TNLEELQSFLDQSVKNSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLC 584
            N+E ++  L+ ++    EG+++K      S Y  + R+ NW+K+K +YL   G++LDL 
Sbjct: 424 YNVESIKKSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEYLEEFGENLDLV 480

Query: 585 VLGAYFGRGKRTGNYGGFLL---------------GCYNQDTGE-----------FETAC 618
           ++G     GK+     G LL               G  N    E             + C
Sbjct: 481 IIGR--DPGKKDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKNENILYSQKKVKKILSFC 538

Query: 619 KIGTGFSDEVLQQLHERL-----KSTVIDLPKATYVFDPSAEPDVWFEP--TLLFEVLTA 671
            +  G S E  +++  +      K++ +  P + + F  S  P  W EP  +++ E+ + 
Sbjct: 539 SVANGISQEEFKEIDRKTRGCWKKTSEVAPPASIFEFG-SKIPAEWIEPNESIVLEIKSR 597

Query: 672 DLSLSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQIVEMYENQA 723
            L  +   +     Y    +L      R+R DK   D T    + E+Y++++
Sbjct: 598 SLDNT---ETNMQKYATSCTLYGGYCKRIRFDK---DWTDCFTLNELYDSRS 643

>ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 944

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 107/416 (25%), Positives = 174/416 (41%), Gaps = 48/416 (11%)

Query: 327 RDAFCQVPNYEVVIDSCL--KHGIMNLDQHCSLRPAIPLKPMLAKPTK-SISEIFDRFQD 383
           RD    V + + V D      H + N D   +L   +P  P LAK    S  ++  R + 
Sbjct: 220 RDYLSVVSDLKTVADKLWDPSHRLKNDDLGVNL--GLPFAPFLAKRLYISYDKVALRLKS 277

Query: 384 QKFTCEYKYDGERAQVHLLEDG-TMRIYSRNGENMTERYPE----IHIRDFVTDLSHTKS 438
             F  E K DGER Q+H ++ G  ++ +SR G + T  Y E      +  ++      + 
Sbjct: 278 D-FYIEEKMDGERIQLHYMDYGRKLKWFSRRGNDYTYLYGEDIGTGTVAKYLQLDPKVRE 336

Query: 439 LILDCEAVAWDKEQNKILPFQVLSTRKRKDVDINEI---KVRVCLFAFDILLHNDEKLIN 495
            +LD E +++D E+N +LPF ++ +  R  +    I     R      D L  N   LIN
Sbjct: 337 CVLDGEMISFDTEENSVLPFGLVKSSARDSLTAEGILTQGYRPLYMVIDFLYLNGVSLIN 396

Query: 496 KSLQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLDQSVKNSCEGLMVKMLEGEES 555
             L  R+  L +I        +    M   +   ++S L++++    EG+++K  +   S
Sbjct: 397 VPLNTRKQYLSAILNPCPHAVEIIQSMHCYDDTSIKSSLEKAIMMGSEGIILKHFK---S 453

Query: 556 HYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGKRTGNYGGFLLG---------- 605
            YE   R+ NW+K+K +YL   G++LDL V+G   G+          L G          
Sbjct: 454 KYEIGARTDNWIKIKPEYLEQFGENLDLLVIGRDPGKKDSLMCGLAVLEGDEEPGAQSDK 513

Query: 606 -CYNQDTGE----------FETACKIGTGFSDEVLQQLHE----RLKSTVIDLPKATYVF 650
              N D+ E          F + C I  G S E  +Q+      + K+T    P     F
Sbjct: 514 QVVNLDSEEEEEPRKAVKKFISFCTIANGISQEEFKQIERKTAGKWKNTEDHKPPKILEF 573

Query: 651 DPSAEPDVWFEP--TLLFEVLTADLSLSPVYKAGSSTYDKGVSLRFPRFLRLREDK 704
             S  P+ W  P  +++ EV    L  +   ++    +  G +L      R+REDK
Sbjct: 574 G-SKLPEEWIYPEDSVVLEVKARSLDNT---ESSGRKFKVGCTLHGGYCRRIREDK 625

>Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {ON}
           YOR005C (REAL)
          Length = 947

 Score = 96.3 bits (238), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 100/418 (23%), Positives = 170/418 (40%), Gaps = 72/418 (17%)

