Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0C007801.80ON51334116000.0
NCAS0J018401.80ON4453118611e-110
SAKL0C02574g1.80ON4733138461e-107
Suva_5.31.80ON4833168421e-107
Skud_5.251.80ON4833338341e-105
YEL064C (AVT2)1.80ON4803148291e-105
Smik_5.231.80ON4833148171e-103
Kwal_33.133861.80ON4693107931e-99
TDEL0C062101.80ON4793447896e-99
ZYRO0F16720g1.80ON4923207881e-98
Ecym_10841.80ON4953137862e-98
NDAI0I001301.80ON4443167762e-97
KLTH0F02332g1.80ON4693137642e-95
KLLA0C02277g1.80ON4653357572e-94
AFR671W1.80ON4882786582e-79
Ecym_71337.420ON4573041732e-12
SAKL0F13134g7.420ON5102751643e-11
Kwal_27.107027.420ON4673001501e-09
KLTH0C06006g7.420ON4453191492e-09
AGL285C7.420ON4403031402e-08
KNAG0A053802.295ON4741101359e-08
TDEL0G022502.295ON4671041341e-07
NCAS0B062102.295ON4811231322e-07
ADL205C2.295ON4681041277e-07
KAFR0L019107.420ON4452931251e-06
Kpol_1003.442.295ON4701191241e-06
ZYRO0B04026g7.420ON4362901242e-06
KLLA0E08559g2.295ON4601041232e-06
CAGL0M06611g2.295ON4851291232e-06
Smik_9.972.295ON4901131223e-06
KLTH0G10604g2.295ON468981205e-06
NDAI0B035102.295ON4961241206e-06
KNAG0B021907.420ON4611211189e-06
YIL088C (AVT7)2.295ON4901241181e-05
NDAI0E040107.420ON4713061171e-05
SAKL0E07392g2.295ON472951161e-05
Suva_9.1122.295ON4911161171e-05
TPHA0C034602.295ON4731191162e-05
Kwal_27.114852.295ON4711041162e-05
Skud_9.862.295ON4901271152e-05
Suva_5.2407.420ON4482851152e-05
Smik_5.2647.420ON4482771134e-05
KLLA0E06931g7.420ON4562961124e-05
Kpol_1045.207.420ON4662771108e-05
ZYRO0A02112g2.295ON4671211099e-05
KAFR0J013202.295ON4791191091e-04
Skud_5.2607.420ON4482771091e-04
TBLA0F014007.420ON4532791091e-04
TPHA0K006707.420ON4642871091e-04
Suva_2.287.420ON4592931063e-04
TBLA0F01390singletonON4282491036e-04
TDEL0C028207.420ON4542761028e-04
CAGL0H04587g7.420ON445114990.002
YER119C (AVT6)7.420ON448277940.007
CAGL0G03619g7.420ON460299930.009
TBLA0B072102.295ON497303910.015
YBL089W (AVT5)7.420ON459104900.020
Smik_2.317.420ON459105850.077
KNAG0C033807.420ON545106830.13
TPHA0B029802.177ON749105820.20
KLLA0D09779g5.220ON62899790.54
Kpol_1032.885.252ON57567780.66
Skud_2.197.420ON459104770.71
Ecym_33352.295ON47493770.73
KAFR0D020002.177ON714142751.6
KLLA0C13277g2.177ON721130751.7
AER380C2.177ON716143742.2
Smik_11.905.252ON68070723.1
ACR051C5.252ON67882723.8
NDAI0C037905.252ON72173723.8
SAKL0E10362g2.177ON733136714.9
NCAS0E024407.420ON495206705.5
NDAI0F026602.177ON71091689.5
Kpol_505.52.177ON68758689.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0C00780
         (513 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0C00780 Chr3 complement(137135..138676) [1542 bp, 513 aa] {O...   620   0.0  
NCAS0J01840 Chr10 (346195..347532) [1338 bp, 445 aa] {ON} Anc_1....   336   e-110
SAKL0C02574g Chr3 complement(236779..238200) [1422 bp, 473 aa] {...   330   e-107
Suva_5.3 Chr5 complement(5485..6936) [1452 bp, 483 aa] {ON} YEL0...   328   e-107
