Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0C032605.524ON153097847150.0
SAKL0G04862g5.524ON24444834391e-42
ADR200C5.524ON23384824363e-42
Suva_2.5975.524ON17974354193e-40
YDR420W (HKR1)5.524ON18024174141e-39
Ecym_40605.524ON22014504103e-39
Smik_4.6955.524ON15554654068e-39
KAFR0E033205.524ON11904303961e-37
TDEL0A038805.524ON16964243942e-37
ZYRO0D12496g5.524ON23854793863e-36
KLTH0G03696g5.524ON20854843772e-35
KLLA0A01826g5.524ON14644483744e-35
Skud_4.6945.524ON15042653584e-33
CAGL0F03003g5.524ON11853533574e-33
Kwal_47.186505.524ON21594603532e-32
Kpol_363.145.524ON7612472874e-25
TPHA0L003605.524ON11614342625e-22
TDEL0D030104.150ON11232232536e-21
Kwal_47.177034.150ON15683332233e-17
KLTH0E08844g4.150ON15203262171e-16
YGR014W (MSB2)4.150ON13062222162e-16
TBLA0G009505.524ON22534762054e-15
Skud_7.2994.150ON11692241963e-14
ZYRO0G11242g4.150ON1487921954e-14
SAKL0H23188g4.150ON1262891857e-13
AGR019C4.150ON11052311803e-12
NCAS0A052304.150ON7851111793e-12
KLLA0C17985g4.150ON9081201784e-12
KNAG0D035904.150ON994781776e-12
Ecym_73494.150ON11291001722e-11
NDAI0K025804.150ON9851051722e-11
TBLA0G012104.150ON1825811723e-11
TPHA0K013904.150ON8261011686e-11
Suva_7.2964.150ON1135721679e-11
Smik_7.3024.150ON1189751661e-10
KAFR0F034704.150ON9491041571e-09
Kpol_1062.374.150ON973841562e-09
CAGL0F08833g4.150ON936751347e-07
Kwal_55.213935.443ON123356811.3
TBLA0A047207.86ON126246773.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0C03260
         (1530 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0C03260 Chr3 complement(639021..643613) [4593 bp, 1530 aa] {...  1820   0.0  
SAKL0G04862g Chr7 (392107..399441) [7335 bp, 2444 aa] {ON} some ...   173   1e-42
ADR200C Chr4 complement(1051878..1058894) [7017 bp, 2338 aa] {ON...   172   3e-42
Suva_2.597 Chr2 (1058501..1059391,1059470..1059725,1059765..1059...   166   3e-40
YDR420W Chr4 (1306267..1311675) [5409 bp, 1802 aa] {ON}  HKR1Muc...   164   1e-39
Ecym_4060 Chr4 (125127..131732) [6606 bp, 2201 aa] {ON} similar ...   162   3e-39
Smik_4.695 Chr4 (1227757..1232424) [4668 bp, 1555 aa] {ON} YDR42...   160   8e-39
KAFR0E03320 Chr5 complement(659303..662875) [3573 bp, 1190 aa] {...   157   1e-37
TDEL0A03880 Chr1 (690387..695477) [5091 bp, 1696 aa] {ON} Anc_5....   156   2e-37
ZYRO0D12496g Chr4 (1047901..1055058) [7158 bp, 2385 aa] {ON} som...   153   3e-36
KLTH0G03696g Chr7 (286341..292598) [6258 bp, 2085 aa] {ON} some ...   149   2e-35
KLLA0A01826g Chr1 complement(163010..167404) [4395 bp, 1464 aa] ...   148   4e-35
Skud_4.694 Chr4 (1228095..1232609) [4515 bp, 1504 aa] {ON} YDR42...   142   4e-33
CAGL0F03003g Chr6 (289923..293480) [3558 bp, 1185 aa] {ON} some ...   142   4e-33
Kwal_47.18650 s47 complement(913245..919724) [6480 bp, 2159 aa] ...   140   2e-32
Kpol_363.14 s363 (25673..27781,27783..27959) [2286 bp, 761 aa] {...   115   4e-25
TPHA0L00360 Chr12 complement(50396..53881) [3486 bp, 1161 aa] {O...   105   5e-22
TDEL0D03010 Chr4 complement(564735..568106) [3372 bp, 1123 aa] {...   102   6e-21
Kwal_47.17703 s47 (521283..525989) [4707 bp, 1568 aa] {ON} YNR04...    91   3e-17
KLTH0E08844g Chr5 (804120..808682) [4563 bp, 1520 aa] {ON} some ...    88   1e-16
YGR014W Chr7 (516943..520863) [3921 bp, 1306 aa] {ON}  MSB2Mucin...    88   2e-16
TBLA0G00950 Chr7 complement(232502..239263) [6762 bp, 2253 aa] {...    84   4e-15
Skud_7.299 Chr7 (520447..523956) [3510 bp, 1169 aa] {ON} YGR014W...    80   3e-14
ZYRO0G11242g Chr7 (900370..904833) [4464 bp, 1487 aa] {ON} weakl...    80   4e-14
SAKL0H23188g Chr8 (2009677..2013465) [3789 bp, 1262 aa] {ON} som...    76   7e-13
AGR019C Chr7 complement(747644..750961) [3318 bp, 1105 aa] {ON} ...    74   3e-12
NCAS0A05230 Chr1 (1034523..1036880) [2358 bp, 785 aa] {ON} Anc_4...    74   3e-12
KLLA0C17985g Chr3 complement(1596320..1599046) [2727 bp, 908 aa]...    73   4e-12
KNAG0D03590 Chr4 (657513..660497) [2985 bp, 994 aa] {ON} Anc_4.1...    73   6e-12
Ecym_7349 Chr7 complement(722484..725873) [3390 bp, 1129 aa] {ON...    71   2e-11
NDAI0K02580 Chr11 complement(574995..577952) [2958 bp, 985 aa] {...    71   2e-11
TBLA0G01210 Chr7 (321555..327032) [5478 bp, 1825 aa] {ON} Anc_4....    71   3e-11
TPHA0K01390 Chr11 complement(287666..290146) [2481 bp, 826 aa] {...    69   6e-11
Suva_7.296 Chr7 (508904..512311) [3408 bp, 1135 aa] {ON} YGR014W...    69   9e-11
Smik_7.302 Chr7 (508666..512235) [3570 bp, 1189 aa] {ON} YGR014W...    69   1e-10
KAFR0F03470 Chr6 (689705..692554) [2850 bp, 949 aa] {ON} Anc_4.1...    65   1e-09
Kpol_1062.37 s1062 complement(78801..81722) [2922 bp, 973 aa] {O...    65   2e-09
CAGL0F08833g Chr6 (873849..876659) [2811 bp, 936 aa] {ON} weakly...    56   7e-07
Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR12...    36   1.3  
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...    34   3.5  

>KNAG0C03260 Chr3 complement(639021..643613) [4593 bp, 1530 aa] {ON}
            Anc_5.524 YDR420W
          Length = 1530

 Score = 1820 bits (4715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 902/978 (92%), Positives = 902/978 (92%)

Query: 553  ATSQATTQYTDASQVPDTFAVTGSTTRSTLLPASTPRDPDETTDDINPIFSSTEVLPTLI 612
            ATSQATTQYTDASQVPDTFAVTGSTTRSTLLPASTPRDPDETTDDINPIFSSTEVLPTLI
Sbjct: 553  ATSQATTQYTDASQVPDTFAVTGSTTRSTLLPASTPRDPDETTDDINPIFSSTEVLPTLI 612

Query: 613  ASNDEEVXXXXXXXXXXXXXXXXXXXXXXAENSAGQLVSDIDTESYSTLESIAEQLTDWV 672
            ASNDEEV                      AENSAGQLVSDIDTESYSTLESIAEQLTDWV
Sbjct: 613  ASNDEEVRTTTSPTYPITTNTIITTTSRIAENSAGQLVSDIDTESYSTLESIAEQLTDWV 672

Query: 673  EPTVQSTTQSVLNTQTKTGQAVEESTTETQTYDSQHVNEGVSFGATTRTYDEDFKLSVTS 732
            EPTVQSTTQSVLNTQTKTGQAVEESTTETQTYDSQHVNEGVSFGATTRTYDEDFKLSVTS
Sbjct: 673  EPTVQSTTQSVLNTQTKTGQAVEESTTETQTYDSQHVNEGVSFGATTRTYDEDFKLSVTS 732

Query: 733  TATTNTPMSNGDALDKENQSSETYESVSEPNSESVRLNGNAASTLAHIMTDSTATSAPAA 792
            TATTNTPMSNGDALDKENQSSETYESVSEPNSESVRLNGNAASTLAHIMTDSTATSAPAA
Sbjct: 733  TATTNTPMSNGDALDKENQSSETYESVSEPNSESVRLNGNAASTLAHIMTDSTATSAPAA 792

Query: 793  EAKPTSTSTRISGVVSSKTDRVTPTISRTLVSGSKGISNVVPQATLQQXXXXXXXXXXXX 852
            EAKPTSTSTRISGVVSSKTDRVTPTISRTLVSGSKGISNVVPQATLQQ            
Sbjct: 793  EAKPTSTSTRISGVVSSKTDRVTPTISRTLVSGSKGISNVVPQATLQQSSVSVTDTMVSS 852

Query: 853  XXGSVGVVQTPNPLGGSSILNPASPTSGSDSTDTVWLPTNIIIASNADSTHTARAESTAS 912
              GSVGVVQTPNPLGGSSILNPASPTSGSDSTDTVWLPTNIIIASNADSTHTARAESTAS
Sbjct: 853  ITGSVGVVQTPNPLGGSSILNPASPTSGSDSTDTVWLPTNIIIASNADSTHTARAESTAS 912

Query: 913  LPAAIAPAEELQSPPDFELITIGFLSGLNYAFLVGNPLSSAQVFDFLPHVLFFPIEDAAE 972
            LPAAIAPAEELQSPPDFELITIGFLSGLNYAFLVGNPLSSAQVFDFLPHVLFFPIEDAAE
Sbjct: 913  LPAAIAPAEELQSPPDFELITIGFLSGLNYAFLVGNPLSSAQVFDFLPHVLFFPIEDAAE 972

Query: 973  KSKAIQPQSSDITTTLVAPLRKNRKTVTDMTRANVVNQNEATSSSLNLAVSSEATGSNDV 1032
            KSKAIQPQSSDITTTLVAPLRKNRKTVTDMTRANVVNQNEATSSSLNLAVSSEATGSNDV
Sbjct: 973  KSKAIQPQSSDITTTLVAPLRKNRKTVTDMTRANVVNQNEATSSSLNLAVSSEATGSNDV 1032

Query: 1033 ELIFKNIRVKQIIPLVIEGNDYITSVAEVYFPTIYIDSLSALISDPNSTLYSNPKKNFAT 1092
            ELIFKNIRVKQIIPLVIEGNDYITSVAEVYFPTIYIDSLSALISDPNSTLYSNPKKNFAT
Sbjct: 1033 ELIFKNIRVKQIIPLVIEGNDYITSVAEVYFPTIYIDSLSALISDPNSTLYSNPKKNFAT 1092

Query: 1093 LASLIDKAIPLTSLRKNDGQXXXXXXXXXXXXXXXXXGDDAFQNAEEYLRVSGAMDLSNI 1152
            LASLIDKAIPLTSLRKNDGQ                 GDDAFQNAEEYLRVSGAMDLSNI
Sbjct: 1093 LASLIDKAIPLTSLRKNDGQSNTSTDSSSDVNSNESTGDDAFQNAEEYLRVSGAMDLSNI 1152

Query: 1153 KVSKVNHTIRNRIIVFLFTLTTGVFLWISTFLIIFRITNKSRKLKDSNLKKGSLPLYQQN 1212
            KVSKVNHTIRNRIIVFLFTLTTGVFLWISTFLIIFRITNKSRKLKDSNLKKGSLPLYQQN
Sbjct: 1153 KVSKVNHTIRNRIIVFLFTLTTGVFLWISTFLIIFRITNKSRKLKDSNLKKGSLPLYQQN 1212

Query: 1213 PYRENKQFSAESSESYIDIHYTTEKYSDYSASSPPIGENIIVDSAQGIQYKVDNEGNYYY 1272
            PYRENKQFSAESSESYIDIHYTTEKYSDYSASSPPIGENIIVDSAQGIQYKVDNEGNYYY
Sbjct: 1213 PYRENKQFSAESSESYIDIHYTTEKYSDYSASSPPIGENIIVDSAQGIQYKVDNEGNYYY 1272

Query: 1273 NGNHLAEGMPEEDEESARYKQENQSTELQSDSIDHFYGSHPQQSNTDEKSESGRRINRPH 1332
            NGNHLAEGMPEEDEESARYKQENQSTELQSDSIDHFYGSHPQQSNTDEKSESGRRINRPH
Sbjct: 1273 NGNHLAEGMPEEDEESARYKQENQSTELQSDSIDHFYGSHPQQSNTDEKSESGRRINRPH 1332

Query: 1333 SPYLSGAVKDPPFTFNRPSNDRNVTYSDSLGLKYNADATSMDFFPGEGSQMIGINPNLFR 1392
            SPYLSGAVKDPPFTFNRPSNDRNVTYSDSLGLKYNADATSMDFFPGEGSQMIGINPNLFR
Sbjct: 1333 SPYLSGAVKDPPFTFNRPSNDRNVTYSDSLGLKYNADATSMDFFPGEGSQMIGINPNLFR 1392

Query: 1393 SETGSEVKGFNLHSTKDNSLSHISTIMXXXXXXXXXXXXFGTSTLLLKHTLNNLSYLPMN 1452
            SETGSEVKGFNLHSTKDNSLSHISTIM            FGTSTLLLKHTLNNLSYLPMN
Sbjct: 1393 SETGSEVKGFNLHSTKDNSLSHISTIMSSKQANSQNSSAFGTSTLLLKHTLNNLSYLPMN 1452