Query: 356 SLRPAIPLKPMLAKPTKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDG-TMRIYSRNG 414
           S++      P LAK      E   R     F  E K DGER QVH +  G +++ +SR G
Sbjct: 247 SIKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFSRRG 306

Query: 415 ENMTERY----PEIHIRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDV- 469
            + T  Y        I  ++   +  K  +LD E V +D  +  ILPF ++    +  + 
Sbjct: 307 IDYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAKGVLS 366

Query: 470 --DINEIKVRVCLFAFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTTNL 527
             DIN    R     FD+L  N+  L    L +R+  L SI        +        ++
Sbjct: 367 CSDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTRCYDV 426

Query: 528 EELQSFLDQSVKNSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLG 587
           + +++ L+ ++    EG+++K      S Y  + R+ NW+K+K +YL   G++LDL ++ 
Sbjct: 427 QSVKNSLEVAISLGSEGVVLKYYN---SSYNIASRNYNWIKVKPEYLEEFGENLDLIII- 482

Query: 588 AYFGRGKRTGNYGGFLLGCYNQDTGEFE-------------------------------- 615
                G+ +G    F+LG    D  E E                                
Sbjct: 483 -----GRDSGKKDSFMLGLLVIDEREMEERDQELSSSEVVNDSKIEQDVINSKKKVKKVL 537

Query: 616 TACKIGTGFSDEVLQQLHERLKSTVIDLPKATYVFDP-------SAEPDVWFEP--TLLF 666
           + C +  G S E  ++++ R +       K T  F P       S  P  W EP  +++ 
Sbjct: 538 SFCSVANGISHEEFKEINRRTRGHW----KRTSDFSPPSILQFGSRIPAEWIEPSDSIVL 593

Query: 667 EVLTADL--SLSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQIVEMYENQ 722
           E+ +  L  + + + +  +S    G   R     R+R DK   D T    + ++YE++
Sbjct: 594 EIKSRSLDNTETSIRRYATSCTLYGGYCR-----RIRYDK---DWTDCYTLAQLYEDR 643

>YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON}
           DNL4DNA ligase required for nonhomologous end-joining
           (NHEJ), forms stable heterodimer with required cofactor
           Lif1p, interacts with Nej1p; involved in meiosis, not
           essential for vegetative growth
          Length = 944

 Score = 95.9 bits (237), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 79/294 (26%), Positives = 128/294 (43%), Gaps = 25/294 (8%)

Query: 352 DQHCSLRPAIPLKPMLAKPTKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDG-TMRIY 410
           D   S++      P LAK      E   R     F  E K DGER QVH +  G +++ +
Sbjct: 243 DDDLSIKVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFF 302

Query: 411 SRNGENMTERYPEI--------HIRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLS 462
           SR G + T  Y           H+R   TD    K  +LD E V +D ++  ILPF ++ 
Sbjct: 303 SRRGIDYTYLYGASLSSGTISQHLR--FTD--SVKECVLDGEMVTFDAKRRVILPFGLVK 358

Query: 463 TRKRKDVD---INEIKVRVCLFAFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFA 519
              ++ +    IN +        FD+L  N   L    L +R+  L+SI   +    +  
Sbjct: 359 GSAKEALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIV 418

Query: 520 TEMTTTNLEELQSFLDQSVKNSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGD 579
                  +E ++  L+ ++    EG+++K      S Y  + R+ NW+K+K +YL   G+
Sbjct: 419 RSSRCYGVESIKKSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEYLEEFGE 475

Query: 580 SLDLCVLGAYFGRGKRTGNYGGFLLGCYNQDTGEFETACKIGTGFSDEVLQQLH 633
           +LDL V+      G+ +G    F+LG    D  E++      +   D   Q+ H
Sbjct: 476 NLDLIVI------GRDSGKKDSFMLGLLVLDEEEYKKHQGDSSEIVDHSSQEKH 523

>Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {ON}
           YOR005C (DNL4) - ATP dependent DNA ligase [contig 185]
           FULL
          Length = 963

 Score = 95.1 bits (235), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 90/352 (25%), Positives = 157/352 (44%), Gaps = 46/352 (13%)

Query: 384 QKFTCEYKYDGERAQVHLLEDGT-MRIYSRNGENMTERYPEIHIRDFVTDLSHTKSLILD 442
           Q F  E K DGER Q+H +E G  +R  SR G + T  Y +      ++     K+ + D
Sbjct: 300 QDFIIEEKMDGERIQLHYIERGAKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQD 359