Skud_5.25 Chr5 complement(28970..30421) [1452 bp, 483 aa] {ON} Y...   325   e-105
YEL064C Chr5 complement(29797..31239) [1443 bp, 480 aa] {ON}  AV...   323   e-105
Smik_5.23 Chr5 complement(32195..33646) [1452 bp, 483 aa] {ON} Y...   319   e-103
Kwal_33.13386 s33 complement(195919..197328) [1410 bp, 469 aa] {...   310   1e-99
TDEL0C06210 Chr3 (1130473..1131912) [1440 bp, 479 aa] {ON} Anc_1...   308   6e-99
ZYRO0F16720g Chr6 (1385158..1386636) [1479 bp, 492 aa] {ON} simi...   308   1e-98
Ecym_1084 Chr1 complement(168749..170236) [1488 bp, 495 aa] {ON}...   307   2e-98
NDAI0I00130 Chr9 (12635..13969) [1335 bp, 444 aa] {ON} Anc_1.80 ...   303   2e-97
KLTH0F02332g Chr6 complement(192112..193521) [1410 bp, 469 aa] {...   298   2e-95
KLLA0C02277g Chr3 complement(192607..194004) [1398 bp, 465 aa] {...   296   2e-94
AFR671W Chr6 (1670758..1672224) [1467 bp, 488 aa] {ON} Syntenic ...   258   2e-79
Ecym_7133 Chr7 (264196..265569) [1374 bp, 457 aa] {ON} similar t...    71   2e-12
SAKL0F13134g Chr6 complement(1038673..1040205) [1533 bp, 510 aa]...    68   3e-11
Kwal_27.10702 s27 (455802..457205) [1404 bp, 467 aa] {ON} YER119...    62   1e-09
KLTH0C06006g Chr3 (518793..520130) [1338 bp, 445 aa] {ON} simila...    62   2e-09
AGL285C Chr7 complement(175831..177153) [1323 bp, 440 aa] {ON} S...    59   2e-08
KNAG0A05380 Chr1 (791957..793381) [1425 bp, 474 aa] {ON} Anc_2.2...    57   9e-08
TDEL0G02250 Chr7 complement(441289..442692) [1404 bp, 467 aa] {O...    56   1e-07
NCAS0B06210 Chr2 (1171270..1172715) [1446 bp, 481 aa] {ON} Anc_2...    55   2e-07
ADL205C Chr4 complement(341897..343303) [1407 bp, 468 aa] {ON} S...    54   7e-07
KAFR0L01910 Chr12 complement(362409..363746) [1338 bp, 445 aa] {...    53   1e-06
Kpol_1003.44 s1003 complement(104836..106248) [1413 bp, 470 aa] ...    52   1e-06
ZYRO0B04026g Chr2 complement(339245..340555) [1311 bp, 436 aa] {...    52   2e-06
KLLA0E08559g Chr5 complement(766878..768260) [1383 bp, 460 aa] {...    52   2e-06
CAGL0M06611g Chr13 complement(681693..683150) [1458 bp, 485 aa] ...    52   2e-06
Smik_9.97 Chr9 complement(176731..178203) [1473 bp, 490 aa] {ON}...    52   3e-06
KLTH0G10604g Chr7 complement(895162..896568) [1407 bp, 468 aa] {...    51   5e-06
NDAI0B03510 Chr2 (882507..883997) [1491 bp, 496 aa] {ON} Anc_2.295     51   6e-06
KNAG0B02190 Chr2 (418852..420237) [1386 bp, 461 aa] {ON} Anc_7.4...    50   9e-06
YIL088C Chr9 complement(197931..199403) [1473 bp, 490 aa] {ON}  ...    50   1e-05
NDAI0E04010 Chr5 (888700..890115) [1416 bp, 471 aa] {ON} Anc_7.420     50   1e-05
SAKL0E07392g Chr5 (602503..603921) [1419 bp, 472 aa] {ON} simila...    49   1e-05
Suva_9.112 Chr9 complement(191885..193360) [1476 bp, 491 aa] {ON...    50   1e-05
TPHA0C03460 Chr3 complement(757629..759050) [1422 bp, 473 aa] {O...    49   2e-05
Kwal_27.11485 s27 (819908..821323) [1416 bp, 471 aa] {ON} YIL088...    49   2e-05