Query: 1453 ELSFDLDDMVGEVNXXXXXXXXXXXYRVGDIDELDVELYKRLSKIEKFKNAGKSPAVEDR 1512
            ELSFDLDDMVGEVN           YRVGDIDELDVELYKRLSKIEKFKNAGKSPAVEDR
Sbjct: 1453 ELSFDLDDMVGEVNVDDTDDDTVDDYRVGDIDELDVELYKRLSKIEKFKNAGKSPAVEDR 1512

Query: 1513 KKFIKMHLESKYSKTARS 1530
            KKFIKMHLESKYSKTARS
Sbjct: 1513 KKFIKMHLESKYSKTARS 1530

 Score =  352 bits (902), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 176/188 (93%), Positives = 176/188 (93%)

Query: 1   MKSFXXXXXXXXXXXXPISSAKWFHFNRNNQLAASTGTGIVSHNKNIEIESVANGNSQQE 60
           MKSF            PISSAKWFHFNRNNQLAASTGTGIVSHNKNIEIESVANGNSQQE
Sbjct: 1   MKSFILLLLYYTALILPISSAKWFHFNRNNQLAASTGTGIVSHNKNIEIESVANGNSQQE 60

Query: 61  ATTGTLQDTTSTPVLDTDTALPTSKEQPQNQNSDTHTTAEIPTSKTENQDPTDANGPAQT 120
           ATTGTLQDTTSTPVLDTDTALPTSKEQPQNQNSDTHTTAEIPTSKTENQDPTDANGPAQT
Sbjct: 61  ATTGTLQDTTSTPVLDTDTALPTSKEQPQNQNSDTHTTAEIPTSKTENQDPTDANGPAQT 120

Query: 121 SVTQQTSPTDINIQSNTAHGQTTQTVESLWPAHSDTTTINTDTREHTSTNVVPTDPAVQL 180
           SVTQQTSPTDINIQSNTAHGQTTQTVESLWPAHSDTTTINTDTREHTSTNVVPTDPAVQL
Sbjct: 121 SVTQQTSPTDINIQSNTAHGQTTQTVESLWPAHSDTTTINTDTREHTSTNVVPTDPAVQL 180

Query: 181 HTTEATSM 188
           HTTEATSM
Sbjct: 181 HTTEATSM 188

>SAKL0G04862g Chr7 (392107..399441) [7335 bp, 2444 aa] {ON} some
            similarities with uniprot|P41809 Saccharomyces cerevisiae
            YDR420W HKR1 Serine/threonine rich cell surface protein
            that contains an EF hand motif involved in the regulation
            of cell wall beta-1 3 glucan synthesis and bud site
            selection overexpression confers resistance to Hansenula
            mrakii killer toxin HM-1
          Length = 2444

 Score =  173 bits (439), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 144/483 (29%), Positives = 212/483 (43%), Gaps = 72/483 (14%)

Query: 888  WLPTNIIIASNADSTH---TARAESTASLPAAIAPAEELQSPPDFELITIGFLSGLNYAF 944
            WLP ++I+ S   ST    T    +T++LP AI P   +  P    LITIGF   LNY F
Sbjct: 1474 WLPYSLIVESKDTSTQSSTTVDLGATSTLPQAITPPTAVPQPAGHSLITIGFKEALNYPF 1533

Query: 945  LVGNPLSSAQVFDFLPHVLFFPIEDAAEKSKAIQPQSSDITTTLVAPLRKNRKTVTDMTR 1004
            L+ +PLSSAQ+F FLP VL +P    A      + Q  ++ T L   L  +   + D   
Sbjct: 1534 LISHPLSSAQIFSFLPRVLQYPFSSTAGSVPIYRRQDIEVMTLLQRRLTSSAAEI-DTCS 1592

Query: 1005 ANVVNQNEATSSSLNLA-----------------------VSSEATGSNDVELIFKNIRV 1041
             +  N ++    S+ LA                       VS   + S+   + +  I V
Sbjct: 1593 LSFQNYDKIQLVSVKLALLKSTNRTDQENNSLHRRSVNDKVSVMNSTSDSSNIDYSQIVV 1652

Query: 1042 KQIIPLVIEGNDYITSVAEVYFPTIYIDSLSALISDPNSTLYSNPKKNFATLASLIDKAI 1101
            KQIIPLV    +YI SVAEVYFP   ID+L  L+ + NS LY NP+ +   LASLID ++
Sbjct: 1653 KQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSELYKNPENSLKALASLIDPSV 1712

Query: 1102 PLTSLRKNDGQXXXXXXXXXXXXXXXXXGDDAFQNAEEYLRV--------SGAMDLSNIK 1153
            PLT L  +DG                    D+  ++              S    L +  
Sbjct: 1713 PLTGLVDSDGNSVTNEEGGNSGSSGSNSSGDSDPSSGGSGESQGGANGDGSALGSLDDGA 1772

Query: 1154 VSKVNHTIRNRIIVFLFTLTTGVFLWISTFLI----IFRITNKSRKLKDSNLKKGSLP-- 1207
              K++  I  R+I++L   +    LWI  +L     ++ I    ++LK ++    S P  
Sbjct: 1773 YGKMSLAITKRLIIYLLVFSFVTILWIVAWLYFLKRLYGIEVIGKRLKPNDKTWSSSPGA 1832

Query: 1208 LYQQ----------NPY-------RENKQFSAESSESYIDIHYTTEKYSDYSASSPPI-G 1249
             Y            NP+       RE   F     E Y D  Y TE+   Y      + G
Sbjct: 1833 FYNHHYNSHYSDPNNPFYDPERSLREKCSF----DERY-DYDYDTEEQDGYLYDDLVVTG 1887

Query: 1250 ENIIVDSAQGIQYKVDNEGNYYYNGNHLAEGMPEEDEESARYKQENQSTELQSDSIDHFY 1309
            +N +  +++G+ Y +D  GNYYY G    + +  E+E++  +   NQ   LQ  S++H Y
Sbjct: 1888 DNTVYSTSRGLSYFIDENGNYYYAG---MDFIVNENEQANEFVDHNQ---LQ--SMEHIY 1939

Query: 1310 GSH 1312
              H
Sbjct: 1940 EGH 1942

>ADR200C Chr4 complement(1051878..1058894) [7017 bp, 2338 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDR420W
            (HKR1)
          Length = 2338

 Score =  172 bits (436), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 146/482 (30%), Positives = 215/482 (44%), Gaps = 69/482 (14%)

Query: 859  VVQTPNPLGGSSILNPASPTSGSDSTDTVWLPTNIIIAS------NADSTHTARAESTAS 912
            +   P P  GSS    AS +   + TD  WLP  II  S      NA ST      ST  
Sbjct: 1472 IASAPTPAAGSSNAVAAS-SKVFEKTD--WLPATIITESVQQHLPNAAST--TGGVSTTL 1526

Query: 913  LPAAIAPAEELQSPPDFELITIGFLSGLNYAFLVGNPLSSAQVFDFLPHVLFFPIEDAAE 972
            LPAAI P   ++    ++LI+IGFL GLNY F+    LSSAQ+F FLP VL +P E   E
Sbjct: 1527 LPAAIHPQSLVEGSDGYDLISIGFLKGLNYVFVTSFALSSAQIFTFLPPVLTYPFESHTE 1586

Query: 973  KSKAIQPQSSDITTTLVAPLRKNRKTVTDMTRANVVNQNEATSSSLNLAVSSEATGSNDV 1032
            ++  I   +         P+    +   D T  +    ++       +AV  E +   D+
Sbjct: 1587 ETVKIHDPTEKRQLERPPPVSFYSRASRDTTTLSSFTHSQV------IAVQKETSDVPDL 1640

Query: 1033 ELIFKNIRVKQIIPLVIEGNDYITSVAEVYFPTIYIDSLSALISDPNSTLYSNPKKNFAT 1092
                  ++VKQ+ P V E   YI ++A VYFP+  +  L  LI D  S LY+NP  N   
Sbjct: 1641 SF----VKVKQLAPDVSEERGYIATLAHVYFPSKLVPKLQELILDSESPLYNNPDVNLKI 1696

Query: 1093 LASLIDKAIPLTSLRKNDGQXXXXXXXXXXXXXXXXXGDDAFQNAEEYLRVSGAMDLSNI 1152
             ASLID  I +  ++ +                    G D +  +       G++D  N 
Sbjct: 1697 FASLIDPTIKVRIIQHD-------RSNPRPAQGGGTSGSDGYSPSGYANHGDGSLD--NS 1747

Query: 1153 KVSKVNHTIRNRIIVFLFTLTTGVFLWISTFLIIFRITNKSRKLKD-------------- 1198
            K  K+   I  R+++FL  LT GVFLW   FL +FR   +  K+K               
Sbjct: 1748 KSPKITFKITKRLLIFLTVLTFGVFLWRLVFLYLFRRLYRINKVKSKIVLGEKKIPPSLG 1807

Query: 1199 -----------SNLKKGSLPLYQQNPYRENKQFSAESSESYIDIH-YTTEKYSDYSASSP 1246
                       S+LK  +  LY+ +P +++   +  SS S   +H Y T+   D   +  
Sbjct: 1808 LFYSHQFNNRLSDLKPSA--LYEGDPEKQDGTATDGSSGS---VHGYATDD--DIIVT-- 1858

Query: 1247 PIGENIIVDSAQGIQYKVDNEGNYYYNGNHLAEGMPEEDEESARYKQENQSTELQSDSID 1306
              GEN +   +QGI Y +D EGNYYY G        E++ +   ++ E +S  +  +++D
Sbjct: 1859 --GENTVYSLSQGIAYHIDEEGNYYYAGIDPFTDAFEQEADCLYHESEVESVNV--NNLD 1914

Query: 1307 HF 1308
            H 
Sbjct: 1915 HL 1916

>Suva_2.597 Chr2
            (1058501..1059391,1059470..1059725,1059765..1059812,
            1059849..1059854,1059891..1061045,1061361..1064398) [5394
            bp, 1797 aa] {ON} YDR420W (REAL)
          Length = 1797

 Score =  166 bits (419), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 147/435 (33%), Positives = 202/435 (46%), Gaps = 60/435 (13%)

Query: 883  STDTVWLPTNIIIA-SNADSTHTARAES-TASLPAAIAPAEELQSPPDFELITIGFLSGL 940
            S D  WLPT II+  + +D++ T+   S TASLP  IAPA  +  P +  LITIGF +GL
Sbjct: 1200 SNDYAWLPTAIIVEPTKSDTSTTSFNPSITASLPNVIAPAIAVTEPANHTLITIGFTAGL 1259

Query: 941  NYAFLVGNPLSSAQVFDFLPHVLFFPIEDAAEK------------SKAIQPQSSDITTTL 988
            NY FLV NPLSSAQ+F+FLP VL +P  D   +            S  +  QS   TTTL
Sbjct: 1260 NYVFLVQNPLSSAQIFNFLPLVLKYPFSDTTSQQEESSTYEMGSSSFVLSYQSGSSTTTL 1319

Query: 989  ----VAPLRKNRKTVTDMTRANVVNQNEATSSSLNLAVSSEATGSNDVELIFKNIRVKQI 1044
                V+ +   RK      + +V+       S+ NL + S    S         I VKQI
Sbjct: 1320 SPESVSSIPIVRKKKKKGGKNSVM-------STANLDLPSIGNSS---------IVVKQI 1363

Query: 1045 IPLVIEGNDYITSVAEVYFPTIYIDSLSALISDPNSTLYSNPKKNFATLASLIDKAIPLT 1104
            +P++     Y+ +VAEVYFPT  I SL  LI D NSTLY+NP+ +  TLA LID ++PL 
Sbjct: 1364 VPMIDSSRSYVIAVAEVYFPTEAISSLQELILDTNSTLYNNPQTSLQTLAGLIDSSVPLG 1423

Query: 1105 SLRKNDGQXXXXXXXXXXXXXXXXXGDDAFQNA--EEYLRVSGAM-DLSNIKVSKVNHTI 1161
             L                         ++ +N    +Y    GA+ D +N     +   I
Sbjct: 1424 GLTLYGSNNGCSICDSSSSSVSEVSNTNSTKNGGTNKY----GALDDFTNSLTDHMPWRI 1479

Query: 1162 RNRIIVFLFTLTTGVFLWISTFLIIFRITNKSRKLKDSNLKKGSLPLYQQNPYRENKQFS 1221
              R I++L  LT GV LW+   L  FR  N     + SN  + +      N  R  +   
Sbjct: 1480 TKRFIIYLTCLTAGVLLWLLLALFAFRHRNVLLGRRPSNCIEKT-----PNNERGLEGVG 1534

Query: 1222 AESSESYIDIHYTTEK---------YSDYSASSPPIGENIIVDSAQGIQYKVDNEGNYYY 1272
              +S S  D H   EK         YS       P GEN +  +  G+ Y VD +G+ +Y
Sbjct: 1535 VSTSRSSSDNHNYNEKKPNTESESFYSMEDDQYIPTGENTVYSATHGLHYTVDEDGDLFY 1594

Query: 1273 NGNHLAEGMPEEDEE 1287
                  + MP + +E
Sbjct: 1595 R-----KSMPNDIDE 1604

>YDR420W Chr4 (1306267..1311675) [5409 bp, 1802 aa] {ON}  HKR1Mucin
            family member that functions as an osmosensor in the
            Sho1p-mediated HOG pathway with Msb2p; proposed to be a
            negative regulator of filamentous growth; mutant displays
            defects in beta-1,3 glucan synthesis and bud site
            selection
          Length = 1802

 Score =  164 bits (414), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 134/417 (32%), Positives = 193/417 (46%), Gaps = 63/417 (15%)

