Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0C032405.526ON32432416630.0
Ecym_40615.526ON663731159e-06
KLLA0A01782g5.526ON528551052e-04
Kwal_47.186465.526ON635551052e-04
Suva_13.1565.526ON772591043e-04
Skud_13.1485.526ON779591015e-04
NDAI0H015905.526ON37153997e-04
YML006C (GIS4)5.526ON77457990.001
Smik_13.1455.526ON77457980.001
NCAS0F010805.526ON37966970.001
ZYRO0D12540g5.526ON54868960.002
SAKL0G04906g5.526ON60855960.002
KLTH0G03740g5.526ON63158920.006
CAGL0K07271g5.526ON77653920.007
KNAG0B037105.526ON71155910.009
KAFR0C053905.526ON45557900.012
TDEL0A039005.526ON67153880.019
ADR198C5.526ON54958870.023
NDAI0C010705.526ON75746870.031
TBLA0D016605.526ON86639830.081
NCAS0H025505.526ON74346810.13
YIR021W (MRS1)2.647ON36345780.25
TPHA0K005405.526ON67537780.36
Kpol_1023.995.526ON55153760.50
Skud_4.2403.186ON61993760.57
Smik_9.2252.647ON36345740.77
Kpol_1071.57.62ON44274702.9
NOTE: 1 genes in the same pillar as KNAG0C03240 were not hit in these BLAST results
LIST: TBLA0G00940

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0C03240
         (324 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0C03240 Chr3 complement(634593..635567) [975 bp, 324 aa] {ON}     645   0.0  
Ecym_4061 Chr4 (133342..135333) [1992 bp, 663 aa] {ON} similar t...    49   9e-06
KLLA0A01782g Chr1 complement(157216..158802) [1587 bp, 528 aa] {...    45   2e-04
Kwal_47.18646 s47 complement(909622..911529) [1908 bp, 635 aa] {...    45   2e-04
Suva_13.156 Chr13 complement(246662..248980) [2319 bp, 772 aa] {...    45   3e-04
Skud_13.148 Chr13 complement(242351..244690) [2340 bp, 779 aa] {...    44   5e-04
NDAI0H01590 Chr8 (385963..387078) [1116 bp, 371 aa] {ON}               43   7e-04
YML006C Chr13 complement(256092..258416) [2325 bp, 774 aa] {ON} ...    43   0.001
Smik_13.145 Chr13 complement(244766..247090) [2325 bp, 774 aa] {...    42   0.001
NCAS0F01080 Chr6 (214243..215382) [1140 bp, 379 aa] {ON} Anc_5.5...    42   0.001
ZYRO0D12540g Chr4 (1059795..1061441) [1647 bp, 548 aa] {ON} some...    42   0.002
SAKL0G04906g Chr7 (403654..405480) [1827 bp, 608 aa] {ON} some s...    42   0.002
KLTH0G03740g Chr7 (295985..297880) [1896 bp, 631 aa] {ON} simila...    40   0.006
CAGL0K07271g Chr11 complement(712294..714624) [2331 bp, 776 aa] ...    40   0.007
KNAG0B03710 Chr2 complement(710003..712138) [2136 bp, 711 aa] {O...    40   0.009
KAFR0C05390 Chr3 (1080797..1082164) [1368 bp, 455 aa] {ON} Anc_5...    39   0.012
TDEL0A03900 Chr1 (698940..700955) [2016 bp, 671 aa] {ON} Anc_5.5...    39   0.019
ADR198C Chr4 complement(1046482..1048131) [1650 bp, 549 aa] {ON}...    38   0.023
NDAI0C01070 Chr3 complement(209024..211297) [2274 bp, 757 aa] {O...    38   0.031
TBLA0D01660 Chr4 complement(409692..412292) [2601 bp, 866 aa] {O...    37   0.081
NCAS0H02550 Chr8 (506755..508986) [2232 bp, 743 aa] {ON} Anc_5.5...    36   0.13 
YIR021W Chr9 (397294..398385) [1092 bp, 363 aa] {ON}  MRS1Protei...    35   0.25 
TPHA0K00540 Chr11 complement(107389..109416) [2028 bp, 675 aa] {...    35   0.36 
Kpol_1023.99 s1023 complement(232194..233849) [1656 bp, 551 aa] ...    34   0.50 
Skud_4.240 Chr4 (423826..425685) [1860 bp, 619 aa] {ON} YDL013W ...    34   0.57 
Smik_9.225 Chr9 (370773..371864) [1092 bp, 363 aa] {ON} YIR021W ...    33   0.77 
Kpol_1071.5 s1071 (10336..11664) [1329 bp, 442 aa] {ON} (10336.....    32   2.9  

