Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0C032305.527ON56156127270.0
CAGL0F03047g5.527ON7445827674e-92
NCAS0F010905.527ON7875727652e-91
KAFR0E033005.527ON4664317133e-87
Smik_4.6975.527ON8173756674e-77
YDR422C (SIP1)5.527ON8153766612e-76
Skud_4.6965.527ON8113996595e-76
NDAI0H016005.527ON8423766572e-75
Suva_2.5995.527ON8273736473e-74
ZYRO0D12562g5.527ON8183876403e-73
SAKL0G04928g5.527ON8923986433e-73
TDEL0A039105.527ON7493816355e-73
ADR194C5.527ON6374166182e-71
Ecym_40655.527ON7215316082e-69
KLTH0G03762g5.527ON7093615863e-66
Kwal_47.186425.527ON3093285471e-64
TBLA0D016505.527ON10163705622e-61
Kpol_1004.215.527ON7553955453e-60
Kpol_1023.985.527ON6673724237e-44
TPHA0K005305.527ON6463743183e-30
Suva_7.533.517ON4142941928e-15
Smik_7.553.517ON4152941883e-14
YGL208W (SIP2)3.517ON4152771873e-14
Skud_7.603.517ON4412931864e-14
KAFR0I023803.517ON4092941802e-13
Ecym_12103.517ON4502931723e-12
KNAG0B036905.527ON3261281613e-11
CAGL0K09350g3.517ON4322861624e-11
Kwal_47.190403.517ON4293021572e-10
NCAS0E006203.517ON5001551341e-07
KLLA0B00583g3.517ON486421313e-07
KNAG0B006003.517ON389371294e-07
CAGL0A03696g3.517ON415421286e-07
TBLA0I032703.517ON433701251e-06
SAKL0F02002g3.517ON503421242e-06
TDEL0D058503.517ON404521213e-06
TPHA0A058103.517ON424421214e-06
Kpol_195.23.517ON435571214e-06
KNAG0E015903.517ON423701205e-06
NCAS0F037303.517ON432521206e-06
Suva_5.1233.517ON423521197e-06
Smik_5.1503.517ON417671188e-06
ZYRO0E08404g3.517ON348511179e-06
Skud_5.1363.517ON418661181e-05
YER027C (GAL83)3.517ON417671171e-05
NDAI0B060103.517ON503381171e-05
AER361C3.517ON475721172e-05
NDAI0I028903.517ON582511172e-05
KAFR0F041403.517ON348541152e-05
KLTH0G01848g3.517ON416421126e-05
TDEL0G003905.16ON54887780.62
SAKL0F00748g3.569ON707144723.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0C03230
         (561 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0C03230 Chr3 (632659..634344) [1686 bp, 561 aa] {ON} Anc_5.5...  1055   0.0  
CAGL0F03047g Chr6 complement(298906..301140) [2235 bp, 744 aa] {...   300   4e-92
NCAS0F01090 Chr6 complement(215542..217905) [2364 bp, 787 aa] {O...   299   2e-91
KAFR0E03300 Chr5 (654349..655749) [1401 bp, 466 aa] {ON} Anc_5.5...   279   3e-87
Smik_4.697 Chr4 complement(1236081..1238534) [2454 bp, 817 aa] {...   261   4e-77
YDR422C Chr4 complement(1315326..1317773) [2448 bp, 815 aa] {ON}...   259   2e-76
Skud_4.696 Chr4 complement(1236293..1238728) [2436 bp, 811 aa] {...   258   5e-76
NDAI0H01600 Chr8 complement(387297..389825) [2529 bp, 842 aa] {O...   257   2e-75
Suva_2.599 Chr2 complement(1068063..1070546) [2484 bp, 827 aa] {...   253   3e-74
ZYRO0D12562g Chr4 complement(1061702..1064158) [2457 bp, 818 aa]...   251   3e-73
SAKL0G04928g Chr7 complement(405798..408476) [2679 bp, 892 aa] {...   252   3e-73
TDEL0A03910 Chr1 complement(701073..703322) [2250 bp, 749 aa] {O...   249   5e-73
ADR194C Chr4 complement(1039625..1041538) [1914 bp, 637 aa] {ON}...   242   2e-71
Ecym_4065 Chr4 (144003..146168) [2166 bp, 721 aa] {ON} similar t...   238   2e-69
KLTH0G03762g Chr7 complement(297935..300064) [2130 bp, 709 aa] {...   230   3e-66
Kwal_47.18642 s47 (908641..909570) [930 bp, 309 aa] {ON} YDR422C...   215   1e-64
TBLA0D01650 Chr4 (406397..409447) [3051 bp, 1016 aa] {ON} Anc_5....   221   2e-61
Kpol_1004.21 s1004 complement(41725..43992) [2268 bp, 755 aa] {O...   214   3e-60
Kpol_1023.98 s1023 (229891..231894) [2004 bp, 667 aa] {ON} (2298...   167   7e-44
TPHA0K00530 Chr11 (105141..107081) [1941 bp, 646 aa] {ON} Anc_5....   127   3e-30
Suva_7.53 Chr7 (93895..95139) [1245 bp, 414 aa] {ON} YGL208W (REAL)    79   8e-15
Smik_7.55 Chr7 (92235..93482) [1248 bp, 415 aa] {ON} YGL208W (REAL)    77   3e-14
YGL208W Chr7 (97338..98585) [1248 bp, 415 aa] {ON}  SIP2One of t...    77   3e-14
Skud_7.60 Chr7 (102699..104024) [1326 bp, 441 aa] {ON} YGL208W (...    76   4e-14
KAFR0I02380 Chr9 (482219..483448) [1230 bp, 409 aa] {ON} Anc_3.5...    74   2e-13
Ecym_1210 Chr1 (423627..424979) [1353 bp, 450 aa] {ON} similar t...    71   3e-12
KNAG0B03690 Chr2 (708946..709926) [981 bp, 326 aa] {ON} Anc_5.52...    67   3e-11
CAGL0K09350g Chr11 complement(922651..923949) [1299 bp, 432 aa] ...    67   4e-11
Kwal_47.19040 s47 complement(1073036..1074325) [1290 bp, 429 aa]...    65   2e-10
NCAS0E00620 Chr5 (106661..108163) [1503 bp, 500 aa] {ON} Anc_3.517     56   1e-07
KLLA0B00583g Chr2 complement(44819..46279) [1461 bp, 486 aa] {ON...    55   3e-07
KNAG0B00600 Chr2 (97910..99079) [1170 bp, 389 aa] {ON} Anc_3.517...    54   4e-07
CAGL0A03696g Chr1 (377255..378502) [1248 bp, 415 aa] {ON} simila...    54   6e-07
TBLA0I03270 Chr9 complement(793849..795150) [1302 bp, 433 aa] {O...    53   1e-06
SAKL0F02002g Chr6 (167591..169102) [1512 bp, 503 aa] {ON} simila...    52   2e-06
TDEL0D05850 Chr4 complement(1062927..1064141) [1215 bp, 404 aa] ...    51   3e-06
TPHA0A05810 Chr1 complement(1317530..1318804) [1275 bp, 424 aa] ...    51   4e-06
Kpol_195.2 s195 complement(4330..5637) [1308 bp, 435 aa] {ON} co...    51   4e-06
KNAG0E01590 Chr5 complement(317054..318325) [1272 bp, 423 aa] {O...    51   5e-06
NCAS0F03730 Chr6 complement(750798..752096) [1299 bp, 432 aa] {O...    51   6e-06
Suva_5.123 Chr5 complement(184865..186136) [1272 bp, 423 aa] {ON...    50   7e-06
Smik_5.150 Chr5 complement(213879..215132) [1254 bp, 417 aa] {ON...    50   8e-06
ZYRO0E08404g Chr5 complement(672301..673347) [1047 bp, 348 aa] {...    50   9e-06
Skud_5.136 Chr5 complement(206871..208127) [1257 bp, 418 aa] {ON...    50   1e-05
YER027C Chr5 complement(208979..210232) [1254 bp, 417 aa] {ON}  ...    50   1e-05
NDAI0B06010 Chr2 complement(1460221..1461732) [1512 bp, 503 aa] ...    50   1e-05
AER361C Chr5 complement(1307677..1309104) [1428 bp, 475 aa] {ON}...    50   2e-05
NDAI0I02890 Chr9 complement(682274..684022) [1749 bp, 582 aa] {O...    50   2e-05
KAFR0F04140 Chr6 complement(814903..815949) [1047 bp, 348 aa] {O...    49   2e-05
KLTH0G01848g Chr7 (136780..138030) [1251 bp, 416 aa] {ON} simila...    48   6e-05
TDEL0G00390 Chr7 complement(80116..81762) [1647 bp, 548 aa] {ON}...    35   0.62 
SAKL0F00748g Chr6 (64800..66923) [2124 bp, 707 aa] {ON} highly s...    32   3.5  

>KNAG0C03230 Chr3 (632659..634344) [1686 bp, 561 aa] {ON} Anc_5.527
           YDR422C
          Length = 561

 Score = 1055 bits (2727), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/561 (92%), Positives = 517/561 (92%)

Query: 1   MSSHSLDEGNIGKNLANLRLDAAAVADGVQTDGSDGTRSVRSDVXXXXXXXXXXXVQGTE 60
           MSSHSLDEGNIGKNLANLRLDAAAVADGVQTDGSDGTRSVRSDV           VQGTE
Sbjct: 1   MSSHSLDEGNIGKNLANLRLDAAAVADGVQTDGSDGTRSVRSDVHRHRHHHKHKHVQGTE 60

Query: 61  ALDPDSGIVQNQDRVLNQAILQHAIKKDMKRKRNDSNASGTAAAVLHNHRXXXXXXXNVE 120
           ALDPDSGIVQNQDRVLNQAILQHAIKKDMKRKRNDSNASGTAAAVLHNHR       NVE
Sbjct: 61  ALDPDSGIVQNQDRVLNQAILQHAIKKDMKRKRNDSNASGTAAAVLHNHRQQQQQEENVE 120

Query: 121 GPTLVGAQTGAASGEMSATAAIMLKLYGDKNQLXXXXXXXXXXXXXKSAASNVRLPEVKK 180
           GPTLVGAQTGAASGEMSATAAIMLKLYGDKNQL             KSAASNVRLPEVKK
Sbjct: 121 GPTLVGAQTGAASGEMSATAAIMLKLYGDKNQLAHEVHEAREVHEVKSAASNVRLPEVKK 180

Query: 181 IKKPLPEKETEKVRTQVAAADEQFSNFSDFENENVRVILKWRDPQLQPYQGTGAAIKSHD 240
           IKKPLPEKETEKVRTQVAAADEQFSNFSDFENENVRVILKWRDPQLQPYQGTGAAIKSHD
Sbjct: 181 IKKPLPEKETEKVRTQVAAADEQFSNFSDFENENVRVILKWRDPQLQPYQGTGAAIKSHD 240

Query: 241 IYSTLRAIKSELITPERENKEDLLYLDYDAKKKDWFVPDLYLPPGIYRLKFLINGMLLHS 300
           IYSTLRAIKSELITPERENKEDLLYLDYDAKKKDWFVPDLYLPPGIYRLKFLINGMLLHS
Sbjct: 241 IYSTLRAIKSELITPERENKEDLLYLDYDAKKKDWFVPDLYLPPGIYRLKFLINGMLLHS 300

Query: 301 NFLPTATDAAGTIVNWFEVLPGYETIEPYRDESMIGQDDESIDSQPYKSTTDVTDYAGIX 360
           NFLPTATDAAGTIVNWFEVLPGYETIEPYRDESMIGQDDESIDSQPYKSTTDVTDYAGI 
Sbjct: 301 NFLPTATDAAGTIVNWFEVLPGYETIEPYRDESMIGQDDESIDSQPYKSTTDVTDYAGIS 360

Query: 361 XXXXXXXXXXXXNLRLPNLHITSLNKESSASVNEANETNEGNDIQLLPEPKYEYSTEIPE 420
                       NLRLPNLHITSLNKESSASVNEANETNEGNDIQLLPEPKYEYSTEIPE
Sbjct: 361 RSSSVVSKHSKSNLRLPNLHITSLNKESSASVNEANETNEGNDIQLLPEPKYEYSTEIPE 420

Query: 421 LFQFDDVNTRKTNDIKEVRKESKLETLYPNGKFDFTLARVVNSNQDALFASIQKIGKMTT 480
           LFQFDDVNTRKTNDIKEVRKESKLETLYPNGKFDFTLARVVNSNQDALFASIQKIGKMTT
Sbjct: 421 LFQFDDVNTRKTNDIKEVRKESKLETLYPNGKFDFTLARVVNSNQDALFASIQKIGKMTT 480

Query: 481 EEAEEYFLTKFKVSDLPIYLNSTYLNKNFSGEVNHIIPHVNLRHLLTTSIKEDIICVGCT 540
           EEAEEYFLTKFKVSDLPIYLNSTYLNKNFSGEVNHIIPHVNLRHLLTTSIKEDIICVGCT
Sbjct: 481 EEAEEYFLTKFKVSDLPIYLNSTYLNKNFSGEVNHIIPHVNLRHLLTTSIKEDIICVGCT 540

Query: 541 TRYAGKFITQVIYAPCSYDKQ 561
           TRYAGKFITQVIYAPCSYDKQ
Sbjct: 541 TRYAGKFITQVIYAPCSYDKQ 561

>CAGL0F03047g Chr6 complement(298906..301140) [2235 bp, 744 aa] {ON}
           similar to uniprot|P32578 Saccharomyces cerevisiae
           YDR422c SIP1 multicopy suppressor of SNF1
          Length = 744

 Score =  300 bits (767), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 215/582 (36%), Positives = 295/582 (50%), Gaps = 101/582 (17%)

Query: 58  GTEALDPDSGIVQNQDRVLNQAILQHAIKKDMKRKRNDSNASGTAAAVLHNHRXXXXXXX 117
           G    DPD G++Q  D VLNQ +L+ A+K+DMKRKR D+  S T   V  N +       
Sbjct: 180 GVPVGDPDGGMLQGTDVVLNQELLEQALKRDMKRKRADTMQSST---VELNKKVDTNTSK 236

Query: 118 NVEGPTLVGAQTGAASGEMSATAAIMLKLYGDK----NQLXXXXXXXXXXXXXKSAASNV 173
           N    T +       +   SATAA+M++LYGD+     Q+              + A+  
Sbjct: 237 NSNH-TEIMKNPPETAEPTSATAAMMMRLYGDRTLLNQQITKQKEDENKYSHTITNAAYK 295

Query: 174 RLPEVKKIKKP------LPEKETEKVRTQVAAADEQFS--NFSDFENEN-----VRVILK 220
           +L     +K+       L  +  E +R        Q +  N +   +E+       VILK
Sbjct: 296 KLKPFSGVKRKILSNPNLNLQPLEPIRPNEPPTSGQRTPNNSAHVHSESPSPDRTNVILK 355