Query: 888  WLPTNIIIASNADSTHTA--RAESTASLPAAIAPAEELQSPPDFELITIGFLSGLNYAFL 945
            WLPT II+ S+     TA      T SLP AI PA  +  P +  LITIGF + LNY FL
Sbjct: 1210 WLPTAIIVESSETGPTTASFNPSITGSLPNAIEPAVAVSEPINHTLITIGFTAALNYVFL 1269

Query: 946  VGNPLSSAQVFDFLPHVLFFPIEDAA--------EKSKAIQPQSSDITTTLVAPLRKNRK 997
            V NPLSSAQ+F+FLP VL +P  + +        E S  I    S  +TT ++P  K+  
Sbjct: 1270 VQNPLSSAQIFNFLPLVLKYPFSNTSSELDNSIGELSTFILSYRSGSSTTTLSP--KSIS 1327

Query: 998  TVTDMTRANVVNQNEATSSSLNLAVSSEATGSNDVELIFKNIRVKQIIPLVIEGNDYITS 1057
            +++ + +     +  AT S+ +L         +  ++   +I VK+I+P+V     YI S
Sbjct: 1328 SLSVVKKKKNQQKKNATKSTEDL---------HPPQVDTSSIAVKKIVPMVDSSKAYIVS 1378

Query: 1058 VAEVYFPTIYIDSLSALISDPNSTLYSNPKKNFATLASLIDKAIPLTSLR-KNDGQXXXX 1116
            VAEVYFPT  +  L  LI D NSTLYSNP+    +LA LID  IPL  L     G     
Sbjct: 1379 VAEVYFPTEAVTYLQQLILDENSTLYSNPQTPLRSLAGLIDSGIPLGGLTLYGSGDGGYV 1438

Query: 1117 XXXXXXXXXXXXXGDDAFQNAEEYLRVSGAMD--LSNIKVSKVNHTIRNRIIVFLFTLTT 1174
                         G+   QN +   +  GA+D  +++   S        +II+FL  LT 
Sbjct: 1439 PSLTSSSVLDSSKGNS--QNIDGTYKY-GALDDFINSFTDSASAGKYAVKIIIFLIVLTI 1495

Query: 1175 GVFLWISTFLIIFR----------------ITNKSRKLKDSNLKK---GSLPLYQQNPYR 1215
            GV LW+      FR                  N  R+L+ + L +   G+    ++ P  
Sbjct: 1496 GVLLWLFVAFFAFRHRNILLKRHPRNCIGKSLNNERELESTELSRSSSGNQVYNEKPPES 1555

Query: 1216 ENKQFSAESSESYIDIHYTTEKYSDYSASSPPIGENIIVDSAQGIQYKVDNEGNYYY 1272
            EN     ES  S +D HY               GEN + ++   + Y ++++G+  Y
Sbjct: 1556 EN-----ESVYSAVDDHYIV------------TGENTVYNTIHRLHYTINDDGDLLY 1595

>Ecym_4060 Chr4 (125127..131732) [6606 bp, 2201 aa] {ON} similar to
            Ashbya gossypii ADR200C
          Length = 2201

 Score =  162 bits (410), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 146/450 (32%), Positives = 215/450 (47%), Gaps = 55/450 (12%)

Query: 859  VVQTPNPLGGS------SILNPAS-PTSGSDSTDTVWLPTNIIIASNADS---THTARAE 908
            V  T +PLG S      S + P S P+S S    T WLPT I+ AS   S   + T  + 
Sbjct: 1291 VGGTNSPLGSSNVVPSPSFIAPKSNPSSTSIDEKTGWLPTTIVTASMQTSPKESTTVGSA 1350

Query: 909  STASLPAAIAPAEELQSPPDFELITIGFLSGLNYAFLVGNPLSSAQVFDFLPHVLFFP-I 967
            +T +LP AI PA  +  P +++LITIGF+ GLNYAFLV NP++SAQ+F FLPH+L +P I
Sbjct: 1351 ATYTLPRAITPATPVAKPDNYDLITIGFVQGLNYAFLVSNPVASAQIFSFLPHLLNYPYI 1410

Query: 968  EDA-AEKSKAIQPQSSDITTTLVAPLRKNRKTVTDM---TRANVVNQNEATSSSLNLAVS 1023
            E+  A   + I   +++I          NR +V+        N+  +++ T+S+  +   
Sbjct: 1411 ENKEALLLRHINESNNNI--------LGNRGSVSGSYFNIYGNLSLEHKHTNSTEPVKRR 1462

Query: 1024 SEATGSNDVELIFKNIRVKQIIPLVIEGNDYITSVAEVYFPTIYIDSLSALISDPNSTLY 1083
                     E  +  I VKQI+P +++G DY  SVAEVYFP+  + SL  +++D NS LY
Sbjct: 1463 QNNEEDTSDEHGYSQIVVKQIVPFLLQGADYTASVAEVYFPSEAVTSLRKMVADKNSKLY 1522

Query: 1084 SNPKKNFATLASLIDKAIPLTSLRKNDGQXXXXXXXXXXXXXXXXXGDDAFQNAEEYL-R 1142
             NP      LASL+D  IP+ ++                       GD +  +       
Sbjct: 1523 LNPVATLNQLASLVDPRIPVLTITSG-------SSPSFSNTDPDHSGDTSGSSNNNSSDH 1575

Query: 1143 VSGAMDLSNIKVSKVNHTIRNRIIVFLFTLTTGVFLWISTFLIIFRITNKSRKLKDS-NL 1201
              G +DL   +   ++   R RI++F    + GV LWI  FL + +   K  K++    L
Sbjct: 1576 KGGTLDLGAHR--HMSPATRKRILIFSLAFSFGVLLWILIFLFLLKRLYKVSKIRSKIVL 1633

Query: 1202 KKGSLPLYQQNPYRENKQFSAESSESYIDIHY---------TTEKYSDYSASSPP----- 1247
            ++ S+P      Y  N QF+   S+   D  Y         +    S  +  S P     
Sbjct: 1634 REKSIPNNLGISY--NHQFNDRLSDLKTDAFYDGDPERNFNSQSTNSSSNHDSVPDSFTD 1691

Query: 1248 -----IGENIIVDSAQGIQYKVDNEGNYYY 1272
                  GEN +   +QGI Y +D EGNYYY
Sbjct: 1692 DDMIVTGENTVYSLSQGITYHIDEEGNYYY 1721

>Smik_4.695 Chr4 (1227757..1232424) [4668 bp, 1555 aa] {ON} YDR420W
            (REAL)
          Length = 1555

 Score =  160 bits (406), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 143/465 (30%), Positives = 206/465 (44%), Gaps = 82/465 (17%)

Query: 881  SDSTDTVWLPTNIIIASNADSTHTARAEST--ASLPAAIAPAEELQSPPDFELITIGFLS 938
            S S    WLPT II+ S+   T T     T   SLP  I PA     P +  LIT+GF +
Sbjct: 961  SSSNSYAWLPTAIIVQSSETDTSTTLFNPTITGSLPNLIEPAVTASEPINHTLITVGFTA 1020

Query: 939  GLNYAFLVGNPLSSAQVFDFLPHVLFFPIEDAA--------EKSKAIQPQSSDITTTLVA 990
             LNY FLV NPLSSAQ+F+FLP VL +P  D +        E S  I    S  +TT ++
Sbjct: 1021 ALNYVFLVQNPLSSAQIFNFLPLVLKYPFSDTSSGVESSNGELSSFILSYRSGTSTTTLS 1080

Query: 991  PLRKNRKTVTDMTRANVVNQNEATSSSLNLAVSSEATGSNDVELIFKNIRVKQIIPLVIE 1050
            P  +++ +++ + +    ++ +  +S+++L   S    S         I VKQI+P++  
Sbjct: 1081 P--QSKSSLSIVRKKKKGDKEKPPTSTMDLYFPSINASS---------IAVKQIVPMMDS 1129

Query: 1051 GNDYITSVAEVYFPTIYIDSLSALISDPNSTLYSNPKKNFATLASLIDKAIPLTSL---- 1106
               YI +VAEVYFPT  +  L  LI D NSTLY+NP+    TLA LID +IPL SL    
Sbjct: 1130 SKAYIIAVAEVYFPTEAVSYLQELILDVNSTLYNNPQSPLRTLAGLIDNSIPLGSLTLYS 1189

Query: 1107 RKNDGQXXXXXXXXXXXXXXXXXGDDAFQNAEEYLRV--SGAMD--LSNIKVSKVNHTIR 1162
              N+G                   D + +N++  +     GA+D   ++   S    +  
Sbjct: 1190 SGNEGHVSSLFPSGVL--------DSSKENSKGIVATYKYGALDDFTNSFTDSAPGWSYA 1241

Query: 1163 NRIIVFLFTLTTGVFLWISTFLIIFRITN----------------KSRKLKDSNLKKGSL 1206
             R IVFL  LT G  LW+     +F   N                  RK   + L + S 
Sbjct: 1242 ARTIVFLAILTIGALLWLLFAFFVFHYRNILLKRYPKDCIEKSLGNERKFDSTALSRSSS 1301

Query: 1207 --PLYQQNPY-RENKQFSAESSESYIDIHYTTEKYSDYSASSPPIGENIIVDSAQGIQYK 1263
               ++ + P   EN     ES  S  D HY               GEN +  +  G+ Y 
Sbjct: 1302 GNQIFNEKPSGSEN-----ESVHSVTDDHYII------------TGENTVYSTTHGLHYT 1344

Query: 1264 VDNEGNYYYNG---NHLAEGMPEEDE------ESARYKQENQSTE 1299
            ++++G+ +Y     N L E    ED           Y +  +STE
Sbjct: 1345 INDDGDLFYKEATLNDLEETAEREDSGIDSILRDCVYDEHQESTE 1389

>KAFR0E03320 Chr5 complement(659303..662875) [3573 bp, 1190 aa] {ON}
            Anc_5.524 YDR420W
          Length = 1190

 Score =  157 bits (396), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 140/430 (32%), Positives = 205/430 (47%), Gaps = 47/430 (10%)

Query: 888  WLPTNIIIASN-ADSTHTA-RAESTASLPAAIAPAEELQSPPDFELITIGFLSGLNYAFL 945
            WLP ++I AS+ +DST ++   E TA+LPA IA   E   PP+  L+TIGF   LNY FL
Sbjct: 592  WLPNSMIFASDQSDSTFSSLNPEITATLPAEIAAPTEAVQPPNTTLVTIGFKKELNYIFL 651

Query: 946  VGNPLSSAQVFDFLPHVLFFPI-----EDAAEKSKAIQPQSSDITTTLVAPLRKNRKTVT 1000
            + NPL+SAQ+F+FLP  L +P        ++E+  ++   S          L  +  T  
Sbjct: 652  IDNPLASAQIFEFLPLTLSYPFLLTQYNASSEEITSLCSSSLYYEDDGRTILTTHESTTV 711

Query: 1001 DMTRANVVNQNEATSSSLNLAVSSEATGSNDVEL----------IFK--NIRVKQIIPLV 1048
            D T+   V +    +S+L  A  + +  S+  +            F   N+ VK I+P++
Sbjct: 712  DSTQ--FVKKIMGPASNLLTAQLASSPSSSPTQRPHPRESSPPPFFNSSNVVVKHILPMI 769

Query: 1049 IEGNDYITSVAEVYFPTIYIDSLSALISDPNSTLYSNPKKNFATLASLIDKAIPLTSLRK 1108
                DYI SVAEVYFPT  +  L   I+ PNS LYSNP   ++TL  LID  I LT L +
Sbjct: 770  SNQRDYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLIDPWISLTDLFQ 829

Query: 1109 NDGQXXXXXXXXXXXXXXXXXGDDAFQ--------NAEEYLRVSGAMDLSNIKVSKVNHT 1160
             +G                   D +F          + E  R SG++DL++   SK +  
Sbjct: 830  QNGM----NNQGNNQDGSLSSNDSSFNTKTNPSNLTSTETER-SGSLDLNSGYTSKFSSK 884

Query: 1161 IRNRIIVFLFTLTTGVFLWISTFLIIFRITNKS-RKLKDSNLKKGSLPLYQQNPYRENKQ 1219
            I++R+ +F       VF WI  FL+ F+  NK     K   L   +LP  + N  R +  
Sbjct: 885  IKDRLAIFTTVFLFVVFFWIWLFLVAFKHWNKRIENKKAKKLLNKTLPTARFN--RVDLV 942

Query: 1220 FSAESSESYIDIHYTTEKYSDYSASSPPI--------GENIIVDSAQGIQYKVDNEGNYY 1271
              + +S          EK + YS+   P          E ++ D + G+QY VD +GN+Y
Sbjct: 943  TLSTASSMSSSSISPNEKQT-YSSLENPFKDGTTVNSKEGVVYDQSNGMQYTVDYDGNFY 1001

Query: 1272 YNGN-HLAEG 1280
            Y GN  L +G
Sbjct: 1002 YFGNKELLDG 1011

 Score = 36.2 bits (82), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%)

Query: 1478 YRVGDIDELDVELYKRLSKIEKFKNAGK 1505
            ++VG++D LD ELYKR+S I K +   K
Sbjct: 1162 FQVGELDGLDEELYKRMSSIMKLQRINK 1189

>TDEL0A03880 Chr1 (690387..695477) [5091 bp, 1696 aa] {ON} Anc_5.524
            YDR420W
          Length = 1696

 Score =  156 bits (394), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 117/424 (27%), Positives = 196/424 (46%), Gaps = 79/424 (18%)

Query: 886  TVWLPTNIIIASNADSTHTARAES--TASLPAAIAPAEELQSPPDFELITIGFLSGLNYA 943
            T WLP++I + S+   + T+  +   TA+LP  IAP   +  P +   IT+GF   LNY 
Sbjct: 1067 TFWLPSSIQVQSDPTRSGTSSFDPAVTATLPQLIAPPTAVPVPENASKITVGFKKNLNYE 1126