>KNAG0C03240 Chr3 complement(634593..635567) [975 bp, 324 aa] {ON} 
          Length = 324

 Score =  645 bits (1663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/324 (95%), Positives = 311/324 (95%)

Query: 1   MMHYMNYVVGKNQCRESNNFWFWYIDNLVAGNFEELNDNLIKRNQLCSFLAHYFGGKQTT 60
           MMHYMNYVVGKNQCRESNNFWFWYIDNLVAGNFEELNDNLIKRNQLCSFLAHYFGGKQTT
Sbjct: 1   MMHYMNYVVGKNQCRESNNFWFWYIDNLVAGNFEELNDNLIKRNQLCSFLAHYFGGKQTT 60

Query: 61  KLQRRLLLVTSPYGLRNGSLDEHLSKKLLSSTFGTSIDEFLTFHGHNGWLTIFPISNSDE 120
           KLQRRLLLVTSPYGLRNGSLDEHLSKKLLSSTFGTSIDEFLTFHGHNGWLTIFPISNSDE
Sbjct: 61  KLQRRLLLVTSPYGLRNGSLDEHLSKKLLSSTFGTSIDEFLTFHGHNGWLTIFPISNSDE 120

Query: 121 KLYEFYKQDLYCMGYLMEECERGIISTPEFGWLSKTENAEEEDCSDYEDELEGLTINFAK 180
           KLYEFYKQDLYCMGYLMEECERGIISTPEFGWLSKTENAEEEDCSDYEDELEGLTINFAK
Sbjct: 121 KLYEFYKQDLYCMGYLMEECERGIISTPEFGWLSKTENAEEEDCSDYEDELEGLTINFAK 180

Query: 181 QFKQNICENAFAVNPIXXXXXXXXXXXXXKSFESYEDSFEIGYCHEERDCSCRALRHYPL 240
           QFKQNICENAFAVNPI             KSFESYEDSFEIGYCHEERDCSCRALRHYPL
Sbjct: 181 QFKQNICENAFAVNPILRTLTDTSDTLSLKSFESYEDSFEIGYCHEERDCSCRALRHYPL 240

Query: 241 HRVQARVNHVDNYNRDLTINVVSLLGKDDASGKLWHAVRQLQDDDWVIYDADFSLNNLEN 300
           HRVQARVNHVDNYNRDLTINVVSLLGKDDASGKLWHAVRQLQDDDWVIYDADFSLNNLEN
Sbjct: 241 HRVQARVNHVDNYNRDLTINVVSLLGKDDASGKLWHAVRQLQDDDWVIYDADFSLNNLEN 300

Query: 301 CKLEDILLNSDGACQTMVILCNLQ 324
           CKLEDILLNSDGACQTMVILCNLQ
Sbjct: 301 CKLEDILLNSDGACQTMVILCNLQ 324

>Ecym_4061 Chr4 (133342..135333) [1992 bp, 663 aa] {ON} similar to
          Ashbya gossypii ADR198C
          Length = 663

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 39/73 (53%), Gaps = 4/73 (5%)

Query: 18 NNFWFWYIDNLVAGNFEELNDNLIKRNQLCSFLAHYFGGKQTTKLQRRLLLVTSPYGLRN 77
          N  W WY+ NL  G FEEL+ +++K   +   +  Y GG  T     R+LLV+ P  +R 
Sbjct: 13 NGLWSWYLHNLRCGEFEELSSDIVKCRLMKRLVKEYSGG--TMSASNRVLLVSVPDDIRQ 70