Query: 221 WRDPQLQPY-QGTGAAIKSHDIYSTLRA-----IKSELITPERENKEDLLYLDYDAKKKD 274
           WRD Q Q   +     + S++I ++L+       + +L+  +  ++ + + L YD+   +
Sbjct: 356 WRDSQNQSNNKELKVYLVSNEICASLKNDDKLFAEGKLLATDN-SQFNKIPLSYDSHNNE 414

Query: 275 WFVPDLYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEVLPGYETIEPYRDESM 334
           W+VPDLYLP GIYRL+FL+NG L+HS+FLPTATD  G I+NWFEVL GY+ IEPYRDES 
Sbjct: 415 WYVPDLYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEVLRGYDRIEPYRDESE 474

Query: 335 IGQDDESIDSQPYKSTTDVT-------DYAGIXXXXXXXXXXX---XXNLRLPNLHITSL 384
           I  D        Y S+ D T        + G                 NL+ P       
Sbjct: 475 IQSD--------YTSSVDTTLEGMENNGFQGSSDNSTTSMRNNNPVALNLQAPAPSKAQA 526

Query: 385 NKESS---------------------------ASVNEANETN-EGNDIQLLP--EPK-YE 413
           ++ SS                           ++V+  N  N   ND++  P  +PK YE
Sbjct: 527 SRNSSYYSAKSFEKSITQFSDYTGVSRTNSMVSAVSPINNANTRDNDLEFFPPIKPKVYE 586

Query: 414 YSTEIPELFQFDDVNTRKTNDIKEVRKESKLETLYPNGKFD---FTLARVVNSNQDALFA 470
           YS  IP LF       R + D+++V  ++  E   P   +D   FT  RVV+ NQDALF 
Sbjct: 587 YSNNIPALF-------RISCDMEDVDDDNGTEN-NPRAFYDRPSFT-NRVVDCNQDALFG 637

Query: 471 SIQKIGKMTTEEAEEYFLTKFKVSDLPIYLNSTYLNKNF------------SGEVNHIIP 518
            +QK GKM  EEAE  FL K++V DLP+YLNSTYLNK F               +NHIIP
Sbjct: 638 DLQKGGKMDAEEAENLFLKKYQVPDLPVYLNSTYLNKIFHEFHQVAGPSTQDSSINHIIP 697

Query: 519 HVNLRHLLTTSIKEDIICVGCTTRYAGKFITQVIYAPCSYDK 560
           HVNL+HLLT+SI++ I+ V CTTRYAGKFITQVIYAPC  D+
Sbjct: 698 HVNLKHLLTSSIRDGIVSVACTTRYAGKFITQVIYAPCGNDQ 739

>NCAS0F01090 Chr6 complement(215542..217905) [2364 bp, 787 aa] {ON}
           Anc_5.527 YDR422C
          Length = 787

 Score =  299 bits (765), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 215/572 (37%), Positives = 284/572 (49%), Gaps = 146/572 (25%)

Query: 67  GIVQNQDRVLNQAILQHAIKKDMKRKRNDSNASGTAAAVLHNHRXXXXXXXNVEGPTLVG 126
           G++QN D VLNQ+ L+ A+K+DMKRKR D+ AS                  ++E PT   
Sbjct: 274 GVLQNVDIVLNQSFLKDAMKRDMKRKRTDTGASTATP--------------DIEKPT--- 316

Query: 127 AQTGAASGEMSATAAIMLKLYGDKNQLXXXXXXXXXX----XXXKSAASNVRLPEVKKIK 182
                    +SATAA+MLKLYGDKNQ+                 + + S + L EVKKIK
Sbjct: 317 ----EKKKPISATAAMMLKLYGDKNQMEKEEKKSSGSYSYADQYEHSTSQINLREVKKIK 372

Query: 183 ----------------KPLPEKETEKVRT--------------QVAAADEQFSNFSDFEN 212
                           K +  +  + V+                  ++DEQ        N
Sbjct: 373 HIENDFVEDNFGISSPKEIKIQHIDDVKNAPPSSLSSSMSSSSFGPSSDEQ-------TN 425

Query: 213 ENVRVILKWRDPQLQPYQGTGAAIKSHDIYSTLRAIKSELITPERENKEDLLYLDYDAKK 272
           +NV+V+LKWRD Q+   +    +I S DI S +         P +  K   L + ++   
Sbjct: 426 DNVQVVLKWRD-QIDNPKHCKISIVSDDISSAI---------PAKATKAGKLPMLFNPMI 475

Query: 273 KDWFVPDLYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEVLPGYETIEPYRDE 332
           K+W+VP+L LPPGIYRLKF ING L HSNFLPTATD+ G IVNWFEVLPGY+T+EPYRDE
Sbjct: 476 KEWYVPNLLLPPGIYRLKFSINGDLTHSNFLPTATDSMGNIVNWFEVLPGYDTVEPYRDE 535

Query: 333 SM------IGQDDESIDSQP-----------------YKSTTDVTDYAGIXXXXXXXXXX 369
            +       G      D+ P                   S T  +DY GI          
Sbjct: 536 IIETTFHTNGSQGTLRDNNPTTIRSRRSSSFVSANGDLASMTPYSDYTGISRSN------ 589

Query: 370 XXXNLRLPNLHITSLNKESSASVNEANETNEGNDIQLLPEP-KYEYSTEIPELFQFDDVN 428
                       ++LN + ++ V+         D+    EP K EYS EIPELF+     
Sbjct: 590 ------------SALNSKRTSLVSLRGVGKL--DLFTPMEPKKIEYSNEIPELFKI---- 631

Query: 429 TRKTNDIKEVRKESKL----ETLYPNGKFDFTLARVVNSNQDALFASIQKIGKMTTEEAE 484
              +N I++   +       ETL P  +  FT  RVV+ NQD LF+ +QK G +  E AE
Sbjct: 632 ---SNSIEDEDDDEGDYGHNETLSPFEEPSFT-NRVVDCNQDKLFSDLQKNGNIDAETAE 687

Query: 485 EYFLTKFKVSDLPIYLNSTYLNKNF------------------SGEVNHIIPHVNLRHLL 526
             FL K++V DLPIYLNS+YLNK F                  +  + HIIPHVNL HLL
Sbjct: 688 MLFLNKYQVPDLPIYLNSSYLNKIFLQFQKQHNDPTPSANTASTIGITHIIPHVNLNHLL 747

Query: 527 TTSIKEDIICVGCTTRYAGKFITQVIYAPCSY 558
           T+SI+++II V CTTRY GKFITQV+YAPC+Y
Sbjct: 748 TSSIRDEIISVACTTRYQGKFITQVMYAPCNY 779

>KAFR0E03300 Chr5 (654349..655749) [1401 bp, 466 aa] {ON} Anc_5.527
           YDR422C
          Length = 466

 Score =  279 bits (713), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 180/431 (41%), Positives = 236/431 (54%), Gaps = 77/431 (17%)

Query: 136 MSATAAIMLKLYGDKNQLXXXXXXXXXXXXXKSAASNVRLPEVKKIKKPLPEKETEKVRT 195
           MS TA  MLKLYG+  +                 AS + LP  KK K        E   T
Sbjct: 99  MSQTAKTMLKLYGNSAE--------REREQEAKNASLLSLPNTKKFKN-------ESAGT 143

Query: 196 QVAAADEQFSNFSDFENENVRVILKWRDPQLQPYQGTGAAIKSHDIYSTLRAI----KSE 251
                D+          ++V VILKWR+P       +  AI S DI STL  I    KS 
Sbjct: 144 DSDVDDDN---------DDVEVILKWREP---IDHNSAVAIVSKDIVSTLLTIAKTHKSS 191

Query: 252 LITPERENKEDLLYLDYDAKKKDWFVPDLYLPPGIYRLKFLINGMLLHSNFLPTATDAAG 311
           +IT   E K+  + L YD    +W++P+L+LPPGIY+L+FLING L+HSN+LPTAT+A G
Sbjct: 192 IIT-FIERKKFKINLLYDIVTNEWYLPNLFLPPGIYKLQFLINGNLIHSNYLPTATNANG 250

Query: 312 TIVNWFEVLPGYETIEPYRDESMIGQDDESIDSQPYKSTTDVTDYAGIXXXXXXXXXXXX 371
            IVNWFEV+ GY+TIEPYRDE  I   ++S  ++   S + +TDYAGI            
Sbjct: 251 NIVNWFEVICGYKTIEPYRDEERIIHREKSTANESISSNS-LTDYAGISRSSSIVSNKSS 309

Query: 372 XNLRLPNLHITSLNKESSASVNEANETNEGNDIQLLPEPKYEYSTEIPELFQFDDVNTRK 431
                  L +T+LN                     L + + +Y+ EIPE+F+FD      
Sbjct: 310 LISSS--LKLTNLN---------------------LNDDEIKYTNEIPEIFKFDSTANSN 346

Query: 432 TNDIKEVRKESKLETLYPNGKFDFTLARVVNSNQDALFASIQKIGKMTTEEAEEYFLTKF 491
            N                N  FD +L++V++ NQD +FAS+QKI +M T+EAE YFL +F
Sbjct: 347 VN----------------NQAFDMSLSKVIDLNQDHVFASLQKIARMNTDEAENYFLNRF 390

Query: 492 KVSDLPIYLNSTYLNKNF-----SGEVNHIIPHVNLRHLLTTSIKEDIICVGCTTRYAGK 546
           K+ DLPIYLNS +LNK F     +   N+ +PHVNL HLLTTSIK+D +CV CTTRY GK
Sbjct: 391 KIHDLPIYLNSNFLNKIFIRDNNNETTNNTVPHVNLNHLLTTSIKDDTLCVACTTRYVGK 450

Query: 547 FITQVIYAPCS 557
           FITQ++YAP S
Sbjct: 451 FITQIMYAPSS 461

>Smik_4.697 Chr4 complement(1236081..1238534) [2454 bp, 817 aa] {ON}
           YDR422C (REAL)
          Length = 817

 Score =  261 bits (667), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 156/375 (41%), Positives = 214/375 (57%), Gaps = 41/375 (10%)

Query: 213 ENVRVILKWRDPQLQPYQG----TGAAIKSHDIYSTLR------AIKSELITPERENKED 262
           E+  VILKW++     Y      T  +I S+DI S L+      A +S  +  E++    
Sbjct: 450 ESTLVILKWKN-----YSNMAVTTEVSIVSNDIASALKEQREVDADESASLDSEKQLNPR 504

Query: 263 LLYLDYDAKKKDWFVPDLYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEVLPG 322
           +  + YD   K+WF PDL+LPPGIYRL+F ING+L HSN+LPTATD+ G  VNWFEVLPG
Sbjct: 505 IRMV-YDNVHKEWFFPDLFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEVLPG 563

Query: 323 YETIEPYRDESMIGQDDESIDSQPYKSTTDVTDYAGIXXXXXXXXXXXXXNLRLPNLHIT 382
           Y TIEP+R+E+ +G   E +  +      ++  ++                   P     
Sbjct: 564 YHTIEPFRNEADLGSQVEPVLEEESPIRPELKRFSSSSRKSSYYSAKGVERPSTPFSDYR 623

Query: 383 SLNKESSASVNEANETNEGNDIQLLPE---PKYEYSTEIPELFQFDDVNTRKTNDIKEVR 439
            L++ SS ++ ++    + + + L+ E    K EYS EIP LF   D  T  T+ I+E R
Sbjct: 624 GLSRSSSVNMRDSFVRLKASSLDLMAEIKPEKLEYSNEIPNLFNIADGGT--TSVIRESR 681

Query: 440 KESKLETLYPNGKFDFTLARVVNSNQDALFASIQKIGKMTTEEAEEYFLTKFKVSDLPIY 499
             S      P  +  FT  +VV+ NQD LFA++Q+ G +  E AE  FL+++ + DLPIY
Sbjct: 682 DSS------PQEQPSFTY-KVVDCNQDDLFATLQQGGNIDAETAETVFLSRYPIPDLPIY 734

Query: 500 LNSTYLNKNFS-------------GEVNHIIPHVNLRHLLTTSIKEDIICVGCTTRYAGK 546
           LNS+YLNK  +             G +NHIIPHVNL HLLT+SI+++II V CTTRY GK
Sbjct: 735 LNSSYLNKILNQSNPNSEPHDRDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGK 794

Query: 547 FITQVIYAPCSYDKQ 561
           FITQVIYAPC Y  Q
Sbjct: 795 FITQVIYAPCYYKTQ 809

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 60/96 (62%), Gaps = 3/96 (3%)

Query: 57  QGTEALDPDSGIVQNQDRVLNQAILQHAIKKDMKR--KRNDSNASGTAAAVLHNHRXXXX 114
           + ++ +D ++G++Q++D VLNQ++LQ+A+KKDM+R  + N SN++ T      N+     
Sbjct: 259 KNSDNIDAEAGVLQSEDMVLNQSLLQNALKKDMQRLSRANSSNSTCTIENSN-NNNNYSS 317

Query: 115 XXXNVEGPTLVGAQTGAASGEMSATAAIMLKLYGDK 150
              N+      G+    ++  +SATA +M+KLYGDK
Sbjct: 318 SENNIRNKEDSGSFNDNSNVPISATAKMMMKLYGDK 353

>YDR422C Chr4 complement(1315326..1317773) [2448 bp, 815 aa] {ON}
           SIP1Alternate beta-subunit of the Snf1p kinase complex,
           may confer substrate specificity; vacuolar protein
           containing KIS (Kinase-Interacting Sequence) and ASC
           (Association with Snf1 kinase Complex) domains involved
           in protein interactions
          Length = 815

 Score =  259 bits (661), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 156/376 (41%), Positives = 208/376 (55%), Gaps = 43/376 (11%)

Query: 213 ENVRVILKWRDPQLQPYQGTGAA-----IKSHDIYSTLRAIKSELITPERENKEDLLYLD 267
           EN  V+LKW+D       GT AA     I S DI S L+  + EL   E  + +    L+
Sbjct: 450 ENTLVVLKWKD------DGTVAATTEVFIVSTDIASALKE-QRELTLDENASLDSEKQLN 502

Query: 268 ------YDAKKKDWFVPDLYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEVLP 321
                 YD   K+WFVPDL+LP GIYRL+F ING+L HSNFLPTATD+ G  VNWFEVLP
Sbjct: 503 PRIRMVYDDVHKEWFVPDLFLPAGIYRLQFSINGILTHSNFLPTATDSEGNFVNWFEVLP 562

Query: 322 GYETIEPYRDESMIGQDDESIDSQPYKSTTDVTDYAGIXXXXXXXXXXXXXNLRLPNLHI 381
           GY TIEP+R+E+ I    E    +      ++  +                    P    
Sbjct: 563 GYHTIEPFRNEADIDSQVEPTLDEELPKRPELKRFPSSSRKSSYYSAKGVERPSTPFSDY 622