Query: 944  FLVGNPLSSAQVFDFLPHVLFFPIEDAAEKSKAIQPQSSDIT-------TTLVAPLRKNR 996
            FLV +  ++AQ+F FLP VL FP E+   K  + + + + +        TT + P + ++
Sbjct: 1127 FLVSSSTTAAQIFHFLPFVLSFPFEENGTKDFSYKRRGTLLVSSFEFNNTTTLMPAQFHQ 1186

Query: 997  KTVTDMTRANVVNQNEATSSSLNLAVSSEATGSNDVELIF--KNIRVKQIIPLVIEGNDY 1054
            +TVT +++ +                        D E  F    + V QI+P++I+  +Y
Sbjct: 1187 ETVTGISKRS------------------------DSEFPFNASAVDVIQIMPMIIKDRNY 1222

Query: 1055 ITSVAEVYFPTIYIDSLSALISDPNSTLYSNPKKNFATLASLIDKAIPLTSLRKNDGQXX 1114
            +TS+A +YFP+ Y+  L +++SD  S L++NP      LA+LID +IPLT L   DG   
Sbjct: 1223 LTSIAVLYFPSAYVSELQSMVSDDTSQLFNNPDPTLDALAALIDPSIPLTGLI--DGSTG 1280

Query: 1115 XXXXXXXXXXXXXXXGDDAFQNAEEYLRVSGAMDLSNIKVSKVNHTIRNRIIVFLFTLTT 1174
                                Q++++    SG+  L     S ++  ++ R++++L  L  
Sbjct: 1281 SLNGGNPSTQSHSPSSPYKSQSSDDN---SGS--LGTATNSGLSSAVKKRLVIYLTCLVF 1335

Query: 1175 GVFLWISTFLIIFRITNKSRKLKDSNLKKGSLPLYQQNPYRENKQFSAESSESYIDI--- 1231
            G  LWI  F+ +++     R +     K+     YQ++  +E KQ       ++ DI   
Sbjct: 1336 GTLLWILVFMFLYKHLYGGRVIA----KRA----YQRDAAQEEKQH-----YNFADITSV 1382

Query: 1232 -HYTTEKYSDYSASSPP--------------------IGENIIVDSAQGIQYKVDNEGNY 1270
                TE  +D S   P                      GEN +   +QG+QY V  +G++
Sbjct: 1383 HSAETEPANDKSDDVPQEKDVASASQSRYSLPEDLMITGENTVYSVSQGLQYFVAEDGSF 1442

Query: 1271 YYNG 1274
            YY G
Sbjct: 1443 YYAG 1446

>ZYRO0D12496g Chr4 (1047901..1055058) [7158 bp, 2385 aa] {ON} some
            similarities with uniprot|P41809 Saccharomyces cerevisiae
            YDR420W HKR1 Serine/threonine rich cell surface protein
            that contains an EF hand motif involved in the regulation
            of cell wall beta-1 3 glucan synthesis and bud site
            selection overexpression confers resistance to Hansenula
            mrakii killer toxin HM-1
          Length = 2385

 Score =  153 bits (386), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 136/479 (28%), Positives = 198/479 (41%), Gaps = 85/479 (17%)

Query: 868  GSSILNPASPTSGSDSTDTVWLPTNIIIASNADSTHTA--RAESTASLPAAIAPAEELQS 925
            GSS+    S TS    ++T WLP +II+ S    +       E TA+LP AIAP   +  
Sbjct: 1631 GSSV---PSATSAPTESNTNWLPYSIIMQSTPSPSSAPSFNPEVTATLPHAIAPQTPVSE 1687

Query: 926  PPDFELITIGFLSGLNYAFLVGNPLSSAQVFDFLPHVLFFPIEDAAEKSKAIQPQSSD-- 983
            PP+   ITIGF   ++Y FLV NPLSSAQ+F FLP VL +P        K      S   
Sbjct: 1688 PPNSSTITIGFKRQIDYDFLVNNPLSSAQIFTFLPDVLIYPFNYDQNIDKGTHTNESSHY 1747

Query: 984  -ITTTLVAPLRKNRKTVTDMTRANVVNQNEATSSSLNLAVSSEATGSNDVELI-FKNIRV 1041
               TT + P R        M R N  ++                     V++I   N+ V
Sbjct: 1748 KRKTTTLQPYRD------VMVRTNKKHK---------------------VQMISTANVSV 1780

Query: 1042 KQIIPLVIEGNDYITSVAEVYFPTIYIDSLSALISDPNSTLYSNPKKNFATLASLIDKAI 1101
             QI+P++     Y+ +VAE+YFP  Y++ L   + + NS LY+N       LA LID +I
Sbjct: 1781 IQIMPMLSRDKSYLVAVAELYFPAQYVNKLKDYMKNSNSMLYNNTNPTLFALADLIDPSI 1840

Query: 1102 PLTSLRKNDGQXXXXXXXXXXXXXXXXXGDD--AFQNAEEYLRVSGAMDLSNIKVSKVNH 1159
            PLT +  ++G                       +FQN  E    +G ++ +N   S +  
Sbjct: 1841 PLTGMVDDNGDVNNGGSGSGSSGEGNHASQSPHSFQNGNE---DNGNLETAN-STSHITG 1896

Query: 1160 TIRNRIIVFLFTLTTGVFLWISTFLIIFRITNK-----------------------SRKL 1196
             I  R+ +FL     GV LWI +FL IFR   K                       S   
Sbjct: 1897 VITKRLAIFLNCFAFGVLLWILSFLFIFRKIRKVQPPEEGESYAELDTSGDVLKLPSGSG 1956

Query: 1197 KDSNLKKGSLPLYQQNPYRENKQFSAESSESYIDIHYTTEKYSDYSASSPPIGENIIV-- 1254
            +D+     S P + Q     N   + E+ +                 +  PI +++IV  
Sbjct: 1957 EDNASGSSSGPQFFQEKATNNDSQNQETVDRNATPKLENSNEGIGGNAQSPISDDLIVTG 2016

Query: 1255 -----DSAQGIQYKVDNEGNYYYNGNHLAEGMPEEDEESARYKQENQSTELQSDSIDHF 1308
                  +  G++Y VD +G ++Y GN       +  +ES   K E+       D ID F
Sbjct: 2017 ENTVYSTLHGLEYFVDEDGQFHYAGNR------QISDESGTTKDEH-------DEIDDF 2062

>KLTH0G03696g Chr7 (286341..292598) [6258 bp, 2085 aa] {ON} some
            similarities with uniprot|P41809 Saccharomyces cerevisiae
            YDR420W HKR1 Serine/threonine rich cell surface protein
            that contains an EF hand motif involved in the regulation
            of cell wall beta-1 3 glucan synthesis and bud site
            selection overexpression confers resistance to Hansenula
            mrakii killer toxin HM-1
          Length = 2085

 Score =  149 bits (377), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 146/484 (30%), Positives = 220/484 (45%), Gaps = 60/484 (12%)

Query: 855  GSVGVVQTPNPLGGSSILNPASPTS-GSDSTDTVWLPTNIIIASNADSTHTAR---AEST 910
            GSV   +TP+    +++L P+S  S GS S D  WLP+NI+ AS   S HT     A++T
Sbjct: 1199 GSVQPSRTPSL---ATVLAPSSTNSEGSTSMD--WLPSNIVTASYTGSAHTQSSFDADAT 1253

Query: 911  ASLPAAIAPAEELQSPPDFELITIGFLSGLNYAFLVGNPLSSAQVFDFLPHVLFFPIEDA 970
            A+LP AI P   +  PP++  ITIGF   LNY FL+ NPL+SAQ+F FLP +L +P    
Sbjct: 1254 ATLPQAIMPPTPVTMPPNYSQITIGFKESLNYPFLIENPLASAQIFGFLPEILRYPF--- 1310

Query: 971  AEKSKAIQPQSSDITTTLVAP----LRKNRKTVTDMTRANVVNQNEATSSSLNLAVSSEA 1026
            + ++      +S +   LV      L  N   + D      +N   +  +SL+  VS   
Sbjct: 1311 SVRASRSNSSTSSVKRDLVGDSGNLLLDNSTLILDK-----LNWKTSIMNSLSSNVSVSR 1365

Query: 1027 TGS-NDVELIFKNIRVKQIIPLVIEGNDYITSVAEVYFPTIYIDSLSALISDPNSTLYSN 1085
             GS N     F  + V  I+PL++ GNDYITSVA VYFPT  ++ L  +I +  S +Y N
Sbjct: 1366 NGSHNAFRANFSGVAVSSIVPLIVSGNDYITSVAVVYFPTEAVEVLQKMIINGASRIYKN 1425

Query: 1086 PKKNFATLASLIDKAIPLTSL--RKNDGQXXXXXXXXXXXXXXXXXGDDAFQNAEEYLRV 1143
            P ++   +A LID  IP+T +      GQ                 G     +  +Y  V
Sbjct: 1426 PDQSLRDMALLIDSKIPITGIISSDGSGQGSGSSGGSGSSSGSDGTGSSGSSSESDYEDV 1485

Query: 1144 ----SGAMDLSNIKVSKVNHTIRNRIIVFLFTLTTGVFLWISTFLIIFRITNKSRKLKDS 1199
                SG +D    K  +V      R+++FL      V +WIS  L+ F           S
Sbjct: 1486 KNDNSGTLD--GYKNFQVKFFTTKRLVIFLPVFIVAVTMWISLGLLFF----------GS 1533

Query: 1200 NLKKGSLPLYQQNPYRE------------------NKQFSAESSESYIDIHYTTEKYSDY 1241
              +KGSL     N  ++                   K+ SA+  ++     +  E  SD 
Sbjct: 1534 LFRKGSLQGMAGNLEKKWNTDQKTLDNYFGITEFIGKRQSADLEKNLAGSFHNDESSSDA 1593

Query: 1242 SASSP--PIGENIIVDSAQGIQYKVDNEGNYYYNGNHLAEGMPEEDEESARYKQENQSTE 1299
                    +G  +    + G+ Y VD EGN++Y G      +P + + +++ +  N    
Sbjct: 1594 FDDDDLLAVGNGMFFSKSTGLTYHVDREGNFFYAGTANKAVLPLKSKSTSKLEASNMVPN 1653

Query: 1300 LQSD 1303
             +SD
Sbjct: 1654 GESD 1657

>KLLA0A01826g Chr1 complement(163010..167404) [4395 bp, 1464 aa] {ON}
            some similarities with uniprot|P41809 Saccharomyces
            cerevisiae YDR420W HKR1 Serine/threonine rich cell
            surface protein that contains an EF hand motif involved
            in the regulation of cell wall beta-1 3 glucan synthesis
            and bud site selection overexpression confers resistance
            to Hansenula mrakii killer toxin HM-1
          Length = 1464

 Score =  148 bits (374), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 128/448 (28%), Positives = 199/448 (44%), Gaps = 83/448 (18%)

Query: 888  WLPTNIIIASNADSTHTARAE----STASLPAAIAPAEELQSPPDFELITIGFLSGLNYA 943
            WLPT ++I   A    +A       +T++LP AI PA ++  P  + +IT+GF   LNY 
Sbjct: 722  WLPTTLVIEPTAAHATSAATSADLGATSTLPQAINPASDVPLPDGYTVITVGFKEPLNYP 781

Query: 944  FLVGNPLSSAQVFDFLPHVLFFPIEDAAEKSKAIQPQSSDITTTLVAPLRKNRKTVTDMT 1003
            FL+ NPL+SAQ+F+FLP VL  P +               +TTT  AP+ +         
Sbjct: 782  FLIANPLASAQIFNFLPKVLVRPFQ---------------LTTTGAAPVYRRSW------ 820

Query: 1004 RANVVNQNEATSSSLNLAVSSEATGSNDVELIFKNIRVKQIIPLVIEGNDYITSVAEVYF 1063
              N+  +   T    +L  SS  T        + +++VK I+PLVI+   YI S+AEVYF
Sbjct: 821  --NIFKKGINT----HLLSSSLPT--------YDDVQVKSIVPLVIQNVSYIVSIAEVYF 866

Query: 1064 PTIYIDSLSALISDPNSTLYSNPKKNFATLASLIDKAIPLTSL------------RKNDG 1111
            PT  + +L  L+ D +S LYSNP    A LASLI+ AIPLT L                 
Sbjct: 867  PTESVHTLQELVLDSSSILYSNPVSYLADLASLINPAIPLTGLTYSGSSGSSSGNGSGGD 926

Query: 1112 QXXXXXXXXXXXXXXXXXGDDAFQNAEEYLRVSGAMDLSNIKVSKVNHTIRNRIIVFLFT 1171
                               D++  NA  +    G++D + +     NH    R +  +  
Sbjct: 927  SDGNGNGSGEGTGGNGAEKDNSSNNAALW----GSLD-AGLTSGFPNHDTVIRFVCMVTV 981

Query: 1172 LTTGVFLWISTFLI----IFRITNKSRKLKDSNLKKGSLPLY------------QQNPYR 1215
            LT  +   +   L+    +++ TN ++++  +      +P +             +N + 
Sbjct: 982  LTAFILCLVGLILVFLKNLYKRTNCAQRMHLTEKNWPEIPTFYSHHMNGSTDSPMRNMFY 1041

Query: 1216 ENKQFSAESSESYIDIHYTTEKYSDYSASSPPIGENIIVDSAQGIQYKVDNEGNYYYNG- 1274
               QFS +S  +  D H       D   +    GEN +   +QGI Y VD +GN+++ G 
Sbjct: 1042 SGSQFS-DSDTTEEDSHSAEYIDDDLIIT----GENTVYSISQGITYYVDEDGNFFFAGV 1096

Query: 1275 ---NHLAEGMPEEDEESARYKQENQSTE 1299
                H +E  PE+ E+    K E  + E
Sbjct: 1097 GKDVHTSE--PEKLEKIIHDKTETVTVE 1122