Query: 78 GS--LDEHLSKKL 88
          G+  L+E L   L
Sbjct: 71 GASILEEFLRSSL 83

 Score = 33.5 bits (75), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 8/60 (13%)

Query: 256 DLTINVVSLLGKDDASGKLWHAVRQLQDD--------DWVIYDADFSLNNLENCKLEDIL 307
           D  I + S+L  +    +L  AVRQ  +D        DW++YD  FS+NN++   L DI 
Sbjct: 340 DFRIVLQSILIYNTTLDQLLTAVRQSNNDTTVADINDDWLLYDERFSMNNIQMVSLIDIF 399

>KLLA0A01782g Chr1 complement(157216..158802) [1587 bp, 528 aa]
          {ON} some similarities with uniprot|Q04233
          Saccharomyces cerevisiae YML006C GIS4 CAAX box
          containing protein of unknown function proposed to be
          involved in the RAS/cAMP signaling pathway
          Length = 528

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 18 NNFWFWYIDNLVAGNFEELNDNLIKRNQLCSFLAHYFGGKQTTKLQRRLLLVTSP 72
          N  W WY+ NL  G FEEL  N +K   L  FL   F  + T  L ++LLLV+ P
Sbjct: 16 NGLWSWYLSNLRNGEFEELTGNELKHGLLKRFLRDQF--QATGPLNKKLLLVSIP 68

 Score = 34.7 bits (78), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 31/53 (58%), Gaps = 8/53 (15%)

Query: 263 SLLGKDDASGKLWHAVRQLQDD--------DWVIYDADFSLNNLENCKLEDIL 307
           S+L  +  + +++  +RQ ++D        DW++YD DF+L NL+   L DIL
Sbjct: 295 SILITNKETEQIFTGIRQSENDRSNADINDDWLLYDTDFNLGNLQMLSLYDIL 347

>Kwal_47.18646 s47 complement(909622..911529) [1908 bp, 635 aa]
          {ON} YML006C (GIS4) - CAAX box containing protein
          [contig 191] FULL
          Length = 635

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 18 NNFWFWYIDNLVAGNFEELNDNLIKRNQLCSFLAHYFGGKQTTKLQRRLLLVTSP 72
          N  W WY+ NL  GNFEELN+N +K   L  FL       +T    ++LLLV+ P
Sbjct: 17 NGLWSWYLCNLRHGNFEELNNNQLKSALLRRFLNEQLMS-ETVPFNKKLLLVSIP 70

 Score = 37.0 bits (84), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 8/53 (15%)

Query: 263 SLLGKDDASGKLWHAVRQLQDD--------DWVIYDADFSLNNLENCKLEDIL 307
           S+L +   + +L+ AVRQ  +D        DW++YD  FS+NNL+   L D+L
Sbjct: 339 SILIQQTDTRQLYTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILALHDVL 391

>Suva_13.156 Chr13 complement(246662..248980) [2319 bp, 772 aa]
          {ON} YML006C (REAL)
          Length = 772

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 36/59 (61%), Gaps = 2/59 (3%)

Query: 16 ESNNFWFWYIDNLVAGNFEELNDNLIKRNQLCSFL-AHYFGGKQTT-KLQRRLLLVTSP 72
          + N  W WY+ NL  G+FEEL  N +K   L  FL +H++G   T+ +  +++LLV+ P
Sbjct: 14 DDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNTSIRPNKKILLVSIP 72

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 42/72 (58%), Gaps = 12/72 (16%)

Query: 263 SLLGKDDASGKLWHAVRQLQD--------DDWVIYDADFSLNNLENCKLEDILLNSDGAC 314
           S+L ++  + +++ A+RQ  +        DDW++YD++FS+NNL+   L+D+L       
Sbjct: 454 SILIQNPDTKEIFTAIRQSNNEPTVASVTDDWLLYDSNFSMNNLQILTLQDLLDIKRSFP 513

Query: 315 Q----TMVILCN 322
           +    TMVI+ N
Sbjct: 514 KILLYTMVIVTN 525

>Skud_13.148 Chr13 complement(242351..244690) [2340 bp, 779 aa]
          {ON} YML006C (REAL)
          Length = 779