Query: 382 TSLNKESSASVNEANETNEGNDIQLLPEPKYE---YSTEIPELFQFDDVNTRKTNDIKEV 438
             L++ SS ++ ++    + + + L+ E K E   YS EIP LF   D +T        +
Sbjct: 623 RGLSRSSSINMRDSFVRLKASSLDLMAEVKPERLVYSNEIPNLFNIGDGST--------I 674

Query: 439 RKESKLETLYPNGKFDFTLARVVNSNQDALFASIQKIGKMTTEEAEEYFLTKFKVSDLPI 498
             +   + ++P     FT  RVV+ NQD LFA++Q+ G +  E AE  FL+++ V DLPI
Sbjct: 675 SVKGDSDDVHPQEPPSFT-HRVVDCNQDDLFATLQQGGNIDAETAEAVFLSRYPVPDLPI 733

Query: 499 YLNSTYLNKNFS-------------GEVNHIIPHVNLRHLLTTSIKEDIICVGCTTRYAG 545
           YLNS+YLN+  +             G +NHIIPHVNL HLLT+SI+++II V CTTRY G
Sbjct: 734 YLNSSYLNRILNQSNQNSESHERDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYEG 793

Query: 546 KFITQVIYAPCSYDKQ 561
           KFITQV+YAPC Y  Q
Sbjct: 794 KFITQVVYAPCYYKTQ 809

 Score = 60.5 bits (145), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 57/94 (60%), Gaps = 3/94 (3%)

Query: 59  TEALDPDSGIVQNQDRVLNQAILQHAIKKDMKR--KRNDSNASGTAAAVLHNHRXXXXXX 116
           ++++D ++G++Q++D VLNQ++LQ+A+KKDM+R  + N SN+  TA  + H         
Sbjct: 261 SDSVDAEAGVLQSEDMVLNQSLLQNALKKDMQRLSRVNSSNSMYTAERISHA-NNNGNIE 319

Query: 117 XNVEGPTLVGAQTGAASGEMSATAAIMLKLYGDK 150
            N       G      +  +SATA +M+KLYGDK
Sbjct: 320 NNTRNKGNAGGSNDDFTAPISATAKMMMKLYGDK 353

>Skud_4.696 Chr4 complement(1236293..1238728) [2436 bp, 811 aa] {ON}
           YDR422C (REAL)
          Length = 811

 Score =  258 bits (659), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 159/399 (39%), Positives = 207/399 (51%), Gaps = 90/399 (22%)

Query: 213 ENVRVILKWRDPQLQPYQGTGAAIKSHDIYSTLRAIKSELITPERE-NKEDLLYLD---- 267
           EN  V+LKW+         T  +I S+DI S L+         +RE N +D   LD    
Sbjct: 447 ENTLVVLKWKS-DTNMTATTEVSIVSNDIASALKE--------QREVNLDDDASLDSEKP 497

Query: 268 --------YDAKKKDWFVPDLYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEV 319
                   YD+  ++WFVPDL+LP GIYRL+F ING+L HSNFLPTATD+ G  VNWFEV
Sbjct: 498 LNSRIRMIYDSVHREWFVPDLFLPAGIYRLQFSINGLLTHSNFLPTATDSEGNFVNWFEV 557

Query: 320 LPGYETIEPYRDES-----MIGQDDESIDSQPY-------------------KSTTDVTD 355
           LPGY TIEP+RDE+     M    DE    +P                    +  T  +D
Sbjct: 558 LPGYHTIEPFRDEADMDFQMRSTLDEEAPIRPEPKRLSSSRKSSYYSAKDGERPGTPFSD 617

Query: 356 YAGIXXXXXXXXXXXXXNLRLPNLHITSLNKESSASVNEANETNEGNDIQLLPEPKYEYS 415
           Y G+              L+  +L + +                     ++ PE K EYS
Sbjct: 618 YRGLSRSNSVFLRGSFVRLKASSLDLMA---------------------EIKPE-KLEYS 655

Query: 416 TEIPELFQFDDVNTRKTNDIKEVRKESKLETLYPNGKFDFTLARVVNSNQDALFASIQKI 475
            EIP LF   + +T  + D          E L P  +  FT  +VV+ NQD LFA++Q+ 
Sbjct: 656 NEIPNLFNIGEASTTTSKD--------HFERLSPQDRPSFT-HKVVDCNQDDLFATLQQG 706

Query: 476 GKMTTEEAEEYFLTKFKVSDLPIYLNSTYLNKNFS-------------GEVNHIIPHVNL 522
           G +  E AE  FL+++ + DLPIYLNS+YLN+  +             G +NHIIPHVNL
Sbjct: 707 GNIDAETAEAVFLSRYPIPDLPIYLNSSYLNRILNQSNPNSEFHDGDEGGINHIIPHVNL 766

Query: 523 RHLLTTSIKEDIICVGCTTRYAGKFITQVIYAPCSYDKQ 561
            HLLT+SI+++II V CTTRY GKFITQVIYAPC Y  Q
Sbjct: 767 NHLLTSSIRDEIISVACTTRYEGKFITQVIYAPCYYKTQ 805

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 57/91 (62%), Gaps = 6/91 (6%)

Query: 62  LDPDSGIVQNQDRVLNQAILQHAIKKDMKR--KRNDSNASGTAAAVLHNHRXXXXXXXNV 119
           +D ++G++Q++D VLNQ++LQ+A+KKDM+R  + N SN++ T    +           N+
Sbjct: 264 IDAEAGVLQSEDMVLNQSLLQNALKKDMQRLSRANSSNSTYT----MGRENRINNSESNI 319

Query: 120 EGPTLVGAQTGAASGEMSATAAIMLKLYGDK 150
           +G       +  ++  +SATA +M+KLYGDK
Sbjct: 320 DGKENSIDPSDDSTVPISATAKMMMKLYGDK 350

>NDAI0H01600 Chr8 complement(387297..389825) [2529 bp, 842 aa] {ON}
           Anc_5.527 YDR422C
          Length = 842

 Score =  257 bits (657), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 156/376 (41%), Positives = 210/376 (55%), Gaps = 39/376 (10%)

Query: 212 NENVRVILKWRDPQLQPYQGTGAAIKSHDIYSTLRAIKSELITPERENKEDLLYLDYDAK 271
           N+NV V+LKWRD Q+   +    AI S DI + L +  S+  +    N  + L + ++  
Sbjct: 474 NDNVHVVLKWRD-QIDNPKKCKIAIISDDIVNALESSSSKRKSNTNNNDNNTLPMVFNPM 532

Query: 272 KKDWFVPDLYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEVLPGYETIEPYRD 331
            K+W++P+L LPPGIYRLKF IN  + HSNFLPTATD+ G IVNWFEVLPGY+ +EPYRD
Sbjct: 533 IKEWYMPNLTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVLPGYDAVEPYRD 592

Query: 332 ESMIGQDDESIDSQPYKSTTDVTDYAGIXXXXXXXXXXXXXNLR--LPNLHITSLNKESS 389
           E +    + +  + P + T  V D   I             +L    P      +++ SS
Sbjct: 593 EII----ETTFHTAPSQGTLSVHDLTMIRSRRSSSFVSAKSDLSSFTPYSDYAGISRSSS 648

Query: 390 --------ASVNEANETNEGNDIQLLPEPKYEYSTEIPELFQFDDVNTRKTNDIKEVRKE 441
                   AS+     TN+ +    +   K  YS EIPELF+    N+  TN     + E
Sbjct: 649 SVGTATKKASLVSLRGTNKLDLFTPIEPKKIAYSKEIPELFKI--ANSEDTN-----KME 701

Query: 442 SKLETLYPNGKFDFTLARVVNSNQDALFASIQKIGKMTTEEAEEYFLTKFKVSDLPIYLN 501
              +   P  +  FT  +V++ NQD LFA +Q+ G +  E AE  FL ++ + DLPIYLN
Sbjct: 702 IDDDGSSPFERPSFT-HKVIDCNQDKLFADLQRDGNIDAETAEALFLNRYPIPDLPIYLN 760

Query: 502 STYLNKNF----------------SGEVNHIIPHVNLRHLLTTSIKEDIICVGCTTRYAG 545
           STYLNK F                S  + HIIPHVNL HLLT+SI+++II V CTTRY G
Sbjct: 761 STYLNKIFTQFQKQHNDPTLPASSSIGLTHIIPHVNLNHLLTSSIRDEIISVACTTRYQG 820

Query: 546 KFITQVIYAPCSYDKQ 561
           KFITQV+YAPC+Y  Q
Sbjct: 821 KFITQVMYAPCNYSSQ 836

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 62/130 (47%), Gaps = 22/130 (16%)

Query: 63  DPDSGIVQNQDRVLNQAILQHAIKKDMKRKRND---SNASGTAAAVLHNHRXXXXXXXNV 119
           D +SG++Q+ D V+NQ+ LQ+A+K+DMKRKR D   +N SG   +     +         
Sbjct: 280 DEESGVLQSADIVVNQSTLQNALKRDMKRKRTDTISTNKSGAPTSDALKAKDEPEAKTKT 339

Query: 120 EGPTLVGAQTGAASGEMSATAAIMLKLYGDKNQLXXXXXXXXXXXXX-------KSAASN 172
           E P             MSATAA+MLKLYGD                        K + S+
Sbjct: 340 EKPA------------MSATAAMMLKLYGDTTLKEKETFKNNTISGTIRYDDFYKRSESS 387

Query: 173 VRLPEVKKIK 182
           V LPE KK+K
Sbjct: 388 VNLPENKKLK 397

>Suva_2.599 Chr2 complement(1068063..1070546) [2484 bp, 827 aa] {ON}
           YDR422C (REAL)
          Length = 827

 Score =  253 bits (647), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 153/373 (41%), Positives = 209/373 (56%), Gaps = 48/373 (12%)

Query: 217 VILKWRDPQLQPYQGTGAAIKSHDIYSTLRA-----IKSELITPERENKEDLLYLDYDAK 271
           VILKW++    P   T  +I SHDI STL+      +  +      +     + + YDA 
Sbjct: 469 VILKWKNNSNMP-ATTEVSIISHDIASTLKEQLEVNLDEDASLDSEKQLNPRIRMIYDAV 527

Query: 272 KKDWFVPDLYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEVLPGYETIEPYRD 331
            K+WFVP+L+LPPGIYRL+F ING+L HSNFLPTATD+ G  VNWFEVLPGY TIEP+RD
Sbjct: 528 HKEWFVPELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVLPGYHTIEPFRD 587

Query: 332 E----SMIGQD---DESIDSQPYKSTTDVTDYAGIXXXXXXXXXXXXXNLRLPNLHITSL 384
           E    S +G     +  I  +P + ++     +               + R        L
Sbjct: 588 EADTESQVGSTIDVEAPIRPEPKRLSSSSRKSSYYSAKGVERPSTPFSDYR-------GL 640

Query: 385 NKESSASVNEANETNEGNDIQLLPEPK---YEYSTEIPELFQFDDVNTRKTNDIKEVRKE 441
           ++ +SA++ ++    + + + L+ + K    EYS EIP LF    +       I+E    
Sbjct: 641 SRSNSANLRDSFVRLKASSLDLMAQIKPEILEYSNEIPSLFT---IGNGSATPIQEDLPS 697

Query: 442 SKLETLYPNGKFDFTLARVVNSNQDALFASIQKIGKMTTEEAEEYFLTKFKVSDLPIYLN 501
             L +        FT  +VV+ NQD LFA++Q+ G +  E AE  FL+++ + DLPIYLN
Sbjct: 698 QDLPS--------FT-HKVVDCNQDDLFATLQQGGNIDAETAEIVFLSRYPIPDLPIYLN 748

Query: 502 STYLNKNFS-------------GEVNHIIPHVNLRHLLTTSIKEDIICVGCTTRYAGKFI 548
           S+YLNK  +             G +NHIIPHVNL HLLT+SI+++II V CTTRY GKFI
Sbjct: 749 SSYLNKILNQGNPNSESGDKDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFI 808

Query: 549 TQVIYAPCSYDKQ 561
           TQVIYAPC Y  Q
Sbjct: 809 TQVIYAPCYYKTQ 821

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 59/104 (56%), Gaps = 12/104 (11%)

Query: 59  TEALDPDSGIVQNQDRVLNQAILQHAIKKDMKR--KRNDSNASGTAAAVLHNHRXXXXXX 116
           ++ +D ++G++Q++D VLNQ++LQ+A+KKD++R  + N SN++ T  +  HN+       
Sbjct: 264 SDNIDAEAGVLQSEDMVLNQSLLQNALKKDIQRLSRVNSSNSTYTIDSATHNNNNNNNNN 323

Query: 117 XNVEGPTLVGAQTGA----------ASGEMSATAAIMLKLYGDK 150
            N    +      G           +   +SATA +M+KLYGDK
Sbjct: 324 SNSNNSSNSENNIGYKENSSDSNDDSGAPISATAKMMMKLYGDK 367

>ZYRO0D12562g Chr4 complement(1061702..1064158) [2457 bp, 818 aa]
           {ON} some similarities with uniprot|P32578 Saccharomyces
           cerevisiae YDR422C SIP1 Alternate beta-subunit of the
           Snf1p kinase complex may confer substrate specificity
           vacuolar protein containing KIS (Kinase-Interacting
           Sequence) and ASC (Association with Snf1 kinase Complex)
           domains involved in protein interactions
          Length = 818

 Score =  251 bits (640), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 158/387 (40%), Positives = 213/387 (55%), Gaps = 51/387 (13%)

Query: 213 ENVRVILKWRDPQLQPYQGTG-AAIKSHDIYSTLRAIKSELITPERENKEDLLYLDYDAK 271
           ++V V +KWRD    P  GT   ++ S DI STL   +      ++    +   + Y+ +
Sbjct: 437 QDVHVAIKWRD--HLPVDGTNRMSMVSEDIASTLSFER------QKHGARNTFPMRYEEE 488

Query: 272 KKDWFVPDLYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEVLPGYETIEPYRD 331
            K+W VPDL LP G+YRL+FLING L HSN+LPTATD+ G  VNWFEV+PGYE +EPYRD
Sbjct: 489 TKEWVVPDLVLPVGVYRLQFLINGELTHSNYLPTATDSVGNFVNWFEVIPGYEKVEPYRD 548

Query: 332 E-------------SMIGQDDESIDSQPYKSTTDVTDYAGIXXXXXXXXXXXXXNLRL-- 376
           E             + I     S+++Q  + T  +    G              + R+  
Sbjct: 549 EVELDSGQPLNAGNNGIAGSVLSLENQGSEGTVLMEPVPGKVNVRPPLASMHHSSNRVIR 608

Query: 377 ---PNLHITSLNKESSA-SVNEANETNEGNDIQLLPEPK-YEYSTEIPELFQFDDVNTRK 431
              P    T +++ SSA   +  N T    D+    +PK Y+YS EIPELF+   +   K
Sbjct: 609 SNTPYSDYTGISRSSSALRKSPINCTTSSLDLHTALQPKKYKYSNEIPELFKTAPIT--K 666