>Skud_4.694 Chr4 (1228095..1232609) [4515 bp, 1504 aa] {ON} YDR420W
            (REAL)
          Length = 1504

 Score =  142 bits (358), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 101/265 (38%), Positives = 144/265 (54%), Gaps = 28/265 (10%)

Query: 857  VGVVQTPNPLGGSSIL-----NPASPTSGSDSTDTVWLPTNIIIASNADSTHTA--RAES 909
            V  +QT    G  S++     +P +P + S+  D  WLPT II+  +   + TA      
Sbjct: 884  VTALQTQTITGSDSVIPVSFTHPTTPYTYSN--DYAWLPTTIIVEPSQTGSSTAPFNPSI 941

Query: 910  TASLPAAIAPAEELQSPPDFELITIGFLSGLNYAFLVGNPLSSAQVFDFLPHVLFFPIED 969
            T SLP+ I PA  +  P +  LIT+GF +GLNY FLV NPLSSAQ+F+FLP VL +P  +
Sbjct: 942  TGSLPSLIEPAVAVSEPANHTLITVGFTAGLNYEFLVQNPLSSAQIFNFLPLVLGYPFSN 1001

Query: 970  A-AEKSKAIQPQSSDI-------TTTLVAPLRKNRKTVTDMTRANVVNQNEATSSSLNLA 1021
               E   + Q  SS +       +TT ++P  K+  +++ + +     +  AT+S+ +L 
Sbjct: 1002 TRLEVQSSTQGLSSFVLSYQSGTSTTTLSP--KSVSSLSIVKKKKKGEKRNATASTADLY 1059

Query: 1022 VSSEATGSNDVELIFKNIRVKQIIPLVIEGNDYITSVAEVYFPTIYIDSLSALISDPNST 1081
            + S  T S         I VKQI+P+V     Y+ +VAEVYFPT  I  L  LI D +S 
Sbjct: 1060 LPSIETSS---------IVVKQIVPMVNSSKAYVIAVAEVYFPTEAISYLQKLILDASSP 1110

Query: 1082 LYSNPKKNFATLASLIDKAIPLTSL 1106
            +Y+NP+    TLA LID  IPL  L
Sbjct: 1111 IYNNPQTPLRTLAGLIDSRIPLGGL 1135

>CAGL0F03003g Chr6 (289923..293480) [3558 bp, 1185 aa] {ON} some
            similarities with uniprot|P32334 Saccharomyces cerevisiae
            YGR014w MSB2 or uniprot|P41809 Saccharomyces cerevisiae
            YDR420w HKR1
          Length = 1185

 Score =  142 bits (357), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 115/353 (32%), Positives = 163/353 (46%), Gaps = 59/353 (16%)

Query: 874  PASPTSGSD-STDTVWLPTNIIIASNADSTHTARAESTA--SLPAAIAPAEELQSPPDFE 930
            PA+PT     S+D  WLP+ II  S+  +T ++    TA  SLP  IAP +     P+  
Sbjct: 702  PATPTGPKTLSSDENWLPSGIIFQSDFATTVSSSFNPTATKSLPQFIAPPKMTVKSPNTT 761

Query: 931  LITIGFLSGLNYAFLVGNPLSSAQVFDFLPHVLFFPIEDAAEKSKAIQPQSSDITTTLVA 990
            L+TIG   GLNY FL+ NPLSSAQ+F+FLP VL +P    A                   
Sbjct: 762  LVTIGLKQGLNYQFLIDNPLSSAQIFNFLPSVLTYPFSSYAPN----------------- 804

Query: 991  PLRKNRKTVTDMTRANVVNQNEATSSSLNLAVSSEATGSNDVELIFKNIRVKQIIPLVIE 1050
                      D    ++++ N       NL  +S              I V  I+PL+I 
Sbjct: 805  ----------DFPINSLIDDNALAFLDSNLFNAS-------------TISVHGIVPLLIP 841

Query: 1051 GNDYITSVAEVYFPTIYIDSLSALISDPNSTLYSNPKKNFATLASLIDKAIPLTSLRKND 1110
            G+++  SV EVYFP   +DSLSALI D NS+LYSNP  + + LA LID +IPLT L    
Sbjct: 842  GHEFFVSVVEVYFPNDLLDSLSALIKDRNSSLYSNPNDSLSALARLIDPSIPLTGLIS-- 899

Query: 1111 GQXXXXXXXXXXXXXXXXXGD----DAFQNAEEYLRVSGAMDLSNIKVSKVNHTIRNRII 1166
            G                  G+       +     L + G++D  +    K  H  +NR+I
Sbjct: 900  GSSIESTSNSDADYNSDQSGNTRQSRKGKGLPSNLSIVGSLDNYDKNPEKEEH--KNRVI 957

Query: 1167 VFLF--TLTTG-VFLWISTFLIIFRITNKSRK----LKDSNLKKGSLPLYQQN 1212
              +    L  G +F+W   F+++ R T + RK    ++ SN+K  +   Y  N
Sbjct: 958  SIVLPTVLPLGLLFIWCLFFILMSR-TQRRRKGNATIEKSNIKVDNTSGYHDN 1009

>Kwal_47.18650 s47 complement(913245..919724) [6480 bp, 2159 aa] {ON}
            YDR420W (HKR1) - Type 1 membrane protein with EF hand
            motif [contig 191] FULL
          Length = 2159

 Score =  140 bits (353), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 131/460 (28%), Positives = 201/460 (43%), Gaps = 73/460 (15%)

Query: 857  VGVVQTPNPLGGSSILNPASPTSGSDSTDTVWLPTNIIIASNADSTHTARA---ESTASL 913
            +GV+    P   S+ L+  S +     T + WLPT ++ AS  +S +T  +    +TA+L
Sbjct: 1275 IGVISGDAPT--STFLSKPSQSVAGSRTSSDWLPTLLVTASATESVNTQSSFDTAATATL 1332

Query: 914  PAAIAPAEELQSPPDFELITIGFLSGLNYAFLVGNPLSSAQVFDFLPHVLFFPIEDAAEK 973
            P  I P+  +  P ++  ITIGF   LNY FL+ NPL+SAQ+F FLP VL +P     ++
Sbjct: 1333 PQFIVPSTPVSIPANYSQITIGFQKALNYPFLIKNPLASAQIFGFLPDVLRYPFVSRFDR 1392

Query: 974  SKAIQ-----------PQSSDI-TTTLVAPLRKNRKTVTDMTRANVVNQNEATSSSLNLA 1021
            +  +            P+   +  T L    RK +  +T+    ++    +A    ++  
Sbjct: 1393 TTNVSESQPWRYFKEFPRDGHLENTNLSEDERKLKNGLTN----HIFEDGQALQYRMH-- 1446

Query: 1022 VSSEATGSNDVELIFKNIRVKQIIPLVIEGNDYITSVAEVYFPTIYIDSLSALISDPNST 1081
                 TG+      F  + V  IIPL+I GNDYI SVA VYFPT  ++ L  +I +  S 
Sbjct: 1447 ---NRTGAFSAN--FSEVVVSSIIPLIISGNDYIASVAIVYFPTSAVNVLQKMILNSASM 1501

Query: 1082 LYSNPKKNFATLASLIDKAIPLTSL-------RKNDGQXXXXXXXXXXXXXXXXXGDDAF 1134
            LYSNP     +LA LID  IP+T L          DG                  G  + 
Sbjct: 1502 LYSNPDSTQESLALLIDPKIPITGLVDSDGSSGSGDGSGGSGSSGDGGDSGSSSSGSGSS 1561

Query: 1135 QNA---EEYLRVSGAMDLSNIKVSKVNHTIRNRIIVFLFTLTTGVFLWISTFLIIFRITN 1191
             NA   +  L   G  D  ++  S     +  ++I+FL      + LW+   L+ F    
Sbjct: 1562 TNASTDDRNLGTLGGFDFFHMSFS-----VAKKLIIFLPVFLVSIALWVLLGLLFFGGLV 1616

Query: 1192 KSRKLKDSNLKKGSLPLYQQNPYRENKQFSAESS--ESYIDIHYTTEKYSDYSASSP--- 1246
             S+       K+  LP         +K++S +    +SY D H   EKY   + SS    
Sbjct: 1617 GSKNKN----KQDPLP---------DKKWSVDEKALQSYFDPHPDVEKYPGSAWSSTSDS 1663

Query: 1247 ------------PIGENIIVDSAQGIQYKVDNEGNYYYNG 1274
                         +G  +    + G+ Y+V  +GN+YY G
Sbjct: 1664 NSDDFRSEEDLLAVGNGLFFSRSTGLTYQVGPDGNFYYAG 1703

>Kpol_363.14 s363 (25673..27781,27783..27959) [2286 bp, 761 aa] {ON}
            (25673..27781,27783..27959) [2286 nt, 762 aa]
          Length = 761

 Score =  115 bits (287), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 87/247 (35%), Positives = 132/247 (53%), Gaps = 14/247 (5%)

Query: 875  ASPTSGSDSTDTV-WLPTNIII-ASNADSTHTARAES-TASLPAAIAPAEELQSPPDFEL 931
            A P S   + D+  WLPTNI++ +SN D T++    + T+ LP  IAP    Q P D  L
Sbjct: 506  AVPLSSEQTRDSFAWLPTNIVVQSSNTDMTNSPETNTNTSGLPVRIAPTAVTQ-PADSIL 564

Query: 932  ITIGFLSGLNYAFLVGNPLSSAQVFDFLPHVLFFPIEDAA-----EKSKAIQPQSSDITT 986
            I+IGF   LNY FL+    +SAQ+F+FLP +L +P E  +     + S ++Q  +S I+T
Sbjct: 565  ISIGFKIELNYPFLIKESYASAQIFNFLPLILTYPFEQDSSNYQLDPSISLQSDTSVIST 624

Query: 987  TL--VAPLRKNRKTVTDMTRANVVNQNEATSSSLNLAVSSEATGSNDVELIFKNIRVKQI 1044
                 + +     T++++    + + ++  +S L    S      N  +    +I VKQI
Sbjct: 625  EYQDYSSIFSYETTLSNL-GLTLYDLSDGETSVLE--ASPTVASMNKYQRDTSSISVKQI 681

Query: 1045 IPLVIEGNDYITSVAEVYFPTIYIDSLSALISDPNSTLYSNPKKNFATLASLIDKAIPLT 1104
            IP++I GN YITS+AE  FP   +D L   I++  S +Y NP      +A+LID  IP+ 
Sbjct: 682  IPILIPGNLYITSLAEGLFPGEKVDELQNYINNLTSIIYQNPDPRLKDMAALIDSTIPIF 741

Query: 1105 SLRKNDG 1111
            S    DG
Sbjct: 742  STIDPDG 748

>TPHA0L00360 Chr12 complement(50396..53881) [3486 bp, 1161 aa] {ON} 
          Length = 1161

 Score =  105 bits (262), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 114/434 (26%), Positives = 181/434 (41%), Gaps = 59/434 (13%)

Query: 888  WLPTNIIIASN--ADSTHTARAESTASLPAAIAPAEELQSPPDFELITIGFLSGLNYAFL 945
            WLP+ I I S+  A+S   +    T+ LP  I     +  P +  LIT+ F   LNYAFL
Sbjct: 516  WLPSEIAIQSDSTAESMEPSFLIDTSGLPNIITAPTAITIPSNTTLITVAFKRELNYAFL 575

Query: 946  VGNPLSSAQVFDFLPHVLFFP----IEDAAEKSKAIQPQSSDITTTLVAPLRKNRKTVTD 1001
            V N  SSAQ+F+FLP ++  P    + ++        P     T  ++     +  +   
Sbjct: 576  VNNFYSSAQIFNFLPIIIKHPFTALVSESCNDDSVCSPL---FTEYILNSYASSAASSMS 632

Query: 1002 MTRANVVNQNEATSSSLNLAVSSEAT------------------------------GSND 1031
             +  N V+       S+N+ +S  +T                               S  
Sbjct: 633  TSSVNNVDFQSGGKHSVNINLSLHSTIVQTAISPTGFQTNMTSQIPSLAKKDLSKNASLQ 692

Query: 1032 VELIFKNIRVKQIIPLVIEGNDYITSVAEVYFPTIYIDSLSALISDPNSTLYSNPKKNFA 1091
             + I  +I V +IIP +++ N YI S+AEVY P   +++L  LI +P S+ Y++   +  
Sbjct: 693  KQEISMDITVARIIPYIVQNNKYIISIAEVYVPNEIVETLQELILNPASSFYNSESSSLK 752

Query: 1092 TLASLIDKAIPLTSLRKNDGQXXXXXXXXX-----XXXXXXXXGDDAFQNAEEYLRVSGA 1146
            TLA LID  IPLT +  ++G                       G      + + L++ G 
Sbjct: 753  TLAFLIDPNIPLTGMLDSNGNLISGGLSSSNGNIQNSSTKHSHGSGISDISSQTLKL-GT 811

Query: 1147 MDLSNIKVSKVNHTIRNRIIVFLFTLTTGVFLWISTFLIIFRITNKSRKLK-DSNLKKGS 1205
            +D S  K    N  ++ R+ +F+   T G  L+I   L       K   +K D    K S
Sbjct: 812  LDSSAYKGLSTN--LKKRLSIFIVCFTVGAVLYIQLSLFGLNFMYKKLSMKADPESDKSS 869

Query: 1206 LPLYQQN-------PYRENKQFSAESSESYIDIHYTTEKYSDYSASSPPIGENIIVDSAQ 1258
            LP Y            R +K FS  S+  + D +  +   S  S + P      + + +Q
Sbjct: 870  LPQYHITRDSTSNIEGRSSKSFSTPSNP-FSDKYQKSSSDSSKSITLP---GKAVYNRSQ 925