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 36/59 (61%), Gaps = 2/59 (3%)

Query: 16 ESNNFWFWYIDNLVAGNFEELNDNLIKRNQLCSFL-AHYFGGKQTT-KLQRRLLLVTSP 72
          + N  W WY+ NL  G+FEEL  N +K   L  FL +H++G   T+ +  +++LLV+ P
Sbjct: 14 DDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDYNTSARPNKKILLVSIP 72

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 35/53 (66%), Gaps = 8/53 (15%)

Query: 263 SLLGKDDASGKLWHAVRQLQD--------DDWVIYDADFSLNNLENCKLEDIL 307
           S+L +D  + +++ A+RQ  +        DDW++YD++FS+NNL+   L+D+L
Sbjct: 462 SILIQDPDTKEIFTAIRQSNNKPTMASVTDDWLLYDSNFSMNNLQILTLQDLL 514

>NDAI0H01590 Chr8 (385963..387078) [1116 bp, 371 aa] {ON} 
          Length = 371

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 32/53 (60%), Gaps = 8/53 (15%)

Query: 263 SLLGKDDASGKLWHAVRQ--------LQDDDWVIYDADFSLNNLENCKLEDIL 307
           S++ K   + +L  A+RQ           D+W++YD+DFSLNNLE   L+DIL
Sbjct: 301 SIVFKSVRTAELLTAIRQSSADRIVATSSDEWLLYDSDFSLNNLEISTLQDIL 353

>YML006C Chr13 complement(256092..258416) [2325 bp, 774 aa] {ON}
          GIS4CAAX box containing protein of unknown function,
          proposed to be involved in the RAS/cAMP signaling
          pathway
          Length = 774

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 18 NNFWFWYIDNLVAGNFEELNDNLIKRNQLCSFL-AHYFGGKQ-TTKLQRRLLLVTSP 72
          N  W WY+ NL  G+FEEL  N +K   L  FL +H++G    + +  +++LLV+ P
Sbjct: 16 NGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNISARPNKKILLVSIP 72

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 42/72 (58%), Gaps = 12/72 (16%)

Query: 263 SLLGKDDASGKLWHAVRQLQD--------DDWVIYDADFSLNNLENCKLEDILLNSDGAC 314
           S+L +D  + +++ A+RQ  +        DDW++YD++FS+NNL+   L+D+L       
Sbjct: 455 SILIQDPDTKEIFTAIRQSNNKPTMASVTDDWLLYDSNFSMNNLQILTLQDLLDIKRSFP 514

Query: 315 Q----TMVILCN 322
           +    TMVI+ N
Sbjct: 515 KILFYTMVIVTN 526

>Smik_13.145 Chr13 complement(244766..247090) [2325 bp, 774 aa]
          {ON} YML006C (REAL)
          Length = 774

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 18 NNFWFWYIDNLVAGNFEELNDNLIKRNQLCSFL-AHYFGGKQ-TTKLQRRLLLVTSP 72
          N  W WY+ NL  G+FEEL  N +K   L  FL +H++G    + +  +++LLV+ P
Sbjct: 16 NGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNSISVRSNKKILLVSIP 72

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 35/53 (66%), Gaps = 8/53 (15%)

Query: 263 SLLGKDDASGKLWHAVRQLQD--------DDWVIYDADFSLNNLENCKLEDIL 307
           S+L +D  + +++ A+RQ  +        DDW++YD++FS+NNL+   L+D+L
Sbjct: 458 SILIQDPDTKEIFTAIRQSNNRPTIASVTDDWLLYDSNFSMNNLQILTLQDLL 510

>NCAS0F01080 Chr6 (214243..215382) [1140 bp, 379 aa] {ON} Anc_5.526
           YML006C
          Length = 379

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 41/66 (62%), Gaps = 10/66 (15%)

Query: 263 SLLGKDDASGKLWHAVRQLQDD--------DWVIYDADFSLNNLENCKLEDILLNSDGAC 314
           SLL ++  S + + A+RQ   D        +W++YD+ FSL+NLE   L+DILL++ G  
Sbjct: 308 SLLIQNAQSKETFTAIRQRSSDPNTANILDEWLLYDSKFSLDNLEMGTLQDILLSNKG-- 365