Query: 432 TNDIKEVRKESKLETL-------YPNGKFDFTLARVVNSNQDALFASIQKIGKMTTEEAE 484
            ND  E      +E         +P+    F   +VV+ NQD LF  +Q+ G +  E AE
Sbjct: 667 ANDENEDFTFGHMEPPTYDWARGHPSSNAGFG-NQVVDCNQDELFTELQQGGLLDAETAE 725

Query: 485 EYFLTKFKVSDLPIYLNSTYLNK--------NF----SGEVNHIIPHVNLRHLLTTSIKE 532
           + FL K+ V DLPIYLNS YLN+        N+    SG +NHIIPHVNL HLLT+SI++
Sbjct: 726 QLFLEKYPVPDLPIYLNSYYLNRIISEFQKNNYPGGGSGGINHIIPHVNLNHLLTSSIRD 785

Query: 533 DIICVGCTTRYAGKFITQVIYAPCSYD 559
           ++I VGCTTRY GKFITQVIYAPC Y+
Sbjct: 786 EMISVGCTTRYEGKFITQVIYAPCYYE 812

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/46 (47%), Positives = 30/46 (65%), Gaps = 4/46 (8%)

Query: 65  DSGIVQNQDRVLNQAILQHAIKKDMKRKR----NDSNASGTAAAVL 106
           D G + ++D VLNQ++L + IK+DMKRKR    NDSN +  A   L
Sbjct: 259 DDGYLHSKDIVLNQSLLHNVIKRDMKRKRDKETNDSNNNLVATKTL 304

>SAKL0G04928g Chr7 complement(405798..408476) [2679 bp, 892 aa] {ON}
           some similarities with uniprot|P32578 Saccharomyces
           cerevisiae YDR422C SIP1 Alternate beta-subunit of the
           Snf1p kinase complex may confer substrate specificity
           vacuolar protein containing KIS (Kinase-Interacting
           Sequence) and ASC (Association with Snf1 kinase Complex)
           domains involved in protein interactions
          Length = 892

 Score =  252 bits (643), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 163/398 (40%), Positives = 214/398 (53%), Gaps = 85/398 (21%)

Query: 211 ENENVRVILKWRDPQLQPYQGTGAAIKSHDIYSTLRAIKSELITPERENKEDLLYLDYDA 270
           E++ V V+LKWRD  + P +    ++ S DI + L A++S    P          ++Y+ 
Sbjct: 522 EDDLVNVVLKWRDCIVDP-KTCKISVISSDISAVL-ALQSSKKIP----------MEYET 569

Query: 271 KKKDWFVPDLYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEVLPGYETIEPYR 330
            +K WFVP+L LPPG+Y+L+FLING L HSNFLPTATD+ G  VNWFEVLPGY  IEP R
Sbjct: 570 TEKSWFVPNLKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEVLPGYYEIEPLR 629

Query: 331 D-----------------ESMIGQDDESI-------------DSQPY-------KSTTDV 353
           D                 ES+ G  D +I              S  Y       +STT  
Sbjct: 630 DVPVDSMNYGSDLGVSMKESVNGGSDFTITAPIPRPPLLSQATSSSYRSSKYIERSTTPY 689

Query: 354 TDYAGIXXXXXXXXXXXXXNLRLPNLHITSLNKESSASVNEANETNEGNDIQLLPEPKYE 413
           +DY GI              L   N     LN++ S+S +             LP  KYE
Sbjct: 690 SDYTGI--------------LSRSNSARPLLNQKKSSSYDV---------FAPLPPKKYE 726

Query: 414 YSTEIPELFQFDDVNTRKTNDIKEVRKESKLETLYPNGKFDFTLARVVNSNQDALFASIQ 473
           YST+IPELF+ +D      +  ++    S L       +  F   RV + NQD LF+ +Q
Sbjct: 727 YSTDIPELFKVNDEEDHDHDIPEDPPSYSSLLKGSEAEQPSFH-CRVQDCNQDRLFSDLQ 785

Query: 474 KIGKMTTEEAEEYFLTKFKVSDLPIYLNSTYLNKNF--------SGE----VNHIIPHVN 521
           +  ++  + AEE+FL K+ V DLPIYLNS+YLNK F        +GE    VN +IPHVN
Sbjct: 786 QHDRIDAQAAEEFFLQKYPVPDLPIYLNSSYLNKVFNQLQKDNNAGETKAVVNPVIPHVN 845

Query: 522 LRHLLTTSIKEDIICVGCTTRYAGKFITQVIYAPCSYD 559
           L HLLT+SI+E+II VGCTTRY GKFIT V+YAPC Y+
Sbjct: 846 LNHLLTSSIREEIISVGCTTRYEGKFITHVVYAPCYYE 883

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 25/34 (73%)

Query: 62  LDPDSGIVQNQDRVLNQAILQHAIKKDMKRKRND 95
           LD   G +++ D +LN A+L+ AI+KDMKRKR +
Sbjct: 355 LDLSEGFLEDNDVLLNNAVLESAIRKDMKRKRQE 388

>TDEL0A03910 Chr1 complement(701073..703322) [2250 bp, 749 aa] {ON}
           Anc_5.527 YDR422C
          Length = 749

 Score =  249 bits (635), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 153/381 (40%), Positives = 202/381 (53%), Gaps = 44/381 (11%)

Query: 211 ENENVRVILKWRDPQLQPYQGTGAAIKSHDIYSTLRAIKSELITPERENKEDLLYLDYDA 270
           E E V VILKWRD Q++        I S DI S L         P  ++      + YD 
Sbjct: 370 EPEKVHVILKWRD-QIEDPSKCKITIISTDIASALN------FDPSDKSFHGTFSMKYDE 422

Query: 271 KKKDWFVPDLYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEVLPGYETIEPYR 330
           K+ +++VP+L LPPGIY+ +F+ING + HSN LP+ATD+ G IVNWFEV+PGYE++EP+R
Sbjct: 423 KENNFYVPNLSLPPGIYKFQFVINGEIRHSNLLPSATDSVGNIVNWFEVIPGYESVEPFR 482

Query: 331 DESMIGQDDESIDSQPYKSTTDVTDYAGIXXXXXXXXXXXXXNLRLPNLHITSLNKESSA 390
           +E +   ++  ID     S+T    +                   L   H +S + +   
Sbjct: 483 NE-IDYHENMGIDPPQSDSSTSTGKHHDESPGKVPLVQPVPGRPPLAARHTSSYSNKQER 541

Query: 391 S---------VNEAN----------ETNEGNDIQLLPEPK-YEYSTEIPELFQFDDV-NT 429
           S         V+  N          +T    D+    +PK YEYS EIPELF+  +V   
Sbjct: 542 SGTPYSDYTGVSRCNSAVRKSPLIHQTLSSIDLVTALQPKKYEYSNEIPELFKAGNVLGQ 601

Query: 430 RKTNDIKEVRKESKLETLYPNGKFDFTLARVVNSNQDALFASIQKIGKMTTEEAEEYFLT 489
              N              Y    F   L  VV+ NQD LF S+Q+ G +  E AE+ FL 
Sbjct: 602 SDENQFPTPPPPPMNPPSYDQPSF---LENVVDCNQDNLFVSLQQGGLLDAETAEQLFLE 658

Query: 490 KFKVSDLPIYLNSTYLNKNF------------SGEVNHIIPHVNLRHLLTTSIKEDIICV 537
           K+ V DLP+YLNSTYLNK F            S  +NHIIPHVNL HLLT+SI++++I V
Sbjct: 659 KYTVPDLPVYLNSTYLNKIFNEFQKHNSLGSNSSGLNHIIPHVNLNHLLTSSIRDEMISV 718

Query: 538 GCTTRYAGKFITQVIYAPCSY 558
           GCTTRY GKFITQV+YAPC Y
Sbjct: 719 GCTTRYEGKFITQVVYAPCYY 739

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 25/29 (86%)

Query: 65  DSGIVQNQDRVLNQAILQHAIKKDMKRKR 93
           D G +Q++D VLNQ++LQ+ +++DMKRKR
Sbjct: 232 DDGYLQSEDVVLNQSLLQNVLRRDMKRKR 260

>ADR194C Chr4 complement(1039625..1041538) [1914 bp, 637 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR422C
           (SIP1)
          Length = 637

 Score =  242 bits (618), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 160/416 (38%), Positives = 217/416 (52%), Gaps = 68/416 (16%)

Query: 169 AASNVRLPEVKKIKKPLPEKETEKVRTQVAAADEQFSNFSDFENENVRVILKWRDPQLQP 228
           AA   + P+ KK K P          + V  ++ +    SD E E V VI+KWRD  L P
Sbjct: 261 AAETAKQPDAKKKKLPCSAAALSATASGVVQSETE-EQHSDAEAEFVEVIIKWRDCLLDP 319

Query: 229 YQGTGAAIKSHDIYSTLRAIKSELITPERENKEDLLYLDYDAKKKDWFVPDLYLPPGIYR 288
            Q T  +I S DI S +            +N +  + + +   ++ W  PDL LPPGIY+
Sbjct: 320 -QRTKLSIVSPDIASVIH-----------KNSKRKVAMVFSKDEQFWVAPDLRLPPGIYK 367

Query: 289 LKFLINGMLLHSNFLPTATDAAGTIVNWFEVLPGYETIEPYRDESMIGQDDESIDSQPYK 348
           L+FLING L HSNFLPTATD+   IVNWFEV+P Y+  EPYRD +      E +   P  
Sbjct: 368 LQFLINGALRHSNFLPTATDSHSNIVNWFEVVPWYDRAEPYRDPA-----PEEVAMPP-- 420

Query: 349 STTDVTDYAGIXXXXXXXXXXXXXNLRL------PNLHITSLNKESSASVNEANETNEGN 402
            +  +T  A                 R+      P    T +++  SA    A+  +  N
Sbjct: 421 ESPQLTAPAAGRPPLLKRGTSSSSRARVVERSNTPISDYTGISRSGSARPLLAHHKS-AN 479

Query: 403 DIQLLPEPKY--EYSTEIPELFQFD----DVNTRKTNDIKEVRKESKLETLYPNGKFDFT 456
            I+L P P+   +YSTEIPELF+ +    D NT                     G F+  
Sbjct: 480 SIELSPIPRCVLQYSTEIPELFKPEGCPPDPNTAP-------------------GSFN-- 518

Query: 457 LARVVNSNQDALFASIQKIGKMTTEEAEEYFLTKFKVSDLPIYLNSTYLNKNFS------ 510
              + + NQD LF  +Q+  KM+ +EAEE  + K+ V DLP+YLNS+YLN+ F+      
Sbjct: 519 -ENIQDCNQDELFRFLQEDWKMSAQEAEEVLVEKYPVPDLPVYLNSSYLNEIFTKLQRSS 577

Query: 511 --GEV-----NHIIPHVNLRHLLTTSIKEDIICVGCTTRYAGKFITQVIYAPCSYD 559
             G+V      HIIPHVNL HLLT+SI+++II VGCTTRY GKFITQ++YAPC Y+
Sbjct: 578 VTGDVKRSSFTHIIPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIMYAPCYYE 633

>Ecym_4065 Chr4 (144003..146168) [2166 bp, 721 aa] {ON} similar to
           Ashbya gossypii ADR194C
          Length = 721

 Score =  238 bits (608), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 172/531 (32%), Positives = 264/531 (49%), Gaps = 87/531 (16%)

Query: 59  TEALDPDSGIVQNQDRVLNQAILQHAIKKDMKRKRNDSNASGTAAAVLHNHRXXXXXXXN 118
           T+ LD   G ++N D VL++A++   +K DM+RKR     S  A+  ++ ++       +
Sbjct: 245 TQDLD---GYIENSDVVLSEALVDSVVKNDMRRKRQLQKQSAEASEAINENKNEANQQPD 301

Query: 119 VEGPTLVGAQTGAASGEMSATAAIMLKLYGDKNQLXXXXXXXXXXXXXKSAASNVRLPEV 178
           V+   +  +     S +M       L     K+                  + +     V
Sbjct: 302 VKKAKVPMSNLLKPSKQMGTVTGTFLPQSELKD------------------SGSFEYGSV 343

Query: 179 KKIKKPLPEKETEKVRTQVAAADEQFSNFSDFENENVRVILKWRDPQLQPYQGTGAAIKS 238
           + +              +VAA D    N+SD   E V+VI+KWRD  + P     + I  
Sbjct: 344 QHV--------------EVAADD----NYSDDCPERVQVIIKWRDTNVDPRTSKISIIS- 384

Query: 239 HDIYSTLRAIKSELITPERENKE-DLLYLDYDAKKKDWFVPDLYLPPGIYRLKFLINGML 297
                   +  + ++ P R+ K+  ++YL+   +++ W   DL LP GIY+L F ING +
Sbjct: 385 --------SDIASVVQPTRKRKKIPMVYLE---QEQCWAAEDLKLPAGIYKLMFFINGQV 433

Query: 298 LHSNFLPTATDAAGTIVNWFEVLPGYETIEPYRDESMIGQDDE--SIDSQPYKSTTDVTD 355
            HSN+LPTATD+   IVNWFEV+PGY+ IEPYRD ++    +E  + +      T +   
Sbjct: 434 RHSNYLPTATDSLSNIVNWFEVVPGYDQIEPYRDAAIERSPNELAAYNETSLLLTNETPS 493

Query: 356 YAGIXXXXXXXXXXXXXNLRL------PNLHITSLNKESSASVNEA---NETNEGNDIQL 406
            A I               R+      P    T +   +S S N A   +++N   D+ +
Sbjct: 494 PANIRPPLINRGTSSSSRARVIERTNTPISDYTGVLARNSCS-NPAIYRHKSNNSTDVDI 552

Query: 407 LP-EPKYEYSTEIPELFQFDDVNT---RKTNDIKEVRKESKLETLYPNGKFDFTLARVVN 462
           LP +P   YS+++PELF+  + +T   ++ +D  +++  SK     PN      +  V +
Sbjct: 553 LPKQPTLIYSSDVPELFKVGNASTGGSQQGSDKNKLQNPSKYLQDSPN-----FMKNVQD 607

Query: 463 SNQDALFASIQKIGKMTTEEAEEYFLTKFKVSDLPIYLNSTYLNKNFS------------ 510
            NQD LF  +Q+   M  +EAEE FL K+ V DLPIYLNST LN+ F+            
Sbjct: 608 CNQDELFHYLQEKWNMNAQEAEEVFLEKYSVPDLPIYLNSTSLNEIFNKLQQNSAMGDLP 667