Query: 443 C----EAVAWDKEQNKILPFQVLSTRKRKDVDINEIKV-----RVCLFAFDILLHNDEKL 493
           C    E V++DKE+N +LPF ++ +   +++  ++ KV     R     FD++  N   L
Sbjct: 360 CVLDGEMVSFDKEKNVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSL 419

Query: 494 INKSLQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLDQSVKNSCEGLMVKMLEGE 553
               L  R+  L SI   V    +  +++  +    ++  L+++++   EG+++K     
Sbjct: 420 TRLPLHLRKSYLRSILSPVANIVEILSDVRASEPNAIKVSLERAIEMGSEGIILKQFS-- 477

Query: 554 ESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGKRTGNYGGFLLG-------- 605
            S YE   R+ +W+K+K +Y   +G+++DL V+G     GK+     G +L         
Sbjct: 478 -SPYEIGARNDSWIKIKPEYFEELGETMDLVVIGR--DPGKKDSLMCGLILADETDGSSV 534

Query: 606 -CYNQD--------TGEFETACKIGTGFSDEVLQQLHERLK-----STVIDLPKATYVFD 651
              +QD          +  + C I  G SD   +++  + +     +T    P     F 
Sbjct: 535 NLASQDDPLRPKQRNPKVISFCNIANGVSDAEFKEIERKTRGLWNLTTACPPPSGLLEFG 594

Query: 652 PSAEPDVWFEP--TLLFEV----LTADLSLSPVYKAGSSTYDKGVSLRFPRF 697
            +  P  W +P  +L+ EV    +  D   S  YK GS+   +G   R  RF
Sbjct: 595 -TKLPTEWIDPRSSLVLEVKARSVDTDELSSKKYKTGSTL--RGAYCRALRF 643

>TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {ON}
           Anc_6.18 YOR005C
          Length = 972

 Score = 94.7 bits (234), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 67/245 (27%), Positives = 116/245 (47%), Gaps = 11/245 (4%)

Query: 356 SLRPAIPLKPMLAKPTKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDG-TMRIYSRNG 414
           S++      P LAK      +      +  F  E K DGER Q+H +  G T++ +SR+G
Sbjct: 268 SIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVKFFSRHG 327

Query: 415 ENMTERYPEIH----IRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDV- 469
            + T  Y        I  F+    + K  +LD E V +D    K+LPF ++ +     + 
Sbjct: 328 TDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSASSQLN 387

Query: 470 --DINEIKVRVCLFAFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTTNL 527
             DI+          FDIL  N   LI+  L +R++ L+++        +  + +  T+ 
Sbjct: 388 KKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSIRCTDS 447

Query: 528 EELQSFLDQSVKNSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLG 587
            +++  LD ++    EG+++K      S Y P+ R  NW+K+K +YL   G+++DL V+G
Sbjct: 448 IQIKKGLDAAISVGSEGIVLKQYI---SKYIPNARHNNWIKVKPEYLEEFGENMDLIVIG 504

Query: 588 AYFGR 592
              G+
Sbjct: 505 RDSGK 509

>KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 951

 Score = 94.4 bits (233), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 86/360 (23%), Positives = 159/360 (44%), Gaps = 39/360 (10%)

Query: 386 FTCEYKYDGERAQVHLLEDGT-MRIYSRNGENMTERYPEIHIRDFVTDLSHTKSLILDC- 443
           F  E K DGER Q+H +  G+ ++  SR G + +  Y +   R  ++     KS + DC 
Sbjct: 288 FILEEKMDGERIQLHYVNGGSVLKFLSRRGIDFSHLYGQEVARGVISQYLKLKSDVRDCV 347

Query: 444 ---EAVAWDKEQNKILPFQVLSTRKRKDVDINEIK-----VRVCLFAFDILLHNDEKLIN 495
              E V++DK++  ILPF ++ +    ++  +E+       R     FD++  N   L  
Sbjct: 348 LDGEMVSYDKKRKIILPFGIVKSAAVDELINSEVGNENDGYRPLYMVFDLVYLNGVSLTK 407