Query: 315 QTMVIL 320
            +M++L
Sbjct: 366 NSMLLL 371

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 3/63 (4%)

Query: 10 GKNQCRESNNFWFWYIDNLVAGNFEELNDNLIKRNQL-CSFLAHYFGGKQTTKLQRRLLL 68
           KN   + ++ W WY+ NL +GNFE L +  +++  L   F + +  G + +K  + LL 
Sbjct: 6  SKNYPDDIDDMWSWYLSNLQSGNFEALVNGSVRQQHLEAYFKSQFTSGNEGSK--KILLS 63

Query: 69 VTS 71
          V S
Sbjct: 64 VPS 66

>ZYRO0D12540g Chr4 (1059795..1061441) [1647 bp, 548 aa] {ON} some
          similarities with uniprot|Q04233 Saccharomyces
          cerevisiae YML006C GIS4 CAAX box containing protein of
          unknown function proposed to be involved in the
          RAS/cAMP signaling pathway
          Length = 548

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 33/68 (48%)

Query: 9  VGKNQCRESNNFWFWYIDNLVAGNFEELNDNLIKRNQLCSFLAHYFGGKQTTKLQRRLLL 68
          VG     + N  W WY+ N+  G+FEEL  N +K +    FL  Y       +   ++L+
Sbjct: 7  VGDYFSNDDNGLWSWYLTNIRNGDFEELTRNQLKHSLFKRFLRTYLEPTLNERKDTKVLI 66

Query: 69 VTSPYGLR 76
          V+ P  +R
Sbjct: 67 VSIPEDVR 74

 Score = 36.2 bits (82), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 32/52 (61%), Gaps = 8/52 (15%)

Query: 263 SLLGKDDASGKLWHAVRQLQ--------DDDWVIYDADFSLNNLENCKLEDI 306
           S+L  +  S +++ A+RQ          DDDW++YD+ FS++NL+   L+D+
Sbjct: 317 SVLFINPTSNEIFTAIRQSNNKPTKADVDDDWLLYDSQFSMHNLQMLTLQDL 368

>SAKL0G04906g Chr7 (403654..405480) [1827 bp, 608 aa] {ON} some
          similarities with uniprot|Q04233 Saccharomyces
          cerevisiae YML006C GIS4 CAAX box containing protein of
          unknown function proposed to be involved in the
          RAS/cAMP signaling pathway
          Length = 608

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 18 NNFWFWYIDNLVAGNFEELNDNLIKRNQLCSFLAHYFGGKQTTKLQRRLLLVTSP 72
          N  W WY+ NL  G+FEEL +N++K   L  FL  +   +   +  +++LLV+ P
Sbjct: 16 NGLWSWYLSNLRDGHFEELTNNVLKFTLLKRFLNEHL-MQDIVQFNKKMLLVSIP 69

 Score = 35.0 bits (79), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 32/53 (60%), Gaps = 8/53 (15%)

Query: 263 SLLGKDDASGKLWHAVRQLQDD--------DWVIYDADFSLNNLENCKLEDIL 307
           S+L ++  + +++ AVRQ  +D        DW++YD  FS++NL+   L D+L
Sbjct: 318 SILIQNPDTREIFTAVRQSNNDPNVAHINDDWLLYDEKFSMHNLQMLSLHDVL 370

>KLTH0G03740g Chr7 (295985..297880) [1896 bp, 631 aa] {ON} similar
          to uniprot|Q04233 Saccharomyces cerevisiae YML006C GIS4
          CAAX box containing protein of unknown function
          proposed to be involved in the RAS/cAMP signaling
          pathway
          Length = 631

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 18 NNFWFWYIDNLVAGNFEELNDNLIKRNQLCSFLAHYFGGKQTTKLQRRLLLVTSPYGL 75
          N  W WY+ NL  GNFEELN+N +K   L  FL        +    ++LLLV+ P  +
Sbjct: 17 NGLWSWYLCNLRHGNFEELNNNQLKFALLRRFLNEQLLS-DSVLFNKKLLLVSIPDAI 73