Query: 1259 GIQYKVDNEGNYYY 1272
             + Y VD +GN+YY
Sbjct: 926  DMTYLVDEQGNFYY 939

>TDEL0D03010 Chr4 complement(564735..568106) [3372 bp, 1123 aa] {ON}
            Anc_4.150 YGR014W
          Length = 1123

 Score =  102 bits (253), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 74/223 (33%), Positives = 104/223 (46%), Gaps = 65/223 (29%)

Query: 888  WLPTNIIIASNADSTHTARAESTASLPAAIAPAEELQSPPDFELITIGFLSGLNYAFLVG 947
            W+PT I+  ++  ++     ++TA+LP AIA A ++  P  + LIT+GF   LNY F+V 
Sbjct: 796  WVPTQIVTQTSQTTSSGTVGQATATLPQAIAAATQVARPDGYTLITLGFKRALNYNFVVS 855

Query: 948  NPLSSAQVFDFLPHVLFFPIEDAAEKSKAIQPQSSDITTTLVAPLRKNRKTVTDMTRANV 1007
            NP+SSAQ+F FLP +L  P E++ E          +IT   + PL+              
Sbjct: 856  NPISSAQIFAFLPEMLRTPFENSYE----------NITVQQLVPLQSK------------ 893

Query: 1008 VNQNEATSSSLNLAVSSEATGSNDVELIFKNIRVKQIIPLVIEGNDYITSVAEVYFPTIY 1067
                         AVS  AT                              VAEVYFPT  
Sbjct: 894  -------------AVSYLAT------------------------------VAEVYFPTSE 910

Query: 1068 IDSLSALISDPNSTLYSNPKKNFATLASLIDKAIPLTSLRKND 1110
            I +LS LIS+ +S LY++ +     LA LID +IPLT L  +D
Sbjct: 911  ISALSKLISNTSSNLYTDVEGPAKYLAYLIDASIPLTGLLGSD 953

>Kwal_47.17703 s47 (521283..525989) [4707 bp, 1568 aa] {ON} YNR044W
            (AGA1) - anchorage subunit of a-agglutinin [contig 206]
            FULL
          Length = 1568

 Score = 90.5 bits (223), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 83/333 (24%), Positives = 137/333 (41%), Gaps = 78/333 (23%)

Query: 880  GSDSTDTVWLPTNIIIA-------SNADSTHTARAE-STASLPAAIAPAEELQSPPDFEL 931
             S +T + WLPT +I A       S  DS+    A+ +T +LP AI    E+  P  + L
Sbjct: 1216 ASSATSSNWLPTAMITANANTESASPTDSSDPKDAQQATKTLPQAIGAPTEVVQPEGYTL 1275

Query: 932  ITIGFLSGLNYAFLVGNPLSSAQVFDFLPHVLFFPIEDAAEKSKAIQPQSSDITTTLVAP 991
            IT+GF   LNY F+VGNP++SAQ+F FLP  L  P ++A           ++IT   + P
Sbjct: 1276 ITVGFKKALNYPFVVGNPVTSAQIFAFLPDTLNSPFDNAF----------TNITVARLGP 1325

Query: 992  LRKNRKTVTDMTRANVVNQNEATSSSLNLAVSSEATGSNDVELIFKNIRVKQIIPLVIEG 1051
            L+ + +                    L +A           E+ F + +V+ +  L+   
Sbjct: 1326 LKVSSRDYL-----------------LTVA-----------EVYFPSAQVENLQKLI--Q 1355

Query: 1052 NDYITSVAEVYFPTIYIDSLSALISDPNSTLYSNPKKNFATLASLIDKAIPLTSLRKNDG 1111
            ND     ++ YF                    +   +N   +ASL+D  IPLT L ++DG
Sbjct: 1356 ND----ASKFYF-------------------VNGTSRNV--VASLVDATIPLTGLLQDDG 1390

Query: 1112 QXXXXXXXXXXXXXXXXXG-----DDAFQNAEEYLRVSGAMDLSNIKVSKVNHTIRNRII 1166
                                    D + Q++   L   G+   S+          + ++I
Sbjct: 1391 STTSETGSESGSPSNTGSSSNEGTDSSEQSSHGNLGTLGSSQYSSSASGFFKSGGKGKLI 1450

Query: 1167 VFLFTLTTGVFLWISTFLIIFRITNKSRKLKDS 1199
              +  +  G  ++++  +I+FR   K R+LK S
Sbjct: 1451 GLVVGVVCGALVYVAIMVIVFRFVVKKRQLKAS 1483

>KLTH0E08844g Chr5 (804120..808682) [4563 bp, 1520 aa] {ON} some
            similarities with uniprot|P32334 Saccharomyces cerevisiae
            YGR014W MSB2 Mucin family member at the head of the
            Cdc42p- and MAP kinase-dependent filamentous growth
            signaling pathway also functions as an osmosensor in
            parallel to the Sho1p-mediated pathway potential Cdc28p
            substrate
          Length = 1520

 Score = 88.2 bits (217), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 86/326 (26%), Positives = 127/326 (38%), Gaps = 82/326 (25%)

Query: 888  WLPTNIIIAS-NADSTHTARAES------TASLPAAIAPAEELQSPPDFELITIGFLSGL 940
            WLPT ++ AS + + T +   +S      T +LP AI    E+  P  + LITIGF   L
Sbjct: 1179 WLPTALVTASSDTNDTQSGSTDSNGSQLATQTLPQAIGAPTEVSQPEGYTLITIGFKQAL 1238

Query: 941  NYAFLVGNPLSSAQVFDFLPHVLFFPIEDAAEKSKAIQPQSSDITTTLVAPLR-KNRKTV 999
            NY F+V N ++SAQ+F +LP  L FP +DA           SDIT   + PL+  NR  +
Sbjct: 1239 NYPFVVTNAVTSAQIFAYLPETLNFPFDDAF----------SDITVARLGPLKVSNRDYL 1288

Query: 1000 TDMTRANVVNQNEATSSSLNLAVSSEATGSNDVELIFKNIRVKQIIPLVIEGNDYITSVA 1059
                              L +A           E+ F + +V+                 
Sbjct: 1289 ------------------LTIA-----------EVYFPSAQVEN---------------- 1303

Query: 1060 EVYFPTIYIDSLSALISDPNSTLYS-NPKKNFATLASLIDKAIPLTSL---RKNDGQXXX 1115
                       L  LI +  S  Y+ N  KN   LA+ +D  IPLT L     +      
Sbjct: 1304 -----------LQTLIQNDESKFYAKNATKNL--LAAFVDATIPLTGLVEEEGSTSSGSS 1350

Query: 1116 XXXXXXXXXXXXXXGDDAFQNAEEYLRVSGAMDLSNIKVSK-VNHTIRNRIIVFLFTLTT 1174
                          G+        Y R SG +  S  K S       R++++  +  +  
Sbjct: 1351 QSSGASSNVSTSSEGESEDGGKSGY-RNSGTLGSSYYKSSTFTKQGGRSKLVGLIVGVVC 1409

Query: 1175 GVFLWISTFLIIFRITNKSRKLKDSN 1200
            G  ++I+  +I FR   K  +LK SN
Sbjct: 1410 GALVYIALMVITFRFIIKKMQLKASN 1435

>YGR014W Chr7 (516943..520863) [3921 bp, 1306 aa] {ON}  MSB2Mucin
            family member involved in the Cdc42p- and MAP
            kinase-dependent filamentous growth signaling pathway;
            also functions as an osmosensor in parallel to the
            Sho1p-mediated pathway; potential Cdc28p substrate
          Length = 1306

 Score = 87.8 bits (216), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 69/222 (31%), Positives = 97/222 (43%), Gaps = 68/222 (30%)

Query: 888  WLPTNIII-ASNADST--HTARAESTASLPAAIAPAEELQSPPDFELITIGFLSGLNYAF 944
            W+PT +I  A  A ST   T     T +LP AIA A ++  P  + LITIGF   LNY F
Sbjct: 961  WIPTELITQAPEAASTASSTVGGTQTMTLPHAIAAATQVPEPEGYTLITIGFKKALNYEF 1020

Query: 945  LVGNPLSSAQVFDFLPHVLFFPIEDAAEKSKAIQPQSSDITTTLVAPLRKNRKTVTDMTR 1004
            +V  P SSAQ+F +LP  L  P ++            ++IT   + PL+ +         
Sbjct: 1021 VVSEPKSSAQIFGYLPEALNTPFKNVF----------TNITVLQIVPLQDD--------- 1061

Query: 1005 ANVVNQNEATSSSLNLAVSSEATGSNDVELIFKNIRVKQIIPLVIEGNDYITSVAEVYFP 1064
                        SLN  V                                  SVAEVYFP
Sbjct: 1062 ------------SLNYLV----------------------------------SVAEVYFP 1075

Query: 1065 TIYIDSLSALISDPNSTLYSNPKKNFATLASLIDKAIPLTSL 1106
            T  I+ LS LI++ +S  Y++      ++A+++D +IPLT L
Sbjct: 1076 TAEIEELSNLITNSSSAFYTDGMGTAKSMAAMVDSSIPLTGL 1117

>TBLA0G00950 Chr7 complement(232502..239263) [6762 bp, 2253 aa] {ON}
            Anc_5.524 YDR420W
          Length = 2253

 Score = 83.6 bits (205), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 114/476 (23%), Positives = 189/476 (39%), Gaps = 94/476 (19%)

Query: 888  WLPTNIIIASNADSTHTAR--AESTASLPAAIAP--AEELQSPPDFELITIGFLSGLNYA 943
            WLP+ +++ +N   +   +     T   P AI P    E  +P D +LI +     LNY 
Sbjct: 1556 WLPSTLVVENNPSGSANMQFNPSETFKWPRAITPENQNEKPAPVDSQLILVALDRPLNYP 1615

Query: 944  FLVGNPLSSAQVFDFLPHVLFFPIED---AAEKSKAIQPQSSDI-------TTTLVAPLR 993
            FL+ N +SSAQV +++P +L + + D   AA  S ++   + DI       TTTL   + 
Sbjct: 1616 FLIENLVSSAQVMNYIPFILSYSLIDFSPAAPSSYSLSGTAYDISSEINSGTTTLSPVIA 1675

Query: 994  KNRK---TVTDMTRANVVNQNEATSSSLNLAVSSEATGSNDVEL---------------- 1034
             N+K       + + N ++QN  + S ++  VS      +++E+                
Sbjct: 1676 TNKKRDVKTWQLNKMNSISQNTVSHSLID--VSFLTANQSNIEIQASSSSSTNSIASLQL 1733

Query: 1035 -IFKNIRVKQIIPLVIEGN--------------------------------------DYI 1055
                N    QI+P    GN                                      DY 
Sbjct: 1734 QATDNKTPSQILPTKTSGNEITNSETSDITPTSSSLYPSLYPGIEVKQIIPLLIEDRDYW 1793

Query: 1056 TSVAEVYFPTIYIDSLSALISDPNSTLYSNPKKNFATLASLIDKAIPLTSLRK----NDG 1111
             +  +VY P   +D L A I D +S LY NP      L++ ID +IP+    K     DG
Sbjct: 1794 VAGVQVYVPNNVVDQLQAYIYDLDSILYHNPVYIARELSNFIDSSIPIVGSGKYWTAYDG 1853

Query: 1112 QXXXXXXXXXXXXXXXXXG-------DDAFQNAEEYL-RVSGAMDLSNIKVSKVNHTIRN 1163
                              G       DDA QN    + +  G +D   I +SK      +
Sbjct: 1854 NPNEENELNTSSNSEDTNGSDVEPNSDDASQNTNSLVYQDMGTLDTGTI-LSKKTTLETS 1912

Query: 1164 RIIVFLFTLTTGVFLWIS-TFLIIFRITNKSRKLKDSNLKKGSLPLYQQNPYRENKQFSA 1222
            +  +++  +   +F +IS  F I+F +T      +   + K   P  +  P ++    ++
Sbjct: 1913 KAWIYIVAM---IFGFISLLFSILFSMTFMKFSYQFEFITKIIRPTEKIWPTKDASIGAS 1969

Query: 1223 ES--SESYIDIHYTTEKYSDYSASSPPIGE-NIIVDSAQGIQYKVDNEGNYYYNGN 1275
             +  +++ + I +T          SP I +  I+ D+  G+ Y VD EGNYYY+ N
Sbjct: 1970 HALKNKNILPIVHTPIMEKGEIFPSPSINDCEIVYDNNNGLAYTVDKEGNYYYHHN 2025

>Skud_7.299 Chr7 (520447..523956) [3510 bp, 1169 aa] {ON} YGR014W
            (REAL)
          Length = 1169

 Score = 80.1 bits (196), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 61/224 (27%), Positives = 97/224 (43%), Gaps = 68/224 (30%)

Query: 888  WLPTNIIIASNADSTHTARA---ESTASLPAAIAPAEELQSPPDFELITIGFLSGLNYAF 944
            W+PT +I  +   ++  + A     T +LP A+A A ++     + LIT+GF   LNY F
Sbjct: 823  WIPTELITQAPETASTISSAIGGTQTMTLPQAVAAATQIPESEGYSLITVGFKKPLNYEF 882

Query: 945  LVGNPLSSAQVFDFLPHVLFFPIEDAAEKSKAIQPQSSDITTTLVAPLRKNRKTVTDMTR 1004
            +V  P SSAQ+F +LP  L  P ++            ++IT   + PL+ +         
Sbjct: 883  VVSEPKSSAQIFGYLPAALNTPFKNVF----------TNITVLQIVPLQDD--------- 923

Query: 1005 ANVVNQNEATSSSLNLAVSSEATGSNDVELIFKNIRVKQIIPLVIEGNDYITSVAEVYFP 1064
                        SLN  +                                  SVAEVYFP
Sbjct: 924  ------------SLNYLI----------------------------------SVAEVYFP 937