Skud_9.86 Chr9 complement(173889..175361) [1473 bp, 490 aa] {ON}...    49   2e-05
Suva_5.240 Chr5 complement(375238..376584) [1347 bp, 448 aa] {ON...    49   2e-05
Smik_5.264 Chr5 complement(408587..409933) [1347 bp, 448 aa] {ON...    48   4e-05
KLLA0E06931g Chr5 (628083..629453) [1371 bp, 456 aa] {ON} simila...    48   4e-05
Kpol_1045.20 s1045 (42443..43843) [1401 bp, 466 aa] {ON} (42445....    47   8e-05
ZYRO0A02112g Chr1 complement(171184..172587) [1404 bp, 467 aa] {...    47   9e-05
KAFR0J01320 Chr10 (241859..243298) [1440 bp, 479 aa] {ON} Anc_2....    47   1e-04
Skud_5.260 Chr5 (420651..421997) [1347 bp, 448 aa] {ON} YER119C ...    47   1e-04
TBLA0F01400 Chr6 complement(345013..346374) [1362 bp, 453 aa] {O...    47   1e-04
TPHA0K00670 Chr11 (132771..134165) [1395 bp, 464 aa] {ON} Anc_7....    47   1e-04
Suva_2.28 Chr2 (46134..47513) [1380 bp, 459 aa] {ON} YBL089W (REAL)    45   3e-04
TBLA0F01390 Chr6 complement(342433..343719) [1287 bp, 428 aa] {O...    44   6e-04
TDEL0C02820 Chr3 complement(500004..501368) [1365 bp, 454 aa] {O...    44   8e-04
CAGL0H04587g Chr8 (431944..433281) [1338 bp, 445 aa] {ON} simila...    43   0.002
YER119C Chr5 complement(399496..400842) [1347 bp, 448 aa] {ON}  ...    41   0.007
CAGL0G03619g Chr7 complement(349789..351171) [1383 bp, 460 aa] {...    40   0.009
TBLA0B07210 Chr2 (1705801..1707294) [1494 bp, 497 aa] {ON} Anc_2...    40   0.015
YBL089W Chr2 (49574..50953) [1380 bp, 459 aa] {ON}  AVT5Putative...    39   0.020
Smik_2.31 Chr2 (43199..44578) [1380 bp, 459 aa] {ON} YBL089W (REAL)    37   0.077
KNAG0C03380 Chr3 (665325..666962) [1638 bp, 545 aa] {ON} Anc_7.4...    37   0.13 
TPHA0B02980 Chr2 (679253..681502) [2250 bp, 749 aa] {ON} Anc_2.1...    36   0.20 
KLLA0D09779g Chr4 complement(824518..826404) [1887 bp, 628 aa] {...    35   0.54 
Kpol_1032.88 s1032 complement(188477..190204) [1728 bp, 575 aa] ...    35   0.66 
Skud_2.19 Chr2 (33154..34533) [1380 bp, 459 aa] {ON} YBL089W (REAL)    34   0.71 
Ecym_3335 Chr3 complement(639655..641079) [1425 bp, 474 aa] {ON}...    34   0.73 
KAFR0D02000 Chr4 (407474..409618) [2145 bp, 714 aa] {ON} Anc_2.1...    33   1.6  
KLLA0C13277g Chr3 (1135255..1137420) [2166 bp, 721 aa] {ON} simi...    33   1.7  
AER380C Chr5 complement(1349610..1351760) [2151 bp, 716 aa] {ON}...    33   2.2  
Smik_11.90 Chr11 (157718..159760) [2043 bp, 680 aa] {ON} YKL146W...    32   3.1  
ACR051C Chr3 complement(448844..450880) [2037 bp, 678 aa] {ON} S...    32   3.8  
NDAI0C03790 Chr3 complement(863178..865343) [2166 bp, 721 aa] {O...    32   3.8  
SAKL0E10362g Chr5 complement(860653..862854) [2202 bp, 733 aa] {...    32   4.9  
NCAS0E02440 Chr5 (477113..478600) [1488 bp, 495 aa] {ON} Anc_7.420     32   5.5  
NDAI0F02660 Chr6 complement(649723..651855) [2133 bp, 710 aa] {O...    31   9.5  
Kpol_505.5 s505 complement(5011..7074) [2064 bp, 687 aa] {ON} co...    31   9.6  