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 8/53 (15%)

Query: 263 SLLGKDDASGKLWHAVRQLQDD--------DWVIYDADFSLNNLENCKLEDIL 307
           S+L     + +L+ AVRQ  +D        DW++YD  FS+NNL+   L D+L
Sbjct: 339 SILVHQPDTRQLFTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILALHDVL 391

>CAGL0K07271g Chr11 complement(712294..714624) [2331 bp, 776 aa]
           {ON} similar to uniprot|Q04233 Saccharomyces cerevisiae
           YML006c
          Length = 776

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 35/53 (66%), Gaps = 8/53 (15%)

Query: 263 SLLGKDDASGKLWHAVRQLQD--------DDWVIYDADFSLNNLENCKLEDIL 307
           S+L +D  + +++ AVRQ  +        DDW++YDA+FS++NL+   L+DI+
Sbjct: 473 SILIQDPQTKEVFTAVRQSNNKPTIADITDDWLLYDAEFSMHNLQILTLQDIM 525

 Score = 38.1 bits (87), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 36/69 (52%), Gaps = 5/69 (7%)

Query: 9  VGKNQCRESNNFWFWYIDNLVAGNFEELNDN-----LIKRNQLCSFLAHYFGGKQTTKLQ 63
          VG     + N  W WY+ NL +G+FEE+ +N     L+KR    + L ++     T  + 
Sbjct: 7  VGDYYGNDENGVWSWYLSNLRSGDFEEIIENKLKYTLLKRFLNSNLLGNFSPESPTRFIN 66

Query: 64 RRLLLVTSP 72
          ++L+ V+ P
Sbjct: 67 KKLIFVSIP 75

>KNAG0B03710 Chr2 complement(710003..712138) [2136 bp, 711 aa]
          {ON} Anc_5.526 YML006C
          Length = 711

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 18 NNFWFWYIDNLVAGNFEELNDNLIKRNQLCSFLAHYFGGKQTTKLQRRLLLVTSP 72
          N  W WY+ N+ +G+FEEL  N +K   L  FL ++F   +   +  ++L ++ P
Sbjct: 16 NGLWSWYLQNIRSGDFEELTHNELKYTLLKRFLKNHFTSLE--GINSKILFISIP 68

 Score = 34.7 bits (78), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 28/43 (65%), Gaps = 10/43 (23%)

Query: 264 LLGKDDASGKLWHAVRQLQD--------DDWVIYDADFSLNNL 298
           LL ++D +  ++ A+RQ  +        DDW++YD+DFS+NNL
Sbjct: 482 LLQREDKA--IFTAIRQSNNKVDRATVQDDWILYDSDFSMNNL 522

>KAFR0C05390 Chr3 (1080797..1082164) [1368 bp, 455 aa] {ON}
          Anc_5.526 YML006C
          Length = 455

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 16 ESNNFWFWYIDNLVAGNFEELNDNLIKRNQLCSFLAHYFGGKQTTKLQRRLLLVTSP 72
          + N  W WY+ NL +GNFEEL +N +K + L  FL +        K   ++LL++ P
Sbjct: 14 DENGLWSWYLTNLRSGNFEELINNKLKDSLLKRFLRNQVDINDQIK---KILLISIP 67

>TDEL0A03900 Chr1 (698940..700955) [2016 bp, 671 aa] {ON} Anc_5.526
           YML006C
          Length = 671

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 33/53 (62%), Gaps = 8/53 (15%)

Query: 263 SLLGKDDASGKLWHAVRQLQ--------DDDWVIYDADFSLNNLENCKLEDIL 307
           S L +D  + +++ A+RQ          DDDW++YD+ FS+NNL+   L+++L
Sbjct: 405 SSLLQDPETKEIYTAIRQSNNQPTVADVDDDWLLYDSQFSMNNLQMLTLQELL 457

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 18 NNFWFWYIDNLVAGNFEELNDNLIKRNQLCSFLAHYFGGKQTTKLQR-RLLLVTSP 72
          N  W WY+ ++ +G+FEE + N +K   L  FL  +F   ++   Q  ++L V+ P
Sbjct: 16 NGLWSWYLSHIRSGDFEEFSRNKLKVTLLRRFLNSHFDSNRSHYGQNTKILFVSIP 71