Query: 1065 TIYIDSLSALISDPNSTLYSNPKKNFATLASLIDKAIPLTSLRK 1108
            T  ++ LS LI + +ST Y++      ++A+++D +IPLT L +
Sbjct: 938  TAEVEELSNLIMNTSSTFYTDGTGTAKSMAAMVDPSIPLTGLLR 981

>ZYRO0G11242g Chr7 (900370..904833) [4464 bp, 1487 aa] {ON} weakly
            similar to uniprot|P32334 Saccharomyces cerevisiae
            YGR014W MSB2 Mucin family member at the head of the
            Cdc42p- and MAP kinase-dependent filamentous growth
            signaling pathway also functions as an osmosensor in
            parallel to the Sho1p-mediated pathway potential Cdc28p
            substrate
          Length = 1487

 Score = 79.7 bits (195), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 41/92 (44%), Positives = 60/92 (65%), Gaps = 1/92 (1%)

Query: 879  SGSDSTDTVWLPTNIIIASNADSTHTA-RAESTASLPAAIAPAEELQSPPDFELITIGFL 937
            S S + D  W+PT II     ++T ++  +++TA+LP AIA A +   P  + L+TIGF 
Sbjct: 1150 SSSTTNDNWWVPTKIITQPAPNTTASSTSSQATATLPQAIAAATQQVRPKGYSLLTIGFK 1209

Query: 938  SGLNYAFLVGNPLSSAQVFDFLPHVLFFPIED 969
            S LNY FL+ +PLSSAQ+F FLP +L  P ++
Sbjct: 1210 SALNYNFLISSPLSSAQIFAFLPSILNDPFQN 1241

 Score = 70.5 bits (171), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 48/71 (67%)

Query: 1036 FKNIRVKQIIPLVIEGNDYITSVAEVYFPTIYIDSLSALISDPNSTLYSNPKKNFATLAS 1095
            F N+ + QI+PL  E  DY+ +VAEVYFPT +I  L++LI++  S+LY++   +   LA 
Sbjct: 1243 FNNVSIYQIVPLKSESLDYLATVAEVYFPTKHISDLNSLITNNASSLYTDAHGSAKYLAE 1302

Query: 1096 LIDKAIPLTSL 1106
            LID  IPLT L
Sbjct: 1303 LIDPTIPLTGL 1313

>SAKL0H23188g Chr8 (2009677..2013465) [3789 bp, 1262 aa] {ON} some
           similarities with uniprot|P08640 Saccharomyces
           cerevisiae YIR019C MUC1 GPI-anchored cell surface
           glycoprotein required for diploid pseudohyphal formation
           and haploid invasive growth transcriptionally regulated
           by the MAPK pathway (via Ste12p and Tec1p) and the cAMP
           pathway (via Flo8p)
          Length = 1262

 Score = 75.9 bits (185), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 38/89 (42%), Positives = 53/89 (59%), Gaps = 9/89 (10%)

Query: 888 WLPTNIIIASNADSTHTARAE---------STASLPAAIAPAEELQSPPDFELITIGFLS 938
           WLPT +++ S A     A A          +T +LP AIA A ++  P  + LITIGF  
Sbjct: 902 WLPTAMLVESTATDNGQANAGGSGTGISTLATQTLPQAIAAATQVSQPDGYTLITIGFKK 961

Query: 939 GLNYAFLVGNPLSSAQVFDFLPHVLFFPI 967
            LNY F+V +P+SSAQ+F +LP+VL +P 
Sbjct: 962 SLNYPFVVSHPVSSAQLFSYLPNVLNYPF 990

 Score = 62.4 bits (150), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 45/71 (63%)

Query: 1036 FKNIRVKQIIPLVIEGNDYITSVAEVYFPTIYIDSLSALISDPNSTLYSNPKKNFATLAS 1095
            F +++V Q++PL     DY+ +VA+VYFP+  ++ L  LIS+  + LY N      +LAS
Sbjct: 994  FSDVQVYQLVPLKSSSRDYLITVAKVYFPSEQVEVLQKLISNTAANLYFNSNPTEKSLAS 1053

Query: 1096 LIDKAIPLTSL 1106
            LID  IPLT +
Sbjct: 1054 LIDPTIPLTGI 1064

>AGR019C Chr7 complement(747644..750961) [3318 bp, 1105 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YGR014W
            (MSB2)
          Length = 1105

 Score = 73.9 bits (180), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 61/231 (26%), Positives = 90/231 (38%), Gaps = 77/231 (33%)

Query: 888  WLPTNIIIASNADSTHTARAESTAS------------LPAAIAPAEELQSPPDFELITIG 935
            WLPT II A+  +   T   ++T S            LP  IA  + +    D+ LITIG
Sbjct: 757  WLPTVIITATEQEVVSTESPQNTQSKPKPTATPNIQTLPQVIAAPDRVTPKKDYTLITIG 816

Query: 936  FLSGLNYAFLVGNPLSSAQVFDFLPHVLFFPIEDAAEKSKAIQPQSSDITTTLVAPLRKN 995
            F   LNY F+  NP ++AQ+FD+LP +L +P             + +DI+   + PL+ N
Sbjct: 817  FKKQLNYPFIAMNPFANAQIFDYLPGILNYPFNF----------EYADISVIQLVPLKAN 866

Query: 996  RKTVTDMTRANVVNQNEATSSSLNLAVSSEATGSNDVELIFKNIRVKQIIPLVIEGNDYI 1055
             K                               +   ++ F + +V ++  LV+      
Sbjct: 867  SKDYI----------------------------ATIAQVYFPSEKVDELAKLVV------ 892

Query: 1056 TSVAEVYFPTIYIDSLSALISDPNSTLYSNPKKNFATLASLIDKAIPLTSL 1106
                                 D NS LYS+   N    ASLID  +PLT L
Sbjct: 893  ---------------------DTNSELYSSYDANMKVFASLIDPQLPLTGL 922

>NCAS0A05230 Chr1 (1034523..1036880) [2358 bp, 785 aa] {ON}
           Anc_4.150
          Length = 785

 Score = 73.6 bits (179), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 41/111 (36%), Positives = 61/111 (54%), Gaps = 11/111 (9%)

Query: 885 DTVWLPTNIIIAS-NADSTHTARAESTASLPAAIAPAEELQSPPDFELITIGFLSGLNYA 943
           D  W+PT +I AS     +    + +T +LP  I  A  + +P  + +ITIGF   LNY 
Sbjct: 449 DNWWIPTQLITASTQVTGSAMVSSAATKTLPQVIGAATSVPTPEGYTVITIGFKEALNYE 508

Query: 944 FLVGNPLSSAQVFDFLPHVLFFPIEDAAEKSKAIQPQSSDITTTLVAPLRK 994
           F+V +P SSAQ+F FLP+VL  P +D  +          +IT + + PL+K
Sbjct: 509 FIVSSPKSSAQIFSFLPYVLNTPFDDIYD----------NITVSRLVPLQK 549

 Score = 55.8 bits (133), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 43/72 (59%)

Query: 1035 IFKNIRVKQIIPLVIEGNDYITSVAEVYFPTIYIDSLSALISDPNSTLYSNPKKNFATLA 1094
            I+ NI V +++PL  +   Y  +VAEV FP   I +LS  I D NS+LY+       +LA
Sbjct: 535  IYDNITVSRLVPLQKKDIGYFITVAEVLFPESAIANLSVYIKDTNSSLYTKNDDALRSLA 594

Query: 1095 SLIDKAIPLTSL 1106
             LID +IPLT L
Sbjct: 595  LLIDPSIPLTGL 606

>KLLA0C17985g Chr3 complement(1596320..1599046) [2727 bp, 908 aa]
           {ON} some similarities with uniprot|P32334 Saccharomyces
           cerevisiae YGR014W MSB2 Mucin family member at the head
           of the Cdc42p- and MAP kinase-dependent filamentous
           growth signaling pathway also functions as an osmosensor
           in parallel to the Sho1p-mediated pathway potential
           Cdc28p substrate
          Length = 908

 Score = 73.2 bits (178), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 64/120 (53%), Gaps = 7/120 (5%)

Query: 855 GSVGVVQTPNPLGGSSILNPASPTSGSDSTDTVWLPTNII----IASNADSTHTARAEST 910
           GS  VV T  P+          P S   +T  VWLPT ++     +    ++ T+   +T
Sbjct: 505 GSTSVVSTVEPVVSLPSTTTEQPVS---TTQQVWLPTTMVAEFETSGTQSTSTTSSKIAT 561

Query: 911 ASLPAAIAPAEELQSPPDFELITIGFLSGLNYAFLVGNPLSSAQVFDFLPHVLFFPIEDA 970
            +LP AI  A E+  P  + LIT+GF   LNY F V NP+S+AQ+F+FLP VL +P   A
Sbjct: 562 ETLPQAITAATEIVQPAGYTLITVGFKKELNYPFTVNNPVSNAQIFEFLPKVLNYPFNGA 621

 Score = 55.8 bits (133), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 43/71 (60%)

Query: 1036 FKNIRVKQIIPLVIEGNDYITSVAEVYFPTIYIDSLSALISDPNSTLYSNPKKNFATLAS 1095
            F N  V +++PL +   DY+ +VA+VYFP   + +L A I + +S +Y+N       L+S
Sbjct: 624  FDNTSVLELVPLKVTSLDYLVTVAKVYFPEDSVSTLQAQILNSSSVIYNNDVTALKQLSS 683

Query: 1096 LIDKAIPLTSL 1106
             ID +IPLT L
Sbjct: 684  YIDASIPLTGL 694

>KNAG0D03590 Chr4 (657513..660497) [2985 bp, 994 aa] {ON} Anc_4.150
            YGR014W
          Length = 994

 Score = 72.8 bits (177), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 49/78 (62%)

Query: 1035 IFKNIRVKQIIPLVIEGNDYITSVAEVYFPTIYIDSLSALISDPNSTLYSNPKKNFATLA 1094
            IF NI V Q++PL      Y  +VAEVYFPT  I +LS L+ D +S LY+   ++  TLA
Sbjct: 733  IFSNISVLQLVPLQDSSISYYVTVAEVYFPTAEITNLSQLVKDTSSILYTEVSESLKTLA 792

Query: 1095 SLIDKAIPLTSLRKNDGQ 1112
             +ID +IP+T L KN  Q
Sbjct: 793  DMIDPSIPITGLVKNATQ 810

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 62/131 (47%), Gaps = 19/131 (14%)

Query: 855 GSVGVVQTPNPLGGSSILNPASPTSGS-------------DSTDT-VWLPTNII-----I 895
           GSV  V T NP+   S      P + +             ++TD+  W+PT ++     +
Sbjct: 599 GSVAPVSTSNPVPTQSTTTLVGPMTSALPSSISSSVNSTSETTDSDWWIPTRLLTETAAV 658

Query: 896 ASNADSTHTARAESTASLPAAIAPAEELQSPPDFELITIGFLSGLNYAFLVGNPLSSAQV 955
            + +++  T    +T  +P  I    ++     + LITIGF   L+Y F+V  P SSAQ+
Sbjct: 659 ETASNTVSTLSPSATKYMPQVIMAPGDVTVAEGYTLITIGFKKPLHYEFVVTQPKSSAQI 718

Query: 956 FDFLPHVLFFP 966
             FLP++L  P
Sbjct: 719 ISFLPNLLNQP 729

>Ecym_7349 Chr7 complement(722484..725873) [3390 bp, 1129 aa] {ON}
           similar to Ashbya gossypii AGR019C
          Length = 1129

 Score = 70.9 bits (172), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 54/100 (54%), Gaps = 13/100 (13%)

Query: 880 GSDSTDTVWLPTNIIIASNADSTHTARAESTASLPAAIAPAEELQSPPDF---------- 929
           G  +  + WLPT I+  S+ADS  T     T + P     +  +Q+ P F          
Sbjct: 768 GPHTPTSTWLPTAILTESDADSEPTVTVTDTETKPTTSMASTAIQTLPKFISSANGKIPE 827

Query: 930 ---ELITIGFLSGLNYAFLVGNPLSSAQVFDFLPHVLFFP 966
               LIT+GF   LNY F+V NP+SSAQ+FDFLP+VL +P
Sbjct: 828 GNYTLITVGFKRRLNYPFVVSNPVSSAQIFDFLPNVLNYP 867

 Score = 63.2 bits (152), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 47/69 (68%)

Query: 1038 NIRVKQIIPLVIEGNDYITSVAEVYFPTIYIDSLSALISDPNSTLYSNPKKNFATLASLI 1097
            N+ V +++PL     DY+ +VA V+FPT ++D L+ L++D  S+LYS+  +   T+ASLI
Sbjct: 874  NVSVWRLLPLKSGSRDYLVTVAAVFFPTEHLDELARLVADNTSSLYSSYDETGKTMASLI 933

Query: 1098 DKAIPLTSL 1106
            D  IPLT +
Sbjct: 934  DPMIPLTGI 942

>NDAI0K02580 Chr11 complement(574995..577952) [2958 bp, 985 aa] {ON}
           Anc_4.150
          Length = 985

 Score = 70.9 bits (172), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/105 (43%), Positives = 59/105 (56%), Gaps = 7/105 (6%)

Query: 869 SSILNPA---SPTSGSDSTDT-VWLPTNIIIASNADSTHTARAES---TASLPAAIAPAE 921
           SS ++P+   +PT    S+DT  W+PT +I  SN  S   +   S   T +LP  IA   
Sbjct: 583 SSFISPSVTTTPTQTRASSDTNWWIPTVLITQSNQPSESASVPTSNTATKTLPQVIAVGT 642

Query: 922 ELQSPPDFELITIGFLSGLNYAFLVGNPLSSAQVFDFLPHVLFFP 966
            +  P  + LITIGF   LNY F+V NP SSAQ+F FLP VL  P
Sbjct: 643 TIPEPEGYSLITIGFKKPLNYEFIVANPKSSAQIFSFLPDVLNAP 687