Query: 496 KSLQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLDQSVKNSCEGLMVKMLEGEES 555
             L  R++ L  I   V    +    +   + + +++F+ ++++   EG++VK      S
Sbjct: 408 VPLHIRKEYLKEILSPVPDVVEILKGIRACDAKAIKNFMQRAIEMGSEGVIVKQ---ASS 464

Query: 556 HYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGKRTGNYGGFLLGCYN---QDTG 612
            YE   R+ +W+K+K +Y   +G+++DL V+G     GK+     G L+       ++ G
Sbjct: 465 TYEVGARNDHWVKIKPEYFEDLGETMDLVVIGR--DPGKKDSLMCGLLVSDSEHILENFG 522

Query: 613 EFETA------------CKIGTGFSDEVLQQLHERLKSTVIDL----PKATYVFDPSAEP 656
             E              C +  G SDE  ++++ + + + +      P  + +   S  P
Sbjct: 523 PIEHGKEGDPIIKCVSFCNVANGVSDEEFKEINRKTRGSWVSYKEKPPPLSLLEFGSKIP 582

Query: 657 DVWFEP--TLLFEVLTADLSLSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQ 714
             W +P  +++ EV    +  S   +  S  Y  G +L      R+R DK     TS  Q
Sbjct: 583 VEWIDPKNSVVIEVKARSVENS---EYSSKRYRAGSTLHSAYCRRIRNDKDWTTCTSVAQ 639

>TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.18
           YOR005C
          Length = 969

 Score = 94.0 bits (232), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 93/403 (23%), Positives = 174/403 (43%), Gaps = 57/403 (14%)

Query: 365 PMLAKP-TKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDGT-MRIYSRNGENMTERYP 422
           P LAK  T S  +I  +  +  F  E K DGER QVH ++ G  +R  SR G + T+ Y 
Sbjct: 273 PQLAKKMTISYEKICTKLNND-FLIEEKMDGERIQVHYMDYGAKIRFLSRRGVDYTQLYG 331

Query: 423 EI----HIRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDVDINEI---K 475
           E      + +++   S+ +  +LD E + +D ++N +LPF ++ +  R+ +    I    
Sbjct: 332 ENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALSTEGICSQG 391

Query: 476 VRVCLFAFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLD 535
            R  L   D++  N   LI   L +R++ L+ + K      +    +  +    ++  L+
Sbjct: 392 HRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEHTAIRKSLE 451

Query: 536 QSVKNSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGKR 595
           +S+    EG+++K     ++ YE   R+  W+K+K +YL   G++LDL ++G     GK+
Sbjct: 452 KSISMGSEGIVLK---SYKARYEIGARNDYWIKVKPEYLEQFGENLDLVIIGR--TPGKK 506

Query: 596 TGNYGGFLLGCYNQDTGEFE------------------------------TACKIGTGFS 625
                G  +    +D  E E                              + C I  G S
Sbjct: 507 DSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFISFCVIANGIS 566

Query: 626 DEVLQQLHERLKSTVID----LPKATYVFDPSAEPDVWFEP--TLLFEVLTADLSLSPVY 679
            +  +++  + +   +     LP A  +   S  P+ W +P  +++ EV    L  +   
Sbjct: 567 QQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKARSLDNT--- 623

Query: 680 KAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQIVEMYENQ 722
           ++    +  G +L      R+R+DK   D T      E+++ +
Sbjct: 624 ESSKKKFAAGCTLHGGYCRRIRDDK---DWTGCYSFSELWQER 663

>KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.18
           YOR005C
          Length = 954

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 70/268 (26%), Positives = 121/268 (45%), Gaps = 11/268 (4%)

Query: 328 DAFCQVPNYEVVIDSCLKHGIMNLDQHCSLRPAIPLKPMLAKPTKSISEIFDRFQDQKFT 387
           D F  V +   V     +  +   ++  +L+      P LAK      E   +     F+
Sbjct: 220 DYFSVVSDLSSVTKKLYEPSVRLRNEDLTLKIGSAFAPHLAKRLNISYEKILKKLGSDFS 279

Query: 388 CEYKYDGERAQVHLLEDGT-MRIYSRNGENMTERY----PEIHIRDFVTDLSHTKSLILD 442
            E K DGER Q+H ++ G  ++  SR G + T  Y        I  ++    + K  ILD
Sbjct: 280 IEEKMDGERIQIHYMDYGNEIKFLSRRGTDYTYLYGGDTSTGTIACYLKLNENVKECILD 339