Query: 511 --GEVNHIIPHVNLRHLLTTSIKEDIICVGCTTRYAGKFITQVIYAPCSYD 559
               + HIIPHVNL HLLT++I+++II VGCTTRY GKFITQ++YAPC Y+
Sbjct: 668 KRKSLTHIIPHVNLNHLLTSNIRDEIISVGCTTRYEGKFITQIMYAPCYYE 718

>KLTH0G03762g Chr7 complement(297935..300064) [2130 bp, 709 aa] {ON}
           similar to uniprot|P32578 Saccharomyces cerevisiae
           YDR422C SIP1 Alternate beta-subunit of the Snf1p kinase
           complex may confer substrate specificity vacuolar
           protein containing KIS (Kinase-Interacting Sequence) and
           ASC (Association with Snf1 kinase Complex) domains
           involved in protein interactions
          Length = 709

 Score =  230 bits (586), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 142/361 (39%), Positives = 195/361 (54%), Gaps = 36/361 (9%)

Query: 215 VRVILKWRDPQLQPYQGTGAAIKSHDIYSTLRAIKSELITPERENKEDLLYLDYDAKKKD 274
             VIL W+D  + P +    +I S DI STL   K          K   + + +D ++  
Sbjct: 361 THVILNWKDNIVDP-KTCKMSIVSKDISSTLNPHK----------KFSKIPMVFDMERNC 409

Query: 275 WFVPDLYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEVLPGYETIEPYRD--- 331
           W   DLYLP G+Y+ +FLING L HS++LPTATD+ G  VNWFEV+ G+++IEP RD   
Sbjct: 410 WTAHDLYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGHDSIEPSRDVIS 469

Query: 332 -ESMIGQDDESIDSQPYKSTTDVTDYAGIXXXXXXXXXXXXXNLRLPNLHITSLNKESSA 390
            E +    D+    QP      +    G                  P    T L   S  
Sbjct: 470 SEDVKLSKDQIAVEQPAPERPALGS-DGSSSSNWKGSSRHVERSGTPFSDYTGLCSRSEL 528

Query: 391 SVNE--ANETNEGNDIQLLPEPKYEYSTEIPELFQ--FDDVNTRKTNDIKEVRKESKLET 446
           +  E   N T+  + +  +P PKYEY+ EIPELF+  FD        + +E+ K+     
Sbjct: 529 TKPELRHNNTSSYDLLAPVPRPKYEYTDEIPELFKANFDGSLVPPPYEERELTKDG---- 584

Query: 447 LYPNGKFDFTLARVVNSNQDALFASIQKIGKMTTEEAEEYFLTKFKVSDLPIYLNSTYLN 506
              + K    L RV + NQD LFA +Q+ G++ ++ AEE FL ++   DLP+YL+S++LN
Sbjct: 585 ---SQKPPSFLHRVQDCNQDVLFADLQQNGQIDSQAAEEAFLQQYPTPDLPVYLDSSFLN 641

Query: 507 KNFSG---------EVNHIIPHVNLRHLLTTSIKEDIICVGCTTRYAGKFITQVIYAPCS 557
             FSG          VNHI+PHVNL HLLT+SI+++II VGCTTRY GKFITQ+IY PC 
Sbjct: 642 AVFSGFQDKTDSKTRVNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTPCY 701

Query: 558 Y 558
           Y
Sbjct: 702 Y 702

>Kwal_47.18642 s47 (908641..909570) [930 bp, 309 aa] {ON} YDR422C
           (SIP1) - SNF1 protein kinase substrate [contig 191]
           PARTIAL
          Length = 309

 Score =  215 bits (547), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 126/328 (38%), Positives = 172/328 (52%), Gaps = 65/328 (19%)

Query: 268 YDAKKKDWFVPDLYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEVLPGYETIE 327
           +D +   W  PDLYLP G+Y+ +FLING L HS FLPTATD+ G  VNWFEV+ G++ IE
Sbjct: 3   FDMESNCWIAPDLYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVAGHKVIE 62

Query: 328 PYRD---------ESMIGQDDESIDSQP-------------------YKSTTDVTDYAGI 359
           P RD         +  I  +D S   +P                    +S T  +DY G+
Sbjct: 63  PSRDVISNDFTENQVAISANDPSASPRPPILSGSSSFSNWKNSAKHIERSGTPYSDYTGL 122

Query: 360 XXXXXXXXXXXXXNLRLPNLHITSLNKESSASVNEANETNEGNDIQLLPEPKYEYSTEIP 419
                        +L  P L                  T+  + +  +P P YEYS EIP
Sbjct: 123 CSRT---------DLAKPEL--------------RHKNTSSYDLLAPVPRPVYEYSNEIP 159

Query: 420 ELFQFDDVNTRKTNDIKEVRKESKLETLYPNGKFDFTLARVVNSNQDALFASIQKIGKMT 479
           ELF+ +   +      +E      + +  P       L RV + NQD LFA +QK G++ 
Sbjct: 160 ELFKANFEGSSTPPPYQE-----SVPSQNPVKNQPSFLHRVQDCNQDVLFADLQKNGEID 214

Query: 480 TEEAEEYFLTKFKVSDLPIYLNSTYLNKNFSG---------EVNHIIPHVNLRHLLTTSI 530
           ++ AEE FL ++   DLP+YL+S++LN  F G         ++NHI+PHVNL HLLT+SI
Sbjct: 215 SQAAEEAFLQQYPTPDLPVYLDSSFLNAVFRGFQEKNDTKSKLNHIVPHVNLNHLLTSSI 274

Query: 531 KEDIICVGCTTRYAGKFITQVIYAPCSY 558
           +++II VGCTTRY GKFITQ+IY PC Y
Sbjct: 275 RDEIISVGCTTRYEGKFITQIIYTPCYY 302

>TBLA0D01650 Chr4 (406397..409447) [3051 bp, 1016 aa] {ON} Anc_5.527
            YDR422C
          Length = 1016

 Score =  221 bits (562), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 145/370 (39%), Positives = 208/370 (56%), Gaps = 55/370 (14%)

Query: 217  VILKWRDPQLQP-YQGTGAAIKSHDIYSTLRAIKSELITPERENKEDLLYLDYDAKKKDW 275
            VI+K+RDP  +     T   + S DI +TL    ++L+T    NK +L+Y   +  +K W
Sbjct: 664  VIIKYRDPMEESEIPETKIQLISKDINTTLHYDTTDLLT--ENNKMELVY---NKDEKAW 718

Query: 276  FVPDLYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEVLPGYETIEPYRDESMI 335
             +P+L LPPGIY+++FL+N  L HS+FLPTATD  G IVNWFEVL GY+ IEP+RDE++ 
Sbjct: 719  ILPNLMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVLSGYDFIEPFRDENIS 778

Query: 336  GQDD------ESIDSQPYKSTTDVTDYAGIXXXXXXXXXXXXXNLRLPNLHITSLNKESS 389
              D+      ++I  +  K T  +T  AG                  P  + T +++ +S
Sbjct: 779  SADNSDGTLMQNIIPEKLK-TISMTKMAGNGSKGST-----------PRSNYTGVSRSNS 826

Query: 390  ASVNEANETNEGNDIQLLP--EP-KYEYSTEIPELFQFDDVNTRKTNDIKEVRKESKLET 446
             S + ++   +  ++ L    EP K EYSTEIPE+F+    NT + N      +      
Sbjct: 827  LSASSSSSVWKSVNVNLFTPLEPNKVEYSTEIPEIFK----NTTENNTSNAPMQ------ 876

Query: 447  LYPNGKFDFTLARVVNSNQDALFASIQKIGKMTTEEAEEYFLTKFKVSDLPIYLNSTYLN 506
             +P  K    L  VV+ +Q+ LF  +   G M TE AE+ FL K+ V +LPIYLNS Y+ 
Sbjct: 877  YHPERKRPGLLHNVVDCSQEELFGDLLADGLMDTETAEQMFLDKYPVPELPIYLNSKYMT 936

Query: 507  KNFSGEV-----------------NHIIPHVNLRHLLTTSIKEDIICVGCTTRYAGKFIT 549
            +   GE+                 NHIIPHVNL+HLLT+SI+E++I V CTTRY GKF+T
Sbjct: 937  Q-IVGEINQPSGSGPPSSLNNNDLNHIIPHVNLQHLLTSSIREEMISVACTTRYEGKFLT 995

Query: 550  QVIYAPCSYD 559
            Q++Y PC Y+
Sbjct: 996  QILYTPCFYE 1005

>Kpol_1004.21 s1004 complement(41725..43992) [2268 bp, 755 aa] {ON}
           complement(41725..43992) [2268 nt, 756 aa]
          Length = 755

 Score =  214 bits (545), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 140/395 (35%), Positives = 204/395 (51%), Gaps = 69/395 (17%)

Query: 205 SNFS-DFENENVRVILKWRDPQLQPYQGTGAAIKSHDIYSTLRAIKSELITPERENKEDL 263
           S FS D  +ENVRV LKWRD  +   +    +I S++I S +    ++L +   ++   +
Sbjct: 383 STFSLDLGSENVRVFLKWRD-LIDDIENANISIVSNEILSVI--CMNDLDSENSDSARMV 439

Query: 264 LYLDYDAKKKDWFVPDLYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEVLPGY 323
            Y D      +W    L+LPPGIY+L+F +NG L HS++LPTATD  G IVNWFEV  GY
Sbjct: 440 YYPD----TSEWVTKYLFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEVPRGY 495

Query: 324 ETIEPYRDESMIGQDDESIDSQPY---------------------KSTTDVTDYAGIXXX 362
           E+IEP+RD   +  +      QP                      + TT  +D+AGI   
Sbjct: 496 ESIEPFRDNDYVKNEISGGILQPIPNTLGIPSVSSQLSSFSFHASRPTTPYSDFAGINRS 555

Query: 363 XXXXXXXXXXNLRLPNLHITSLNKESSASVNEANETNEGNDIQLLPEPKYEYSTEIPELF 422
                       + P++  T+ + E S +V               PEPKY+Y+TEIPE++
Sbjct: 556 SPLPLRE-----KSPDVKSTNFDLEFSTAV---------------PEPKYDYTTEIPEIY 595

Query: 423 QFDDVNTRKTNDIKEVRKESKLET--LYPNGKFDFTLARVVNSNQDALFASIQK-IGK-M 478
           +  D++       +    +  +    LY     +     V+  +Q  LF  + K  GK +
Sbjct: 596 KAVDLDLTTAKATETTTDDEDITKPPLYLGTGGNSIFNDVIGCSQRDLFEKLSKNTGKGL 655

Query: 479 TTEEAEEYFLTKFKVSDLPIYLNSTYLNK------NFSG----------EVNHIIPHVNL 522
            T+E E+ FL K+ ++DLPIYLN+ Y+NK      N  G           VNHI+PHVN+
Sbjct: 656 NTDELEKIFLAKYPITDLPIYLNTDYMNKALEQHRNIVGVDDVMQEEINVVNHIVPHVNI 715

Query: 523 RHLLTTSIKEDIICVGCTTRYAGKFITQVIYAPCS 557
           +HLLT +I++ +I V CT RY GKFITQV+Y+PCS
Sbjct: 716 KHLLTHNIQDSVIAVACTVRYGGKFITQVVYSPCS 750

>Kpol_1023.98 s1023 (229891..231894) [2004 bp, 667 aa] {ON}
           (229891..231894) [2004 nt, 668 aa]
          Length = 667

 Score =  167 bits (423), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 114/372 (30%), Positives = 183/372 (49%), Gaps = 47/372 (12%)

Query: 215 VRVILKWRDPQLQPYQGTGAAIKSHDIYSTLRAIKSELITPERENKEDLLYLDYDAKKKD 274
           V V+L+WRD  +Q       +I S DI ++++A  S ++            + YD  + +
Sbjct: 310 VNVVLRWRDSYIQNETCKSVSIISEDILTSVQAQNSGVLLISN------FSMTYDKNENN 363

Query: 275 WFVPDLYLPPGIYRLKFLINGM-LLHSNFLPTATDAAGTIVNWFEVLPGYETIEPYRDES 333
           W +PDL+LPPG YRL+FLI+     +SN+LP   D  GTI+N  E+LPGY+++EP+   +
Sbjct: 364 WVLPDLFLPPGKYRLRFLIDHHDFRYSNYLPVTEDELGTIINEIEILPGYKSVEPFEHNN 423

Query: 334 MIGQDDESIDSQ-----PYKSTTDVTDYAGIXXXXXXXXXXXXXNLRLPNLHITSLNKES 388
            I   +  I+S+       +  ++   Y  +                L N   + +  + 
Sbjct: 424 HIMIQENIINSELSLNNSRQLQSEPPSYPELEENFSSPIESIISEDELDNDQYSKVYGKR 483

Query: 389 SASVNEANETNEGNDIQLLPE-PKYEYSTEIPELFQFDDVNTRKTNDIKE---VRKESKL 444
           + S+ ++  +     + + P   +  Y+ EIP+LF+  D N     + +    V   S  
Sbjct: 484 NNSIGQSKTS-----LSIKPCISEVTYTNEIPQLFKITDNNCIVNENYERYGFVEPPSYG 538

Query: 445 ETLYPNGKFDFTLARVVNSNQDALFASIQKIGKMTTEEAEEYFLTKFKVSDLPIYLNSTY 504
           E    N        RV++ NQD LFA+ Q+ G +  E AE+ FL K+ V DLP++L+S +
Sbjct: 539 EPGLEN--------RVIDCNQDILFATFQQNGAVDVELAEQLFLEKYPVPDLPVFLDSHF 590

Query: 505 LNKNF------------SGEVNHI------IPHVNLRHLLTTSIKEDIICVGCTTRYAGK 546
             K F            +GE   I      IPHVNL H+LT  I   +I V CTTRY  K
Sbjct: 591 SEKLFDNNDSSKNLNDMNGEDIQIKNNGQDIPHVNLNHVLTNKISNGMISVACTTRYKRK 650

Query: 547 FITQVIYAPCSY 558
           F+T ++Y+P ++
Sbjct: 651 FVTHILYSPSTH 662

>TPHA0K00530 Chr11 (105141..107081) [1941 bp, 646 aa] {ON} Anc_5.527
           YDR422C
          Length = 646

 Score =  127 bits (318), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 106/374 (28%), Positives = 175/374 (46%), Gaps = 64/374 (17%)

Query: 213 ENVRVILKWRDPQLQPYQGTGAAIKSHDIYSTLRAIKSELITPERENKEDLLYLDYDAKK 272
           +  RV L+W D + +P      +I S DI   +   +S        +K   L L YD+  
Sbjct: 310 QKTRVTLRWIDSKFKPNNYQSVSIISEDIIDVINFYRS------NNDKIKRLPLKYDSLT 363

Query: 273 KDWFVPDLYLPPGIYRLKFLINGM-LLHSNFLPTATDAAGTIVNWFEVLPGYETIEPYRD 331
            +W + DL+LP G Y   FLIN   + HS  + T  D  G  VN+FEV     T EP + 
Sbjct: 364 HEWKISDLFLPAGYYEFSFLINETDVHHSLHICTKMDRFGKRVNYFEVPKYVRTFEPLQL 423