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 46/73 (63%), Gaps = 2/73 (2%)

Query: 1036 FKNIRVKQIIPLVIEGNDYITSVAEVYFPTIYIDSLSALISD--PNSTLYSNPKKNFATL 1093
            F NI V Q++PL     +Y+ +VA+VYFPT  ID+LS+LI D    S +Y+  +    +L
Sbjct: 692  FNNITVLQLVPLQNPSLNYLVTVAKVYFPTDMIDTLSSLIEDYTTPSLIYTINQGAKGSL 751

Query: 1094 ASLIDKAIPLTSL 1106
            A+LI   IPLT L
Sbjct: 752  ANLISSDIPLTGL 764

>TBLA0G01210 Chr7 (321555..327032) [5478 bp, 1825 aa] {ON} Anc_4.150
            YGR014W
          Length = 1825

 Score = 70.9 bits (172), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 52/81 (64%), Gaps = 4/81 (4%)

Query: 888  WLPTNIIIASNADSTHTARAESTASLPAAIAPAEELQSPPDFELITIGFLSGLNYAFLVG 947
            W+PT++ +AS  +ST T+    T ++P AI   E+  +P +  LITIGF   LNY F+V 
Sbjct: 1498 WIPTSLAVASTMNSTDTSTLP-TQAIPQAIGSVEQPPAPENHSLITIGFKKELNYEFVVS 1556

Query: 948  NPLSSAQVFDFLPHVL---FF 965
            +P+S AQ+ ++LP+ L   FF
Sbjct: 1557 HPMSGAQIINYLPNTLVNAFF 1577

 Score = 53.9 bits (128), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 41/69 (59%)

Query: 1038 NIRVKQIIPLVIEGNDYITSVAEVYFPTIYIDSLSALISDPNSTLYSNPKKNFATLASLI 1097
            NI V  ++P     +DY+ ++A VYFPT  I  L  LI D +S+ Y+  +     LA+L+
Sbjct: 1582 NISVNNLVPYNDTKSDYLITIATVYFPTDEIKHLRELIHDKSSSFYTASQDVARQLANLV 1641

Query: 1098 DKAIPLTSL 1106
            D +IPLT L
Sbjct: 1642 DPSIPLTGL 1650

>TPHA0K01390 Chr11 complement(287666..290146) [2481 bp, 826 aa] {ON}
           Anc_4.150 YGR014W
          Length = 826

 Score = 69.3 bits (168), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 58/101 (57%), Gaps = 3/101 (2%)

Query: 880 GSDSTDTVWLPTNIIIASNA--DSTHTARAESTASL-PAAIAPAEELQSPPDFELITIGF 936
            S+++   W+PT II  S+   +S  + +  ST  + P AIA    +  P  + LITIGF
Sbjct: 480 ASNTSSNWWVPTRIITESDKTQNSVSSTQTVSTTRIKPKAIAAPTTIPVPSGYTLITIGF 539

Query: 937 LSGLNYAFLVGNPLSSAQVFDFLPHVLFFPIEDAAEKSKAI 977
              LNY F++ NP+SSAQ+F FLP  L  P + A + S +I
Sbjct: 540 KEALNYDFVLDNPVSSAQIFAFLPEALDLPFQFANDSSVSI 580

 Score = 54.7 bits (130), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 47/83 (56%), Gaps = 3/83 (3%)

Query: 1031 DVELIFKN---IRVKQIIPLVIEGNDYITSVAEVYFPTIYIDSLSALISDPNSTLYSNPK 1087
            D+   F N   + + +++P  +   +Y   VAEVYFP+  ID LS+LI D +S LY+   
Sbjct: 567  DLPFQFANDSSVSILKLVPYSLSNYNYTVLVAEVYFPSDSIDELSSLIKDSDSPLYTLNT 626

Query: 1088 KNFATLASLIDKAIPLTSLRKND 1110
             +   L +LID+ IPLT L   D
Sbjct: 627  GSRLALVNLIDQNIPLTGLVNLD 649

>Suva_7.296 Chr7 (508904..512311) [3408 bp, 1135 aa] {ON} YGR014W
            (REAL)
          Length = 1135

 Score = 68.9 bits (167), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 51/72 (70%)

Query: 1035 IFKNIRVKQIIPLVIEGNDYITSVAEVYFPTIYIDSLSALISDPNSTLYSNPKKNFATLA 1094
            +F NI V QI+PL  +   Y+ SVAEVYFPT  I++LS+LI++ +S+ Y++      ++A
Sbjct: 875  VFTNISVLQIVPLQDDLFSYLVSVAEVYFPTAEIETLSSLITNTSSSFYTDGMGTAKSMA 934

Query: 1095 SLIDKAIPLTSL 1106
            +++D +IPLT L
Sbjct: 935  AMVDASIPLTGL 946

 Score = 68.2 bits (165), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 57/115 (49%), Gaps = 19/115 (16%)

Query: 888 WLPTNIIIASNADSTHTARAESTAS----------LPAAIAPAEELQSPPDFELITIGFL 937
           W+PT +I       T    A S+AS          LP AIA A ++  P  + LITIGF 
Sbjct: 790 WIPTQLI-------TQETEAASSASTTTGGTQTMTLPHAIAAATQIAEPDGYSLITIGFK 842

Query: 938 SGLNYAFLVGNPLSSAQVFDFLPHVLFFPIEDAAEKSKAIQ--PQSSDITTTLVA 990
             LNY F+V  P SSAQ+F +LP  L  P +D       +Q  P   D+ + LV+
Sbjct: 843 KALNYEFVVSEPKSSAQIFAYLPEALNTPFKDVFTNISVLQIVPLQDDLFSYLVS 897

>Smik_7.302 Chr7 (508666..512235) [3570 bp, 1189 aa] {ON} YGR014W
            (REAL)
          Length = 1189

 Score = 68.6 bits (166), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 51/75 (68%)

Query: 1035 IFKNIRVKQIIPLVIEGNDYITSVAEVYFPTIYIDSLSALISDPNSTLYSNPKKNFATLA 1094
            +F NI V QI+PL  +   Y+ SVAEVYFPT  ++ LS LI++ +ST Y++      ++A
Sbjct: 927  VFTNISVLQIVPLQDDSLSYLVSVAEVYFPTAELEELSNLITNTSSTFYTSGTGTAKSMA 986

Query: 1095 SLIDKAIPLTSLRKN 1109
            +++D +IPLT L ++
Sbjct: 987  AMVDPSIPLTGLLRD 1001

 Score = 64.3 bits (155), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/120 (35%), Positives = 67/120 (55%), Gaps = 11/120 (9%)

Query: 860 VQTPNPLGGSSILNPASPTSGSDSTDTV-------WLPTNIIIAS---NADSTHTARAES 909
           VQT      +++L P S T+G+D+  +V       W+PT +I  +    + ++ TA    
Sbjct: 808 VQTSLTAESTTVLQP-STTNGTDNYSSVTSSDNNWWIPTELITQAPEAASTASSTASGTQ 866

Query: 910 TASLPAAIAPAEELQSPPDFELITIGFLSGLNYAFLVGNPLSSAQVFDFLPHVLFFPIED 969
           T +LP AIA A ++ +   + LIT+GF   LNY F+V  P SSAQ+F +LP  L  P ++
Sbjct: 867 TMTLPHAIAAATQIPASEGYSLITVGFKRALNYEFVVSEPKSSAQIFGYLPEALNTPFKN 926

>KAFR0F03470 Chr6 (689705..692554) [2850 bp, 949 aa] {ON} Anc_4.150
           YGR014W
          Length = 949

 Score = 65.1 bits (157), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 60/104 (57%), Gaps = 2/104 (1%)

Query: 869 SSILNPASPTSGSDSTDTVWLPTNIIIASN--ADSTHTARAESTASLPAAIAPAEELQSP 926
           SSI    S T+ S S    W+ ++++ AS   + +T  +   +T SLP AIA   E+ +P
Sbjct: 572 SSITLVTSATTTSHSNPNWWVASDLMTASEEASTTTRASATTATGSLPQAIAAPTEVTAP 631

Query: 927 PDFELITIGFLSGLNYAFLVGNPLSSAQVFDFLPHVLFFPIEDA 970
            D+ LITIGF   LNY F+V  P SSAQ+F +LP  L  P  ++
Sbjct: 632 DDYSLITIGFKKALNYEFVVNTPESSAQLFSYLPIALNTPFNNS 675

 Score = 60.1 bits (144), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 42/71 (59%)

Query: 1036 FKNIRVKQIIPLVIEGNDYITSVAEVYFPTIYIDSLSALISDPNSTLYSNPKKNFATLAS 1095
            F NI V QI+PLV    +Y  +VAEVYFP   I SL  +I D +S L++       TL S
Sbjct: 676  FTNISVYQIVPLVESSLNYYITVAEVYFPEQEIASLQQMIKDNSSALFTENVGAPKTLVS 735

Query: 1096 LIDKAIPLTSL 1106
            LID +IPL  L
Sbjct: 736  LIDPSIPLVGL 746

>Kpol_1062.37 s1062 complement(78801..81722) [2922 bp, 973 aa] {ON}
           complement(78801..81722) [2922 nt, 974 aa]
          Length = 973

 Score = 64.7 bits (156), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/84 (41%), Positives = 51/84 (60%), Gaps = 2/84 (2%)

Query: 888 WLPTNIIIASNA-DSTHTARAES-TASLPAAIAPAEELQSPPDFELITIGFLSGLNYAFL 945
           W+PT++I  S+  DS  T R  S T S+P AIA + +  +P    L+TIGF   LNY F+
Sbjct: 643 WVPTSLITESDVTDSAVTTRTLSATKSVPLAIAASTQTATPEGCSLVTIGFKEALNYQFV 702

Query: 946 VGNPLSSAQVFDFLPHVLFFPIED 969
           + + ++ AQ+F FLP  L  P E+
Sbjct: 703 LSSSVTVAQIFAFLPGGLIAPFEE 726

 Score = 55.8 bits (133), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 40/71 (56%)

Query: 1036 FKNIRVKQIIPLVIEGNDYITSVAEVYFPTIYIDSLSALISDPNSTLYSNPKKNFATLAS 1095
              N+ V ++ PL     +Y  +VAEVYFPT  ID L+A ++D  S LY N       L S
Sbjct: 728  LANVTVYRLSPLNYGNFNYTLTVAEVYFPTSKIDELAAFVADSESALYVNASGTEEELVS 787

Query: 1096 LIDKAIPLTSL 1106
            LID  IP+T L
Sbjct: 788  LIDPRIPITGL 798

>CAGL0F08833g Chr6 (873849..876659) [2811 bp, 936 aa] {ON} weakly
            similar to uniprot|P32334 Saccharomyces cerevisiae
            YGR014w MSB2 multicopy suppressor of a CDC24 bud
            emergence defect
          Length = 936

 Score = 56.2 bits (134), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 51/75 (68%), Gaps = 1/75 (1%)

Query: 1033 ELIFKNIRVKQIIPLVIEGNDYITSVAEVYFPTIYIDSLSALISDPNSTLYSNPKKNFA- 1091
            E IF +I+  Q++PL I+ + Y+++VA ++FPT  I SLS ++ + +S+LYS   +    
Sbjct: 677  ESIFSDIKTVQLMPLEIQDSGYLSTVALLFFPTSEIQSLSNMVKNTSSSLYSTQYETITQ 736

Query: 1092 TLASLIDKAIPLTSL 1106
            +L++LID  IP+T L
Sbjct: 737  SLSALIDPRIPVTGL 751

 Score = 52.8 bits (125), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 50/82 (60%), Gaps = 6/82 (7%)

Query: 888 WLPTNIIIA---SNADSTHTARAEST--ASLPAAIAPAEELQSPPD-FELITIGFLSGLN 941
           W+PT++IIA   + ++ST T   + T  +SLP  I  +   +S P+ + +ITIGF   LN
Sbjct: 591 WIPTSLIIAPTETESESTPTESNDGTQLSSLPKVIYGSAYSESVPEGYSVITIGFKKPLN 650

Query: 942 YAFLVGNPLSSAQVFDFLPHVL 963
           Y F+V    SSAQ+  +LP +L
Sbjct: 651 YPFVVSESKSSAQIMYYLPKLL 672

>Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR124C
           (UBP2) - Ubiquitin-specific protease [contig 130] FULL
          Length = 1233

 Score = 35.8 bits (81), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 124 QQTSPTDINIQSNTAHGQTTQTVESLWPAHSDTTTINTDTREHTSTN-VVPTDPAV 178
           ++ S  D+ +   TA G+ ++ V+ L PA S+T  + T   E T  N V+ T+P V
Sbjct: 819 KENSENDVEVIDLTAEGEASEDVDMLKPAESETQVVTTQLNEDTVMNDVIATEPMV 874

>TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_7.86
            YAL017W
          Length = 1262

 Score = 34.3 bits (77), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 27/46 (58%)

Query: 1323 ESGRRINRPHSPYLSGAVKDPPFTFNRPSNDRNVTYSDSLGLKYNA 1368
            E+ R IN   +  L  ++ +P F +N+P NDR+++  D +G+   A
Sbjct: 331  ENARSINSNLNKALLDSLAEPFFVYNQPCNDRSISSFDDVGVSLQA 376

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.123    0.336 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 116,865,569
Number of extensions: 5107220
Number of successful extensions: 32767
Number of sequences better than 10.0: 818
Number of HSP's gapped: 30420
Number of HSP's successfully gapped: 2636
Length of query: 1530
Length of database: 53,481,399
Length adjustment: 123
Effective length of query: 1407
Effective length of database: 39,377,481
Effective search space: 55404115767
Effective search space used: 55404115767
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 73 (32.7 bits)