Query: 443 CEAVAWDKEQNKILPFQVLSTRKRKDVD---INEIKVRVCLFAFDILLHNDEKLINKSLQ 499
            E V +D+E+  ILPF ++ +  +  +    I+         AFD++  N   L++  L 
Sbjct: 340 GEMVTYDQEKQMILPFGLVKSSAKNFLSKESISNGSYHPLFMAFDLVYLNGTSLVDLPLY 399

Query: 500 ERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLDQSVKNSCEGLMVKMLEGEESHYEP 559
           +R+D L  I  +  G     +     NLE +   L  ++    EG+++K L    S Y  
Sbjct: 400 QRKDYLSKILTKCNGFVDIVSFARCNNLESITKSLAAAISVGSEGIILKKL---NSRYMV 456

Query: 560 SKRSRNWLKLKKDYLAGVGDSLDLCVLG 587
           + R+ +W+K+K  YL   G+++DL ++G
Sbjct: 457 ASRNDSWIKIKPQYLKQFGENMDLIIIG 484

>NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.18
           YOR005C
          Length = 950

 Score = 90.5 bits (223), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 70/240 (29%), Positives = 112/240 (46%), Gaps = 13/240 (5%)

Query: 357 LRPAIPLKPMLAKPTKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDG-TMRIYSRNGE 415
           + P     P LAK      E         F  E K DGER Q+H  + G  ++ +SR G 
Sbjct: 256 INPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFSRRGT 315

Query: 416 NMTERYPE-IH---IRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKR----K 467
           + T  Y E IH   I   +      K  ILD E + +DK QN ILPF ++ +  R    K
Sbjct: 316 DYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSARSMLTK 375

Query: 468 DVDINEIKVRVCLFAFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTTNL 527
           D  +NE   +     FD++  N   L N  L  R++ L+ I        +  +     N 
Sbjct: 376 DGIMNE-GYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYHRFNE 434

Query: 528 EELQSFLDQSVKNSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLG 587
           + ++  L+ ++    EG+++K  +   S Y  + R+ +W+K+K +YL   G+++DL V+G
Sbjct: 435 DSIRKSLELAISMGSEGIVLKRYD---SRYTVASRNDDWIKVKPEYLEQFGENMDLIVIG 491

>Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {ON}
           YOR005C (REAL)
          Length = 948

 Score = 90.1 bits (222), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 99/413 (23%), Positives = 167/413 (40%), Gaps = 62/413 (15%)

Query: 356 SLRPAIPLKPMLAKPTKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDG-TMRIYSRNG 414
           S++      P LAK      E         F  E K DGER QVH +  G +++ +SR G
Sbjct: 247 SIKVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFFSRRG 306

Query: 415 ENMTERYP----EIHIRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDV- 469
            + T  Y        I  ++      K  +LD E V +D  +  ILPF ++    ++ + 
Sbjct: 307 IDYTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAKEALS 366

Query: 470 --DINEIKVRVCLFAFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTTNL 527
             DIN          FD+L  N   L    L +R++ L SI        +        + 
Sbjct: 367 FNDINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSRCYDA 426

Query: 528 EELQSFLDQSVKNSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLG 587
           E ++  L+ ++    EG+++K      S Y  + R+ NW+K+K +YL   G++LDL ++ 
Sbjct: 427 ESVKKSLEVAISLGSEGVVLKHYS---SSYNVASRNNNWIKVKPEYLEEFGENLDLIII- 482

Query: 588 AYFGRGKRTGNYGGFLLGCY---NQDTGEFE----------------------------T 616
                G+ +G    F+LG      Q+TG+ +                            +
Sbjct: 483 -----GRDSGKKDSFMLGLLVVDEQETGKTDQEGPSEILNDSSTERRATNPKKRVRKVLS 537

Query: 617 ACKIGTGFSDEVLQQLHERL-----KSTVIDLPKATYVFDPSAEPDVWFEP--TLLFEVL 669
            C I  G S E  +++  +      K++ +  P +   F  S  P  W EP  +++ E+ 
Sbjct: 538 FCSIANGISQEEFKEIDRKTRGHWKKTSGLSPPPSILEFG-SKLPAEWIEPSESIVLEIK 596

Query: 670 TADLSLSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQIVEMYENQ 722
           +  L  +   +     Y    +L      R+R DK   D T    + E+YEN+
Sbjct: 597 SRSLDNT---ETNMQKYATNCTLYGGYCRRIRYDK---DWTECYTLDELYENR 643

>CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005c DNL4 DNA ligase IV
          Length = 946

 Score = 88.2 bits (217), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 83/354 (23%), Positives = 153/354 (43%), Gaps = 48/354 (13%)

Query: 386 FTCEYKYDGERAQVHLLEDGT-MRIYSRNGENMTERYPEI----HIRDFVTDLSHTKSLI 440
           F  E K DGER Q+H    G+ ++ YSR   + T  Y        + +F+    + K  +
Sbjct: 292 FFIEEKMDGERIQMHYTNFGSDIKFYSRRATDYTYLYGNNLKTGTLANFINLNKNVKDCV 351

Query: 441 LDCEAVAWDKEQNKILPFQVLSTRKRKDVDINEIKVR---VCLFAFDILLHNDEKLINKS 497
           LDCE V +D     +LPF ++ +  +  +  + I  +     L  FD+L  N   L++  
Sbjct: 352 LDCEVVTFDSNNKIVLPFGMVKSSAKNMLSQDGIDTQGFHPLLMVFDVLYLNGATLVDLP 411

Query: 498 LQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLDQSVKNSCEGLMVKMLEGEESHY 557
             +RR+ L  I        +    +   + + ++  L++++    EG+++K  +   S Y
Sbjct: 412 YYKRREYLKQILTPTAHRIEIIKSIRANDEQMIKKSLEKALSVGSEGIILKRYD---SRY 468

Query: 558 EPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGKRTGNYGGFLLGC----------- 606
             + RS +W+K+K +YL   G+++DL ++      G+        +LG            
Sbjct: 469 VIASRSDDWIKIKPEYLEQFGENMDLVLM------GRDPSKKDSLMLGLLDYEEVIQDSP 522

Query: 607 --YNQDTGE--------FETACKIGTGFSDEVLQQLHERLKSTVID---LPKATYVFDPS 653
              N  + E        F + C I  G S+E  +++  + K    D   +P   Y+   S
Sbjct: 523 IMVNSQSSEENSQRFRGFVSLCIIANGISNEEYKEIDRKTKGLWNDSEKIPPLEYMKFGS 582

Query: 654 AEPDVWFEP--TLLFEVLTADLSLSPVYKAGSSTYDKGVSLRFPRFLR-LREDK 704
             P  W +P  +L+ E+    L  +   ++    +  G +L F  + R +REDK
Sbjct: 583 KVPRQWIDPKKSLILEIKARSLDNT---RSSERKFAAGCTL-FGGYCRQIREDK 632

>KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6.18
           YOR005C
          Length = 948

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 65/241 (26%), Positives = 114/241 (47%), Gaps = 13/241 (5%)

Query: 356 SLRPAIPLKPMLAKP-TKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDGT-MRIYSRN 413
           S+       P LAK  + S  +I  + ++  F  E K DGER Q+H ++ G  ++  SR 
Sbjct: 247 SINIGYAFAPHLAKKLSISYDKICKKLKND-FFIEEKMDGERIQIHYMDYGNDIKFLSRR 305

Query: 414 GENMTERYPEI----HIRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDV 469
           G + T  Y E      I  ++      K  +LD E V +D++Q+ +LPF ++ +     +
Sbjct: 306 GVDYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMNAL 365

Query: 470 DINEIK---VRVCLFAFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTTN 526
              EI        L  FD++  N   L+   L +R+D L S+ +      Q       +N
Sbjct: 366 TKEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRCSN 425

Query: 527 LEELQSFLDQSVKNSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVL 586
              ++  L+ ++    EG+++K      S Y    R+ +W+K+K +YL   G+++DL V+
Sbjct: 426 ENIIRKSLEHAISVGSEGIVLK---NYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVI 482

Query: 587 G 587
           G
Sbjct: 483 G 483

>Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON}
           complement(12295..15192) [2898 nt, 966 aa]
          Length = 965

 Score = 80.9 bits (198), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 65/247 (26%), Positives = 119/247 (48%), Gaps = 14/247 (5%)

Query: 371 TKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDGT-MRIYSRNGENMTERYPEIH---- 425
           T S   I  R ++  F  E K DGER Q+H +  G  ++  SR G + +  Y +      
Sbjct: 285 TYSYDTIARRLKND-FFIEEKMDGERIQLHYMNYGAKLKFLSRRGLDYSYLYGDNRNNGA 343