Query: 332 ESMIGQDDESIDSQPYKSTTDVTDYAGIXXXXXXXXXXXXXNLRLPNLHITSLNKESSAS 391
            S +    ++ D +  + +   +++  +                L N  I +     +A+
Sbjct: 424 SSALYTVTQADDRRHIECSKTSSEFLNL----------------LDNYDIRT---RYNAN 464

Query: 392 VNEANETNEGNDIQLLPEPKYEYSTEIPELFQFDDVNTRKTNDIKEVRKESKLETLYP-- 449
               NE+  GN+         +Y+ +IPELF+F + N      I+E+  E+++  L P  
Sbjct: 465 FYSHNESGTGNNFN-----NNKYTNQIPELFKFSEKN------IRELSTETEITFLEPPS 513

Query: 450 NGKFDFTLARVVNSNQDALFASIQKIGKMTTEEAEEYFLTKFKVSDLPIY---------- 499
            G+  F    +V+ +Q+ LF S+Q+ G + +  AE+  L ++ VS+LPI+          
Sbjct: 514 YGEPSF-YNNIVDCSQEKLFLSLQQNGAVDSYVAEQVILQRYPVSELPIFFENISMEKLA 572

Query: 500 -----LNSTYLNKNF-----SGEVNHIIP----HVNLRHLLTTSIKEDIICVGCTTRYAG 545
                LN ++ NK++       E ++I P    HV L HL+T  I  +++ V  TTRY  
Sbjct: 573 SHNNNLNKSHTNKHWLEGLTPNESDNITPKEPPHVILNHLVTQKISRNVVSVAVTTRYKQ 632

Query: 546 KFITQVIYAPCSYD 559
           K+ITQ++Y+P   D
Sbjct: 633 KYITQILYSPIKPD 646

>Suva_7.53 Chr7 (93895..95139) [1245 bp, 414 aa] {ON} YGL208W (REAL)
          Length = 414

 Score = 78.6 bits (192), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 78/294 (26%), Positives = 118/294 (40%), Gaps = 72/294 (24%)

Query: 263 LLYLDYDAKKKDWFVPDLYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEVLPG 322
           ++ L  D+ K   F   L L PG +R +F+++  L  S+FLPTATD  G  VN+ EV   
Sbjct: 188 MIGLVPDSDKSGSFHVKLRLLPGTHRFRFVVDNELRVSDFLPTATDQMGNFVNYIEVR-- 245

Query: 323 YETIEPYRDESMIGQDDESIDSQPYKSTTDVTDYAGIXXXXXXXXXXXXXNLRLPNLHIT 382
                 + D+  I  D  +I    Y     ++D + I                   L I 
Sbjct: 246 ------HPDKKSI--DGTNISKTKYSVKPPISDRSSIA------------------LQIG 279

Query: 383 SLNKESSASVNEANETNEGNDIQLLPEPKYEYSTEIPELFQFDDVNTRKTNDIKEVRKES 442
               +        +E        L P+P  EY+T+IP +F    V  R            
Sbjct: 280 KDPDDFGDGYTRFHE-------DLSPKPPAEYTTDIPAVFTDPSVMER------------ 320

Query: 443 KLETLYPNGKFDFTLARVVNSNQDALFASIQKIGKMTTEEAEEYFLTKFKVSDLPIYLNS 502
                     + +TL R  N N  +     Q   ++      +Y  T+ +V         
Sbjct: 321 ----------YYYTLDREKNKNDTSWLTPPQLPPQLENVILNKYCTTQDQV--------- 361

Query: 503 TYLNKNFSGEVNHIIP-HVNLRHLLTTSIKEDIICVGCTTRYAGKFITQVIYAP 555
              N+N SG +   IP HV L HL+T+SIK + +CV    RY  K++TQ++Y P
Sbjct: 362 ---NENNSGALP--IPNHVVLNHLITSSIKHNTLCVSSIVRYKQKYVTQILYTP 410

>Smik_7.55 Chr7 (92235..93482) [1248 bp, 415 aa] {ON} YGL208W (REAL)
          Length = 415

 Score = 77.0 bits (188), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 73/294 (24%), Positives = 113/294 (38%), Gaps = 72/294 (24%)

Query: 263 LLYLDYDAKKKDWFVPDLYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEVLPG 322
           ++ L  D+K    F   L L PG +R +F+++  L  S+FLPTATD  G  VN+ EV   
Sbjct: 189 MIGLIPDSKHSGAFHVKLRLLPGTHRFRFVVDNELRVSDFLPTATDQMGNFVNYIEV--- 245

Query: 323 YETIEPYRDESMIGQDDESIDSQPYKSTTDVTDYAGIXXXXXXXXXXXXXNLRLPNLHIT 382
                                 +P K  TD                    +++ P    +
Sbjct: 246 ---------------------REPEKKATD-----------GKRKSKKEYSIQAPTSDRS 273

Query: 383 SLNKESSASVNEANETNEGNDIQLLPEPKYEYSTEIPELFQFDDVNTRKTNDIKEVRKES 442
           S+  +     ++  +          P P  EY+ +IP +F    V  R            
Sbjct: 274 SIALQIGKDPDDFGDGYTRFHEDFSPRPPQEYTADIPAVFSDPSVMER------------ 321

Query: 443 KLETLYPNGKFDFTLARVVNSNQDALFASIQKIGKMTTEEAEEYFLTKFKVSDLPIYLNS 502
                     + +TL R  N N  +          +   + E   L K+       Y+  
Sbjct: 322 ----------YYYTLDREQNHNDTSWLTP-----PLLPPQLENVILNKY-------YMTQ 359

Query: 503 TYLNKNFSGEVNHIIP-HVNLRHLLTTSIKEDIICVGCTTRYAGKFITQVIYAP 555
              N+N SG +   IP HV L HL+T+SIK + +CV    RY  K++TQ++YAP
Sbjct: 360 DQFNENNSGALP--IPNHVVLNHLITSSIKHNTLCVASIVRYKQKYVTQILYAP 411

>YGL208W Chr7 (97338..98585) [1248 bp, 415 aa] {ON}  SIP2One of
           three beta subunits of the Snf1 serine/threonine protein
           kinase complex involved in the response to glucose
           starvation; null mutants exhibit accelerated aging;
           N-myristoylprotein localized to the cytoplasm and the
           plasma membrane
          Length = 415

 Score = 76.6 bits (187), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 72/277 (25%), Positives = 110/277 (39%), Gaps = 72/277 (25%)

Query: 280 LYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEVLPGYETIEPYRDESMIGQDD 339
           L L PG +R +F+++  L  S+FLPTATD  G  VN+ EV                    
Sbjct: 206 LRLLPGTHRFRFIVDNELRVSDFLPTATDQMGNFVNYIEV-------------------- 245

Query: 340 ESIDSQPYKSTTDVTDYAGIXXXXXXXXXXXXXNLRLPNLHITSLNKESSASVNEANETN 399
                QP K+ T+                    ++R P    +S+  +     ++  +  
Sbjct: 246 ----RQPEKNPTN-----------EKIRSKEADSMRPPTSDRSSIALQIGKDPDDFGDGY 290

Query: 400 EGNDIQLLPEPKYEYSTEIPELFQFDDVNTRKTNDIKEVRKESKLETLYPNGKFDFTLAR 459
                 L P P  EY+T+IP +F    V  R                      + +TL R
Sbjct: 291 TRFHEDLSPRPPLEYTTDIPAVFTDPSVMER----------------------YYYTLDR 328

Query: 460 VVNSNQDALFASIQKIGKMTTEEAEEYFLTKFKVSDLPIYLNSTYLNKNFSGEVNHIIP- 518
              SN D  + +  ++      + E   L K+       Y      N+N SG +   IP 
Sbjct: 329 Q-QSNTDTSWLTPPQL----PPQLENVILNKY-------YATQDQFNENNSGALP--IPN 374

Query: 519 HVNLRHLLTTSIKEDIICVGCTTRYAGKFITQVIYAP 555
           HV L HL+T+SIK + +CV    RY  K++TQ++Y P
Sbjct: 375 HVVLNHLVTSSIKHNTLCVASIVRYKQKYVTQILYTP 411

>Skud_7.60 Chr7 (102699..104024) [1326 bp, 441 aa] {ON} YGL208W
           (REAL)
          Length = 441

 Score = 76.3 bits (186), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 77/293 (26%), Positives = 114/293 (38%), Gaps = 70/293 (23%)

Query: 263 LLYLDYDAKKKDWFVPDLYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEVLPG 322
           ++ L  DA K   F   L L PG +R +F+++  L  S+FLPTATD  G  VN+      
Sbjct: 215 MIGLIPDANKNGLFHVKLRLLPGTHRFRFIVDNELRVSDFLPTATDQMGNFVNYI----- 269

Query: 323 YETIEPYRDESMIGQDDESIDSQPYKSTTDVTDYAGIXXXXXXXXXXXXXNLRLPNLHIT 382
            E  +P +  +    DD+    + Y      +D + I                   L I 
Sbjct: 270 -EVRQPQKKLT----DDKKRFKKAYLMQPPTSDRSSIA------------------LQIG 306

Query: 383 SLNKESSASVNEANETNEGNDIQLLPEPKYEYSTEIPELFQFDDVNTRKTNDIKEVRKES 442
               +        +E        L P+P  EY+T IP +F    V  R            
Sbjct: 307 KDPDDFGDGYTRFHE-------DLSPKPSLEYTTNIPAVFTDPSVMER------------ 347

Query: 443 KLETLYPNGKFDFTLARVVNSNQDALFASIQKIGKMTTEEAEEYFLTKFKVSDLPIYLNS 502
                     + +TL R  N N  +     Q   ++     E   L K+       Y   
Sbjct: 348 ----------YYYTLDREQNQNDTSWLTPPQLPPQL-----ENVILNKY-------YATQ 385

Query: 503 TYLNKNFSGEVNHIIPHVNLRHLLTTSIKEDIICVGCTTRYAGKFITQVIYAP 555
              N+N SG +  I  HV L HL+T+SIK + +CV    RY  K++TQ++Y P
Sbjct: 386 DQFNENNSGAL-PIPNHVVLNHLVTSSIKHNTLCVASIVRYKQKYVTQILYTP 437

>KAFR0I02380 Chr9 (482219..483448) [1230 bp, 409 aa] {ON} Anc_3.517
           YER027C
          Length = 409

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 74/294 (25%), Positives = 124/294 (42%), Gaps = 72/294 (24%)

Query: 276 FVPDLYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEVLPGYETIEPYRDESMI 335
           F   L LPPG +R +F+++  L  S++LPTATD  G  VN+ EV+     +      +  
Sbjct: 174 FYVKLQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEVIAPATEVTGAPTTTTF 233

Query: 336 GQDDESIDSQPYKSTTDVTDYAGIXXXXXXXXXXXXXNLRLPNLHITSLNKESSASVNEA 395
           G  D S  SQ  +      + A I               ++ N  +++ ++ +     E 
Sbjct: 234 GTWDSSAQSQQAQQQNLQQNEASI---------------KVENQPLSARSRIALQIEREP 278

Query: 396 NETNEG----NDIQLLPEPKYEYSTEIPELFQFDDVNTRKTNDIKEVRKESKLETLYPNG 451
           +E  +G    +D ++  +P+Y+Y+ +IP +F                   + +E  Y   
Sbjct: 279 DEMGDGFSRFHD-EMPQKPQYDYTQDIPAVF----------------TDPTVMEQYY--- 318

Query: 452 KFDFTLARVVNSNQDALFASIQKIGKMTTEEAEEYFLTKFKVSDLPIYLNSTYLN--KNF 509
               TL +  N++Q+  + +  +                     LP +L +  LN   N 
Sbjct: 319 ---LTLDQQQNNHQNMAWLTPPQ---------------------LPPHLENVILNSYSNS 354

Query: 510 SGEVNH-------IIPHVNLRHLLTTSIKEDIICVGCTTRYAGKFITQVIYAPC 556
            GE N        I  HV L HL T+SIK + +CV    RY  K++TQ++YAP 
Sbjct: 355 QGESNENTSGALPIPNHVILNHLATSSIKHNTLCVASIVRYRQKYVTQILYAPL 408

>Ecym_1210 Chr1 (423627..424979) [1353 bp, 450 aa] {ON} similar to
           Ashbya gossypii AER361C
          Length = 450

 Score = 70.9 bits (172), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 75/293 (25%), Positives = 115/293 (39%), Gaps = 78/293 (26%)

Query: 280 LYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEVLPGYETIEPYRDESMIGQDD 339
           L LPPG +R +F+++  L  S+FLPTATD  G  VN+ E++                   
Sbjct: 217 LQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYMEIV----------------ASP 260

Query: 340 ESIDSQPYKSTTDVTDYAGIXXXXXXXXXXXXXNLRLPNLHITSLNKESSASVNEANETN 399
            S + QP      V+D   I                    H+ ++ +  S + + A +  
Sbjct: 261 PSQEQQPASDLQYVSDEGPISK------------------HVENIREGRSDAASAAVDEE 302

Query: 400 EGNDIQLLPEPKYEYSTEIPELFQFDDVNTRKTNDIKEVRKESKLETLYPNGKFDFTLAR 459
            G             S+      Q +D      +     R+ESK   +Y     +FT   
Sbjct: 303 RG------------MSSRSKLALQIEDDPDDMGDGYTRFREESKEIPVY-----EFT--- 342

Query: 460 VVNSNQD--ALFASIQKIGK----MTTEEAEEYFLTKFKVSDLPIYLNSTYLN------- 506
                QD  A+F     +G+    +  ++  +  L       LP +L    LN       
Sbjct: 343 -----QDIPAVFTDPSVMGQYYLTLDQQKNNQQNLAWLTPPQLPPHLEHVILNHYNKSAD 397

Query: 507 ---KNFSGEVNHIIP-HVNLRHLLTTSIKEDIICVGCTTRYAGKFITQVIYAP 555
              +N SG +   IP HV L HL T+SIK + +CV    RY  K+ TQ++YAP
Sbjct: 398 GASENTSGALP--IPNHVVLNHLATSSIKHNTLCVASIVRYKSKYATQILYAP 448

>KNAG0B03690 Chr2 (708946..709926) [981 bp, 326 aa] {ON} Anc_5.527
           YDR422C
          Length = 326

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 43/128 (33%), Positives = 64/128 (50%), Gaps = 15/128 (11%)

Query: 216 RVILKWRDPQLQPYQGTGAAIKSHDIYSTLRAIKSELITPERENKEDLLY---LDYDAKK 272
           +V L++RD    P++    AI+  DI S L          +R  K   L    L ++   
Sbjct: 71  KVKLRFRDSHTIPFRVHSVAIQGTDITSKL----------QRTGKMGGLQQIPLQFEGDS 120