>ADR198C Chr4 complement(1046482..1048131) [1650 bp, 549 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YML006C
          (GIS4)
          Length = 549

 Score = 38.1 bits (87), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 18 NNFWFWYIDNLVAGNFEELNDNLIKRNQLCSFLAHYFGGKQTTKLQRRLLLVTSPYGL 75
          +  W WY+ NL  G FE+L  +  + +QL +FL   F    +T  +RRL L++ P  +
Sbjct: 6  HGLWSWYLGNLRKGRFEQLVGDEARYSQLKAFLRDCFA--HSTGQERRLQLLSFPASV 61

>NDAI0C01070 Chr3 complement(209024..211297) [2274 bp, 757 aa]
          {ON} Anc_5.526 YML006C
          Length = 757

 Score = 38.1 bits (87), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 16 ESNNFWFWYIDNLVAGNFEELNDNLIKRNQLCSFL-AHYFGGKQTT 60
          + N  W WY+ N+  G+FEEL  N +K   L  FL +H++    TT
Sbjct: 14 DDNGLWSWYLRNIRLGDFEELTGNQLKYTLLKRFLNSHFYSNATTT 59

 Score = 33.1 bits (74), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 33/53 (62%), Gaps = 8/53 (15%)

Query: 263 SLLGKDDASGKLWHAVRQLQD--------DDWVIYDADFSLNNLENCKLEDIL 307
           S L ++  + +++ A+RQ  +        DDW++YD+ F+++NL+   L+D+L
Sbjct: 481 STLIQNPITKEIFTAIRQSNNEPTIAHITDDWLLYDSKFAMDNLQILTLQDLL 533

>TBLA0D01660 Chr4 complement(409692..412292) [2601 bp, 866 aa]
          {ON} Anc_5.526 YML006C
          Length = 866

 Score = 36.6 bits (83), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (58%)

Query: 16 ESNNFWFWYIDNLVAGNFEELNDNLIKRNQLCSFLAHYF 54
          ++N  W WY+ N+  G FEEL +N++K   L  FL   F
Sbjct: 18 DNNGLWSWYLSNIRNGMFEELTENILKITLLKRFLKENF 56

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 8/43 (18%)

Query: 273 KLWHAVRQLQD--------DDWVIYDADFSLNNLENCKLEDIL 307
           K + A+RQ           DDW++YD  FS++NLE   L+++L
Sbjct: 528 KTYTAIRQSDSNRDVADIQDDWLLYDLKFSMDNLEILTLQELL 570

>NCAS0H02550 Chr8 (506755..508986) [2232 bp, 743 aa] {ON}
          Anc_5.526 YML006C
          Length = 743

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 16 ESNNFWFWYIDNLVAGNFEELNDNLIKRNQLCSFL-AHYFGGKQTT 60
          + N  W WY+ N+  G+FEE+  N +K   L  FL +H++     T
Sbjct: 14 DDNGLWSWYLTNIRLGDFEEVTGNQLKYTLLKRFLNSHFYSNSDVT 59

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 33/53 (62%), Gaps = 8/53 (15%)

Query: 263 SLLGKDDASGKLWHAVRQLQD--------DDWVIYDADFSLNNLENCKLEDIL 307
           S+L +   + +++ A+RQ  +        DDW++YD+ FS++NL+   L+D+L
Sbjct: 442 SILIQHPVTKEIYTAIRQSNNEPTIADIMDDWLLYDSQFSMDNLQILTLQDLL 494

>YIR021W Chr9 (397294..398385) [1092 bp, 363 aa] {ON}  MRS1Protein
           required for the splicing of two mitochondrial group I
           introns (BI3 in COB and AI5beta in COX1); forms a
           splicing complex, containing four subunits of Mrs1p and
           two subunits of the BI3-encoded maturase, that binds to
           the BI3 RNA
          Length = 363

 Score = 34.7 bits (78), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 23/45 (51%)