Query: 426 IRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDVDINEIK---VRVCLFA 482
           I  ++      K  ILD E V +D  +N ILPF ++ +   + + +++I+         A
Sbjct: 344 IGRYLNFHKDVKECILDGEMVTYDSVKNCILPFGLVKSSAMQSLSVSDIEPDGYHPLYMA 403

Query: 483 FDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLDQSVKNSC 542
           FD++  N   L    L +R++ L  +        +    +   +   ++S L+++++   
Sbjct: 404 FDLVYLNGSSLSTLPLHQRKNYLDKLLIPCPDFVEILPALHCNDSSLIKSSLEKAIELGS 463

Query: 543 EGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGKRTGNYGGF 602
           EG+++K  +   S Y  +KRS +W+K+K +YL   G+++DL V+G     GK+     G 
Sbjct: 464 EGIILKRFD---SQYLVAKRSDDWIKIKPEYLEQFGENMDLIVIGR--DPGKKDSLMCGL 518

Query: 603 LLGCYNQ 609
           +L   N+
Sbjct: 519 ILTGDNE 525

>NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {ON}
           Anc_6.18 YOR005C
          Length = 967

 Score = 80.5 bits (197), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 58/210 (27%), Positives = 101/210 (48%), Gaps = 11/210 (5%)

Query: 386 FTCEYKYDGERAQVHLLEDGT-MRIYSRNGENMTERYPEIHIRDFVTDLSH----TKSLI 440
           F  E K DGER Q+H  + G  +   SR G + T  Y E      V+   H     ++ +
Sbjct: 293 FFIEEKMDGERIQLHYQDYGNKLSFLSRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCV 352

Query: 441 LDCEAVAWDKEQNKILPFQVLSTRKRKDV---DINEIKVRVCLFAFDILLHNDEKLINKS 497
           LD E V +DKE+N +LPF ++ +  R  +    +     R  L  FD++  N   L+N  
Sbjct: 353 LDGEMVTFDKERNALLPFGLVKSSARSIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIP 412

Query: 498 LQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLDQSVKNSCEGLMVKMLEGEESHY 557
           L +R+  L  I        +       ++   +++ L+ ++    EG+++K      S Y
Sbjct: 413 LYQRKLYLEKIFTPERHIVELLRSKRCSDERSIKNALEHAISIGSEGVVLKHYN---SRY 469

Query: 558 EPSKRSRNWLKLKKDYLAGVGDSLDLCVLG 587
             + R+ +W+K+K +YL   G+++DL V+G
Sbjct: 470 TVASRNDDWIKVKPEYLEQFGENMDLIVIG 499

>KLTH0D17930g Chr4 (1486259..1488217) [1959 bp, 652 aa] {ON} similar
           to uniprot|P47164 Saccharomyces cerevisiae YJR130C STR2
           Cystathionine gamma-synthase converts cysteine into
           cystathionine
          Length = 652

 Score = 32.0 bits (71), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 27/45 (60%), Gaps = 5/45 (11%)

Query: 533 FLDQSVKNSCEGLMVKMLEGEES-----HYEPSKRSRNWLKLKKD 572
           F+ +S+KN CE L  K  + +E+      Y+ +KR R ++K+K D
Sbjct: 50  FIHKSIKNLCESLKAKFAKEDETCLVFPSYQVAKRCREFVKVKGD 94

>Kpol_269.9 s269 (16643..18466) [1824 bp, 607 aa] {ON}
           (16643..18466) [1824 nt, 608 aa]
          Length = 607

 Score = 31.6 bits (70), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 25/50 (50%)

Query: 675 LSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQIVEMYENQAN 724
           ++  Y    S Y  G+S  F R + L E +G++     ++ +E YE  AN
Sbjct: 338 IAAKYNHSDSCYRAGISYEFSRGITLDESEGIDKEYMIKKAIEYYEKGAN 387

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 74,625,177
Number of extensions: 3281955
Number of successful extensions: 12153
Number of sequences better than 10.0: 70
Number of HSP's gapped: 12520
Number of HSP's successfully gapped: 70
Length of query: 727
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 610
Effective length of database: 40,065,477
Effective search space: 24439940970
Effective search space used: 24439940970
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)