Query: 273 KDWFVPDLYLPPGIYRLKFLINGML-LHSNFLPTATDAAGTIVNWFEVLPGYETIEP-YR 330
            +W  PDLYLPPG Y+ +F+IN    +HS +LP  T   G   N+F V+   E +EP   
Sbjct: 121 SEWVAPDLYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVIENDEVVEPAVA 180

Query: 331 DESMIGQD 338
            ++ +GQD
Sbjct: 181 ADAPMGQD 188

 Score = 34.3 bits (77), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 43/100 (43%), Gaps = 4/100 (4%)

Query: 464 NQDALFASIQKIGKMTTEEAEEYFLTKFKVSDLPIYLNSTYLN-KNFSGEVNHIIPHVNL 522
           NQ   F    +     + + +  F  ++ V  +P Y  S  +  ++ + +V   I   NL
Sbjct: 227 NQKTFFYYAFQEQDAASGDYDAQFCERYTVPIIPPYFYSIDITPQDNTLKVPLPIQLANL 286

Query: 523 RHLLTTS---IKEDIICVGCTTRYAGKFITQVIYAPCSYD 559
              +  S   I  D +C+GC   Y GK++  + Y P  ++
Sbjct: 287 NRTIFPSPEDICNDYLCIGCVISYRGKYMAHLFYRPSPWE 326

>CAGL0K09350g Chr11 complement(922651..923949) [1299 bp, 432 aa]
           {ON} similar to uniprot|P34164 Saccharomyces cerevisiae
           YGL208w SIP2 or uniprot|Q04739 Saccharomyces cerevisiae
           YER027c GAL83
          Length = 432

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 72/286 (25%), Positives = 115/286 (40%), Gaps = 69/286 (24%)

Query: 276 FVPDLYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEVLPGYETIEPYRDESMI 335
           F   L L PG +R +F+++  L  S+ LPTATD  G  VN+ EV     +  P  D +  
Sbjct: 209 FKIKLQLAPGTHRFRFIVDNQLRFSDNLPTATDQMGNFVNYLEV-----SAVPKSDSTSS 263

Query: 336 GQDDESIDSQPYKSTTDVTDYAGIXXXXXXXXXXXXXNLRLPNLHITSLNKESSASVNEA 395
               E  D    KS + V+                          +  L+  S  ++   
Sbjct: 264 RTGKERKDKN-KKSVSKVSKDRST---------------------VGPLSARSCIALEIE 301

Query: 396 NETNEGND------IQLLPEPKYEYSTEIPELFQFDDVNTRKTNDIKEVRKESKLETLYP 449
            E ++  D       +L  EPKYE+S+EIP +F    +  + T + ++ +K + +  L P
Sbjct: 302 KEPDDFGDGYTRYHEELPQEPKYEFSSEIPAIFVDQSIIEQLTME-RQRKKSNNMSWLTP 360

Query: 450 NGKFDFTLARVVNSNQDALFASIQKIGKMTTEEAEEYFLTKFKVSDLPIYLNSTYLNKNF 509
             +    L  V+          + K G+  ++  E           LPI           
Sbjct: 361 -PQLPPQLENVI----------LNKFGEPLSQSTEN------NAGALPI----------- 392

Query: 510 SGEVNHIIPHVNLRHLLTTSIKEDIICVGCTTRYAGKFITQVIYAP 555
               NH +    L HL+TTSIK + +CV    RY  K+++Q+ Y P
Sbjct: 393 ---PNHSV----LNHLVTTSIKHNTLCVATNNRYRQKYVSQIYYVP 431

>Kwal_47.19040 s47 complement(1073036..1074325) [1290 bp, 429 aa]
           {ON} YER027C (GAL83) - glucose repression protein, a
           component of the Snf1 complex [contig 188] FULL
          Length = 429

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 76/302 (25%), Positives = 114/302 (37%), Gaps = 66/302 (21%)

Query: 280 LYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEVLPGYETIEPYRDESMIGQDD 339
           L LPPG +R +F+++  L  S+FLPTATD  G  VN+       E + P   E  I Q  
Sbjct: 168 LQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYL------EIVSPTESEDHIQQQQ 221

Query: 340 E------------------SIDSQPYKSTTDVTDYAGIXXXXXXXXXXXXXNLRLPNLHI 381
                              ++DSQ Y +     D + +               R P+   
Sbjct: 222 PQQQQQQQQQQQQQQQQKQALDSQ-YPAQIGSDDKSQVSAQVPDHKRHR--GTRPPDSKS 278

Query: 382 TSLNKESSASVNEANETNEGNDI------QLLPEPKYEYSTEIPELFQFDDVNTRKTNDI 435
             L+  S  ++    E ++  D            P Y Y+T+IP +F             
Sbjct: 279 EPLSARSKLALQIEEEPDDMGDGYSRFHGAAEASPDYSYTTDIPAVF------------- 325

Query: 436 KEVRKESKLETLYPNGKFDFTLARVVNSNQDALFASIQKIGKMTTEEAEEYFLTKFKVSD 495
                 S +E  Y       TL +  N+ Q   + +  ++        E   L  +    
Sbjct: 326 ---TDSSVMEQYY------LTLDQQQNNQQSMAWLTPPQL----PPHLENVILNNYSSQS 372

Query: 496 LPIYLNSTYLNKNFSGEVNHIIP-HVNLRHLLTTSIKEDIICVGCTTRYAGKFITQVIYA 554
            P    S    +N SG +   IP HV L HL T+SIK   +CV    RY  K+ TQ++Y+
Sbjct: 373 EPGDSGS----ENNSGALP--IPNHVVLNHLATSSIKHSTLCVASIVRYKRKYATQILYS 426

Query: 555 PC 556
           P 
Sbjct: 427 PL 428

>NCAS0E00620 Chr5 (106661..108163) [1503 bp, 500 aa] {ON} Anc_3.517
          Length = 500

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/155 (31%), Positives = 66/155 (42%), Gaps = 52/155 (33%)

Query: 410 PKYEYSTEIPELFQFDDVNTRKTNDIKEVRKESKLETLYPNGKFDFTLARVVNSNQDALF 469
           P +EY+ EIP +F    V                +E  Y       TL R  NSN  +L 
Sbjct: 389 PNFEYTQEIPTVFTDPKV----------------MEEYY------LTLDRKKNSNSSSL- 425

Query: 470 ASIQKIGKMTTEEAEEYFLTKFKVSDLPIYLNSTYLN-------KNFSGEVNHIIP-HVN 521
                            +LT      LP +L +  LN       +N SG +   IP HV 
Sbjct: 426 ----------------QWLTP---PQLPPHLENIILNSSQDTSNENTSGAL--PIPNHVV 464

Query: 522 LRHLLTTSIKEDIICVGCTTRYAGKFITQVIYAPC 556
           L HL+TTSIK + +CV    RY  K++TQ++YAP 
Sbjct: 465 LNHLVTTSIKHNTLCVASIIRYKHKYVTQILYAPL 499

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 30/48 (62%)

Query: 272 KKDWFVPDLYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEV 319
           K+  F   L LP G +R +F+++  L  S+FLPTATD  G  VN+ EV
Sbjct: 263 KQGLFHVKLQLPAGTHRFRFIVDNELKFSDFLPTATDQTGNFVNYLEV 310

>KLLA0B00583g Chr2 complement(44819..46279) [1461 bp, 486 aa] {ON}
           uniprot|Q00995 Kluyveromyces lactis FOG1 protein
          Length = 486

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 30/42 (71%)

Query: 280 LYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEVLP 321
           L LPPG +R +F+++  L  S+FLPTATD  G  VN+ E++P
Sbjct: 241 LQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEIVP 282

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 25/38 (65%)

Query: 519 HVNLRHLLTTSIKEDIICVGCTTRYAGKFITQVIYAPC 556
           HV L HL T+SIK + +CV    RY  K+ TQ++YAP 
Sbjct: 448 HVVLNHLATSSIKHNTLCVASIVRYKRKYATQILYAPL 485

>KNAG0B00600 Chr2 (97910..99079) [1170 bp, 389 aa] {ON} Anc_3.517
           YER027C
          Length = 389

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 29/37 (78%)

Query: 519 HVNLRHLLTTSIKEDIICVGCTTRYAGKFITQVIYAP 555
           +V L HLLT+SIK +++C+GC+ RY  K++TQV Y P
Sbjct: 351 YVTLNHLLTSSIKNNMLCLGCSVRYRQKYVTQVYYTP 387

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 34/52 (65%)

Query: 280 LYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEVLPGYETIEPYRD 331
           L LP G ++ +F+++  L  S+FLPTATD  G  VN+ EV P  ET+E  +D
Sbjct: 193 LKLPVGTHKFRFVVDNELRFSDFLPTATDQTGNFVNYIEVKPSEETLELEKD 244

>CAGL0A03696g Chr1 (377255..378502) [1248 bp, 415 aa] {ON} similar
           to uniprot|Q04739 Saccharomyces cerevisiae YER027c GAL83
           glucose repression protein
          Length = 415

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 29/42 (69%)

Query: 280 LYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEVLP 321
           L LPPG +R +F+++  L  S+FLPTATD  G  VN+ E+ P
Sbjct: 202 LQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEIAP 243

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 38/70 (54%), Gaps = 9/70 (12%)

Query: 496 LPIYLNSTYLNK--NFSGEVNH-------IIPHVNLRHLLTTSIKEDIICVGCTTRYAGK 546
           LP +L +  LN   N  GE N        I  HV L HL T+SIK + +CV    RY  K
Sbjct: 345 LPPHLENVILNSYSNAQGESNENNSGALPIPNHVILNHLATSSIKHNTLCVASIVRYKRK 404

Query: 547 FITQVIYAPC 556
           ++TQ++YAP 
Sbjct: 405 YVTQILYAPL 414

>TBLA0I03270 Chr9 complement(793849..795150) [1302 bp, 433 aa] {ON}
           Anc_3.517 YER027C
          Length = 433

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 43/70 (61%), Gaps = 5/70 (7%)

Query: 280 LYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEVLPGYETIEPYRDESMIGQ-D 338
           L LPPG +R +F+++  L  S+FLPTATD  G  VN+ EV+    T+    DE++ G   
Sbjct: 202 LQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEVVAPPTTV----DENIGGNLP 257

Query: 339 DESIDSQPYK 348
           +++ DS  Y+
Sbjct: 258 NQTADSSNYQ 267

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 36/58 (62%), Gaps = 3/58 (5%)

Query: 499 YLNSTYLNKNFSGEVNHIIP-HVNLRHLLTTSIKEDIICVGCTTRYAGKFITQVIYAP 555
           Y  S   N+N SG +   IP HV L HL T+SIK + +CV    RY  K++TQ++YAP
Sbjct: 376 YSGSGSDNENTSGAL--PIPNHVVLNHLATSSIKHNTLCVASIVRYKSKYVTQILYAP 431

>SAKL0F02002g Chr6 (167591..169102) [1512 bp, 503 aa] {ON} similar
           to gnl|GLV|CAGL0A03696g Candida glabrata CAGL0A03696g
           and similar to YER027C uniprot|Q04739 Saccharomyces
           cerevisiae YER027C GAL83 One of three possible
           beta-subunits of the Snf1 kinase complex allows nuclear
           localization of the Snf1 kinase complex in the presence
           of a nonfermentable carbon source contains
           glycogen-binding domain and similar to YGL208W
           uniprot|P34164 Saccharomyces cerevisiae YGL208W SIP2
           Member of a family of proteins including Sip1p and
           Gal83p that interact with Snf1p and Snf4p and are
           involved in the response to glucose starvation component
           of Snf1 protein complex involved in response to glucose
           starvation
          Length = 503

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 20/42 (47%), Positives = 30/42 (71%)

Query: 280 LYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEVLP 321
           L LPPG +R +F+++  L  S++LPTATD  G  VN+ E++P
Sbjct: 253 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEIVP 294

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (67%)

Query: 519 HVNLRHLLTTSIKEDIICVGCTTRYAGKFITQVIYAP 555
           HV L HL T+SIK + +CV    RY  K+ TQ++YAP
Sbjct: 465 HVVLNHLATSSIKHNTLCVASIVRYKSKYATQILYAP 501

>TDEL0D05850 Chr4 complement(1062927..1064141) [1215 bp, 404 aa]
           {ON} Anc_3.517 YER027C
          Length = 404

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 34/52 (65%), Gaps = 3/52 (5%)

Query: 506 NKNFSGEVNHIIP-HVNLRHLLTTSIKEDIICVGCTTRYAGKFITQVIYAPC 556
           N+N SG +   IP HV L HL T+SIK + +CV    RY  K++TQ++YAP 
Sbjct: 354 NENNSGAL--PIPNHVVLNHLATSSIKHNTLCVASIVRYKRKYVTQILYAPL 403

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 28/41 (68%)

Query: 280 LYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEVL 320
           L LP G +R +F+++  L  S++LPTATD  G  VN+ EV+
Sbjct: 187 LQLPVGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEVI 227

>TPHA0A05810 Chr1 complement(1317530..1318804) [1275 bp, 424 aa]
           {ON} Anc_3.517 YER027C
          Length = 424

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 20/42 (47%), Positives = 29/42 (69%)

Query: 280 LYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEVLP 321
           L LPPG ++ +F+++  L  S+FLPTATD  G  VN+ E +P
Sbjct: 183 LQLPPGTHKFRFIVDNELRFSDFLPTATDQMGNFVNYLEAVP 224

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 26/38 (68%)

Query: 519 HVNLRHLLTTSIKEDIICVGCTTRYAGKFITQVIYAPC 556
           HV L HL T+SIK + +CV    RY  K++TQ++YAP 
Sbjct: 386 HVVLHHLATSSIKHNTLCVASIVRYKRKYVTQILYAPL 423

>Kpol_195.2 s195 complement(4330..5637) [1308 bp, 435 aa] {ON}
           complement(4330..5637) [1308 nt, 436 aa]
          Length = 435

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 35/57 (61%), Gaps = 3/57 (5%)

Query: 501 NSTYLNKNFSGEVNHIIP-HVNLRHLLTTSIKEDIICVGCTTRYAGKFITQVIYAPC 556
           NS    +N SG +   IP HV L HL T+SIK + +CV    RY  K++TQ++YAP 
Sbjct: 380 NSPETGQNNSGSL--PIPNHVVLNHLATSSIKHNTLCVASIVRYKRKYVTQILYAPL 434

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 28/41 (68%)

Query: 280 LYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEVL 320
           L LPPG ++ +F+++  L  S+FLPTATD  G  VN+ E +
Sbjct: 178 LQLPPGTHKFRFIVDNELRFSDFLPTATDQMGNFVNYLEAV 218

>KNAG0E01590 Chr5 complement(317054..318325) [1272 bp, 423 aa] {ON}
           Anc_3.517 YER027C
          Length = 423

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 37/70 (52%), Gaps = 9/70 (12%)