Query: 78  GSLDEHLSKKLLSSTFGTSIDEFLTFHGHNGWLTIFPISNSDEKL 122
            ++ E ++K+LL S F   ID  +  H   GW   FPI +S   L
Sbjct: 234 ATIKEVVTKRLLRSAFDNDIDPLMCLHLDKGWKLKFPILSSTTGL 278

>TPHA0K00540 Chr11 complement(107389..109416) [2028 bp, 675 aa] {ON}
           Anc_5.526 YML006C
          Length = 675

 Score = 34.7 bits (78), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 25/37 (67%), Gaps = 8/37 (21%)

Query: 271 SGKLWHAVRQ--------LQDDDWVIYDADFSLNNLE 299
           SG+ + AVRQ         +DD+W++YD+ FS++NLE
Sbjct: 353 SGESFTAVRQSNSLIHEATEDDEWLLYDSKFSMDNLE 389

>Kpol_1023.99 s1023 complement(232194..233849) [1656 bp, 551 aa]
           {ON} complement(232194..233849) [1656 nt, 552 aa]
          Length = 551

 Score = 33.9 bits (76), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 8/53 (15%)

Query: 263 SLLGKDDASGKLWHAVRQLQ--------DDDWVIYDADFSLNNLENCKLEDIL 307
           S+L  +  S +L  A+RQ          DDDW++YD+ FS+ NL+   L ++L
Sbjct: 266 SILIYNSDSDELITAIRQSNNEQDSADIDDDWLLYDSKFSMTNLQILSLNELL 318

>Skud_4.240 Chr4 (423826..425685) [1860 bp, 619 aa] {ON} YDL013W
           (REAL)
          Length = 619

 Score = 33.9 bits (76), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 44/93 (47%), Gaps = 12/93 (12%)

Query: 93  FGTSIDEFLTFHGHNGWLTIF---PISNSDEKLYEFYKQDLYCMGYLMEECERGIISTPE 149
           F  SI  +L F G NG+LT     P+ N  ++  E + Q++  M    EE ER ++    
Sbjct: 375 FRESITNYLNFSGENGFLTRLWGSPVLNDADE--ERHTQNIIDMIQEREERERDVVMK-- 430

Query: 150 FGWLSKTENAEEEDCSDYEDELEGLTINFAKQF 182
              +SKT+  +EE    +ED    L   ++  F
Sbjct: 431 -NLMSKTKAQQEE----FEDRAARLPEGYSASF 458

>Smik_9.225 Chr9 (370773..371864) [1092 bp, 363 aa] {ON} YIR021W
           (REAL)
          Length = 363

 Score = 33.1 bits (74), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 22/45 (48%)

Query: 78  GSLDEHLSKKLLSSTFGTSIDEFLTFHGHNGWLTIFPISNSDEKL 122
            ++ E ++K+LL S F   ID  +  H   GW   FP  +S   L
Sbjct: 234 ATIKEVVAKRLLRSAFDNDIDPLMRLHLDKGWKLKFPTLSSTSDL 278

>Kpol_1071.5 s1071 (10336..11664) [1329 bp, 442 aa] {ON}
           (10336..11664) [1329 nt, 443 aa]
          Length = 442

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 37/74 (50%), Gaps = 6/74 (8%)

Query: 63  QRRLLLVTS-PYGLRNGSLDEHLSKKLLSSTFGTSIDEFLTFHGHNGWLTIFPISNSDEK 121
           QRRLL V+S  + ++N SL   L+ +LLS    T  D F++    NG   +  +S    K
Sbjct: 15  QRRLLSVSSVKFQIKNKSLLPPLNSQLLSLKPVTPNDSFVSCTVFNGKGDVIAVSQKFPK 74

Query: 122 -----LYEFYKQDL 130
                 YE Y +DL
Sbjct: 75  WSFLRQYELYPRDL 88

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.430 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 37,186,801
Number of extensions: 1690585
Number of successful extensions: 4473
Number of sequences better than 10.0: 35
Number of HSP's gapped: 4570
Number of HSP's successfully gapped: 53
Length of query: 324
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 214
Effective length of database: 40,868,139
Effective search space: 8745781746
Effective search space used: 8745781746
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)