Query: 496 LPIYLNSTYLNK--NFSGEVNH-------IIPHVNLRHLLTTSIKEDIICVGCTTRYAGK 546
           LP +L +  LN   +  GE N        I  HV L HL T+SIK + +CV    RY  K
Sbjct: 353 LPPHLENVILNSYSSLQGESNENNSGALPIPNHVILNHLATSSIKHNTLCVASIVRYKQK 412

Query: 547 FITQVIYAPC 556
           + TQ++YAP 
Sbjct: 413 YATQILYAPL 422

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 29/41 (70%)

Query: 280 LYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEVL 320
           L LPPG ++ +F+++  L  S++LPTATD  G  VN+ EV+
Sbjct: 192 LQLPPGTHKFRFIVDNELRFSDYLPTATDQMGNFVNYLEVV 232

>NCAS0F03730 Chr6 complement(750798..752096) [1299 bp, 432 aa] {ON}
           Anc_3.517 YER027C
          Length = 432

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 34/52 (65%), Gaps = 3/52 (5%)

Query: 506 NKNFSGEVNHIIP-HVNLRHLLTTSIKEDIICVGCTTRYAGKFITQVIYAPC 556
           N+N SG +   IP HV L HL T+SIK + +CV    RY  K++TQ++YAP 
Sbjct: 382 NENNSGAL--PIPNHVILNHLATSSIKHNTLCVASIVRYKRKYVTQILYAPL 431

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 28/40 (70%)

Query: 280 LYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEV 319
           L LPPG +R +F+++  L  S++LPTATD  G  VN+ E+
Sbjct: 207 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEI 246

>Suva_5.123 Chr5 complement(184865..186136) [1272 bp, 423 aa] {ON}
           YER027C (REAL)
          Length = 423

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 33/52 (63%), Gaps = 3/52 (5%)

Query: 506 NKNFSGEVNHIIP-HVNLRHLLTTSIKEDIICVGCTTRYAGKFITQVIYAPC 556
           N+N SG +   IP HV L HL T+SIK + +CV    RY  K++TQ++Y P 
Sbjct: 373 NENTSGAL--PIPNHVILNHLATSSIKHNTLCVASIVRYKQKYVTQILYTPL 422

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 28/40 (70%)

Query: 280 LYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEV 319
           L LPPG +R +F+++  L  S++LPTATD  G  VN+ EV
Sbjct: 207 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEV 246

>Smik_5.150 Chr5 complement(213879..215132) [1254 bp, 417 aa] {ON}
           YER027C (REAL)
          Length = 417

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 38/67 (56%), Gaps = 6/67 (8%)

Query: 496 LPIYLNSTYLNKNFSGEVNHI-----IP-HVNLRHLLTTSIKEDIICVGCTTRYAGKFIT 549
           LP +L +  LN   + + ++      IP HV L HL T+SIK + +CV    RY  K++T
Sbjct: 350 LPPHLENVILNSYSNAQTDNTSGALPIPNHVILNHLATSSIKHNTLCVASIVRYKQKYVT 409

Query: 550 QVIYAPC 556
           Q++Y P 
Sbjct: 410 QILYTPL 416

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 44/78 (56%), Gaps = 4/78 (5%)

Query: 280 LYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEVL-PGYETIEPYR---DESMI 335
           L LPPG +R +F+++  L  S++LPTATD  G  VN+ EV  P   + EP +   D    
Sbjct: 204 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEVTAPPDWSSEPQQQGSDNKAN 263

Query: 336 GQDDESIDSQPYKSTTDV 353
             DD+ ++ +P  + + +
Sbjct: 264 YADDDKLNKRPMSARSRI 281

>ZYRO0E08404g Chr5 complement(672301..673347) [1047 bp, 348 aa] {ON}
           some similarities with uniprot|Q04739 Saccharomyces
           cerevisiae YER027C GAL83 One of three possible beta-
           subunits of the Snf1 kinase complex allows nuclear
           localization of the Snf1 kinase complex in the presence
           of a nonfermentable carbon source contains
           glycogen-binding domain and some similarities with
           YGL208W uniprot|P34164 Saccharomyces cerevisiae YGL208W
           SIP2 Member of a family of proteins including Sip1p and
           Gal83p that interact with Snf1p and Snf4p and are
           involved in the response to glucose starvation component
           of Snf1 protein complex involved in response to glucose
           starvation
          Length = 348

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 34/51 (66%), Gaps = 3/51 (5%)

Query: 506 NKNFSGEVNHIIP-HVNLRHLLTTSIKEDIICVGCTTRYAGKFITQVIYAP 555
           N+N SG +   IP HV L HL T+SIK + +CV    RY  K++TQ++YAP
Sbjct: 298 NENNSGALP--IPNHVVLNHLATSSIKHNTLCVASIVRYKRKYVTQILYAP 346

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 27/40 (67%)

Query: 280 LYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEV 319
           L LP G +R +F+++  L  S++LPTATD  G  VN+ E+
Sbjct: 155 LQLPIGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEI 194

>Skud_5.136 Chr5 complement(206871..208127) [1257 bp, 418 aa] {ON}
           YER027C (REAL)
          Length = 418

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 38/66 (57%), Gaps = 6/66 (9%)

Query: 496 LPIYLNSTYLNKNFSGEVNHI-----IP-HVNLRHLLTTSIKEDIICVGCTTRYAGKFIT 549
           LP +L +  LN   + + ++      IP HV L HL T+SIK + +CV    RY  K++T
Sbjct: 351 LPPHLENVILNSYSNAQTDNTSGALPIPNHVILNHLATSSIKHNTLCVASIVRYKQKYVT 410

Query: 550 QVIYAP 555
           Q++Y P
Sbjct: 411 QILYTP 416

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 28/40 (70%)

Query: 280 LYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEV 319
           L LPPG +R +F+++  L  S++LPTATD  G  VN+ EV
Sbjct: 205 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEV 244

>YER027C Chr5 complement(208979..210232) [1254 bp, 417 aa] {ON}
           GAL83One of three possible beta-subunits of the Snf1
           kinase complex, allows nuclear localization of the Snf1
           kinase complex in the presence of a nonfermentable
           carbon source; contains glycogen-binding domain
          Length = 417

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 38/67 (56%), Gaps = 6/67 (8%)

Query: 496 LPIYLNSTYLNKNFSGEVNHI-----IP-HVNLRHLLTTSIKEDIICVGCTTRYAGKFIT 549
           LP +L +  LN   + + ++      IP HV L HL T+SIK + +CV    RY  K++T
Sbjct: 350 LPPHLENVILNSYSNAQTDNTSGALPIPNHVILNHLATSSIKHNTLCVASIVRYKQKYVT 409

Query: 550 QVIYAPC 556
           Q++Y P 
Sbjct: 410 QILYTPL 416

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 28/40 (70%)

Query: 280 LYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEV 319
           L LPPG +R +F+++  L  S++LPTATD  G  VN+ EV
Sbjct: 204 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEV 243

>NDAI0B06010 Chr2 complement(1460221..1461732) [1512 bp, 503 aa]
           {ON} Anc_3.517 YER027C
          Length = 503

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 26/38 (68%)

Query: 519 HVNLRHLLTTSIKEDIICVGCTTRYAGKFITQVIYAPC 556
           HV L HL T+SIK + +CV    RY  K++TQ++YAP 
Sbjct: 465 HVILNHLATSSIKHNTLCVASIVRYKRKYVTQILYAPL 502

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 28/40 (70%)

Query: 280 LYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEV 319
           L LPPG +R +F+++  L  S++LPTATD  G  VN+ E+
Sbjct: 251 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEI 290

>AER361C Chr5 complement(1307677..1309104) [1428 bp, 475 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER027C
           (GAL83) and YGL208W (SIP2)
          Length = 475

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 38/72 (52%), Gaps = 13/72 (18%)

Query: 496 LPIYLNSTYLN----------KNFSGEVNHIIP-HVNLRHLLTTSIKEDIICVGCTTRYA 544
           LP +L    LN          +N SG +   IP HV L HL T+SIK + +CV    RY 
Sbjct: 405 LPPHLEHVILNHYNKSADGVSENTSGALP--IPNHVVLNHLATSSIKHNTLCVASIVRYK 462

Query: 545 GKFITQVIYAPC 556
            K+ TQ++YAP 
Sbjct: 463 QKYATQILYAPL 474

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 34/58 (58%)

Query: 263 LLYLDYDAKKKDWFVPDLYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEVL 320
           ++ L  D  +   F   L LPPG +R +F+++  L  S+FL TATD  G  VN+ E++
Sbjct: 219 MIGLVADPARPGVFQIKLQLPPGTHRFRFIVDNELRFSDFLLTATDQMGNFVNYLEIV 276

>NDAI0I02890 Chr9 complement(682274..684022) [1749 bp, 582 aa] {ON}
           Anc_3.517 YER027C
          Length = 582

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (62%), Gaps = 3/51 (5%)

Query: 507 KNFSGEVNHIIP-HVNLRHLLTTSIKEDIICVGCTTRYAGKFITQVIYAPC 556
           +N SG +   IP HV L HL+TTSIK + +CV    RY  K+ TQ++Y P 
Sbjct: 533 ENISGAL--PIPNHVVLNHLVTTSIKHNTLCVASIIRYKHKYATQILYTPL 581

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 33/57 (57%)

Query: 263 LLYLDYDAKKKDWFVPDLYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEV 319
           ++ L  D +K       L LP G +R +F+++  L  S++LPTATD  G  VN+ EV
Sbjct: 263 MISLIPDPEKPGTLHVKLQLPEGTHRFRFIVDNELRFSDYLPTATDQTGNFVNYLEV 319

>KAFR0F04140 Chr6 complement(814903..815949) [1047 bp, 348 aa] {ON}
           Anc_3.517 YER027C
          Length = 348

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 33/54 (61%)

Query: 274 DWFVPDLYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEVLPGYETIE 327
           DW    L LPPG +R +F+++  L  S+ +P+ATD+ G +VN+ EV P     E
Sbjct: 142 DWARVRLKLPPGNHRFRFVVDNELRFSDDVPSATDSMGNLVNYIEVKPSKRQYE 195

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 26/37 (70%)

Query: 519 HVNLRHLLTTSIKEDIICVGCTTRYAGKFITQVIYAP 555
           HV L HL+  S+K +++ +  TTRY  KFITQV Y+P
Sbjct: 310 HVVLNHLIVNSVKSNMLAISTTTRYKEKFITQVCYSP 346

>KLTH0G01848g Chr7 (136780..138030) [1251 bp, 416 aa] {ON} similar
           to uniprot|P34164 Saccharomyces cerevisiae YGL208W SIP2
           Member of a family of proteins including Sip1p and
           Gal83p that interact with Snf1p and Snf4p and are
           involved in the response to glucose starvation component
           of Snf1 protein complex involved in response to glucose
           starvation and similar to YER027C uniprot|Q04739
           Saccharomyces cerevisiae YER027C GAL83 One of three
           possible beta-subunits of the Snf1 kinase complex allows
           nuclear localization of the Snf1 kinase complex in the
           presence of a nonfermentable carbon source contains
           glycogen-binding domain
          Length = 416

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 28/42 (66%)

Query: 280 LYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEVLP 321
           L LPPG +R +F+++  L  S++L TATD  G  VN+ E+ P
Sbjct: 168 LQLPPGTHRFRFIVDNELRFSDYLATATDQMGNFVNYLEISP 209

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 62/148 (41%), Gaps = 33/148 (22%)

Query: 410 PKYEYSTEIPELFQFDDVNTRKTNDIKEVRKESKLETLYPNGKFDFTLARVVNSNQDALF 469
           P Y Y+T+IP +F                   S +E  Y       TL +  N+ Q   +
Sbjct: 300 PAYSYTTDIPAVFT----------------DSSVMEQYY------LTLDQQQNNQQSMAW 337

Query: 470 ASIQKIGKMTTEEAEEYFLTKFKVSDLPIYLNSTYLNKNFSGEVNHIIP-HVNLRHLLTT 528
            +  ++        E   L  +  S  P    S    +N SG +   IP HV L HL T+
Sbjct: 338 LTPPQL----PPHLENVILNNYSNSSDPGGSGS----ENNSGALP--IPNHVVLNHLATS 387

Query: 529 SIKEDIICVGCTTRYAGKFITQVIYAPC 556
           SIK + +CV    RY  K+ TQ++Y+P 
Sbjct: 388 SIKHNTLCVASIVRYKRKYATQILYSPL 415

>TDEL0G00390 Chr7 complement(80116..81762) [1647 bp, 548 aa] {ON}
           Anc_5.16 YGR278W
          Length = 548

 Score = 34.7 bits (78), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 45/87 (51%), Gaps = 2/87 (2%)

Query: 467 ALFASIQKIGKMTTEEAEEYFLTKF-KVSDLPIYLNSTYLNKNFSGEVNHIIPHVNLRHL 525
           AL   + +IG + T E+  YF+  + K+ D+  +   + L + F+ EV H I  + + HL
Sbjct: 80  ALNLIVPEIGGVLTRESTAYFIVAYNKLDDVQAFAMVSLLAQLFNYEVTHEIVILQIIHL 139

Query: 526 LTTSIKEDII-CVGCTTRYAGKFITQV 551
           L+  + E  +  +    R  GK +++V
Sbjct: 140 LSEDLNESSVHIIIHLLRQCGKHLSEV 166

>SAKL0F00748g Chr6 (64800..66923) [2124 bp, 707 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS) forms a
           complex with methionyl-tRNA synthetase (Mes1p) and Arc1p
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 707

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 55/144 (38%), Gaps = 21/144 (14%)

Query: 420 ELFQFDDVNTRKTNDIK-EVRKESKLETLYPNGKFDFTLARVVNSNQDALFASIQKIGKM 478
           EL     VN  K + IK E   + K      NG+ D   ++++N+ QD     +Q   + 
Sbjct: 18  ELIAARIVNASKADAIKIEFVDDKKAAPATFNGEADSAFSKIINAYQDVFSEGVQGSSEW 77

Query: 479 TTEEAEEYFLTKFKVSDLPIYLNSTYLNKNFSGEVNHIIPHVNLRHLLT---TSIKEDII 535
           +   +EE+ +  F               +  SG +  +   +NLR  +    T+   DI 
Sbjct: 78  SKLASEEFIIKNF---------------QKLSGSLAKLDSRLNLRTYILDSFTATPADIA 122

Query: 536 CVGC--TTRYAGKFITQVIYAPCS 557
           C G   +    G  I   +Y   S
Sbjct: 123 CWGALRSNGMVGSIIKNKVYVNVS 146

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.131    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,007,036
Number of extensions: 2499389
Number of successful extensions: 6650
Number of sequences better than 10.0: 73
Number of HSP's gapped: 6817
Number of HSP's successfully gapped: 122
Length of query: 561
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 446
Effective length of database: 40,294,809
Effective search space: 17971484814
Effective search space used: 17971484814
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)