>KNAG0C00780 Chr3 complement(137135..138676) [1542 bp, 513 aa] {ON}
           Anc_1.80 YEL064C
          Length = 513

 Score =  620 bits (1600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/341 (89%), Positives = 305/341 (89%)

Query: 1   MTSAQDEGLLRDPPPSYELHELENPLIAGIIETNEEKSPLHMAFMNMANSILGAGIISQP 60
           MTSAQDEGLLRDPPPSYELHELENPLIAGIIETNEEKSPLHMAFMNMANSILGAGIISQP
Sbjct: 1   MTSAQDEGLLRDPPPSYELHELENPLIAGIIETNEEKSPLHMAFMNMANSILGAGIISQP 60

Query: 61  FAVREAGVLGAFVVYIALGFLVDWTLRLIVQNLVITGTETYQESVAVALGEPGRLAILLA 120
           FAVREAGVLGAFVVYIALGFLVDWTLRLIVQNLVITGTETYQESVAVALGEPGRLAILLA
Sbjct: 61  FAVREAGVLGAFVVYIALGFLVDWTLRLIVQNLVITGTETYQESVAVALGEPGRLAILLA 120

Query: 121 NGLFAFGGCVAFCIIIGDTIPHVLRTVCPPQYIERNWXXXXXXXXXXXXXXXXXXXXXXE 180
           NGLFAFGGCVAFCIIIGDTIPHVLRTVCPPQYIERNW                      E
Sbjct: 121 NGLFAFGGCVAFCIIIGDTIPHVLRTVCPPQYIERNWVIIVVTLLISLPLSLSKKIKQLE 180

Query: 181 RASFLXXXXXXXXXXXXXXRGPFLPSELKSQVSLFAPQWWFRKTIFKSVSIVSFALVCHH 240
           RASFL              RGPFLPSELKSQVSLFAPQWWFRKTIFKSVSIVSFALVCHH
Sbjct: 181 RASFLALVSMAVIVVTVAVRGPFLPSELKSQVSLFAPQWWFRKTIFKSVSIVSFALVCHH 240

Query: 241 NTSFIFHSLRNKSIYKFNRLTHWSCAVSVSVCMLMGYTGFHTFKEKTKGNVLNNFSGDDG 300
           NTSFIFHSLRNKSIYKFNRLTHWSCAVSVSVCMLMGYTGFHTFKEKTKGNVLNNFSGDDG
Sbjct: 241 NTSFIFHSLRNKSIYKFNRLTHWSCAVSVSVCMLMGYTGFHTFKEKTKGNVLNNFSGDDG 300

Query: 301 WINVARLFFGFNMLTTFPLEIFVLRNVVLDIWAGPTHRWYQ 341
           WINVARLFFGFNMLTTFPLEIFVLRNVVLDIWAGPTHRWYQ
Sbjct: 301 WINVARLFFGFNMLTTFPLEIFVLRNVVLDIWAGPTHRWYQ 341

 Score =  183 bits (464), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 90/105 (85%), Positives = 90/105 (85%)

Query: 409 CNLGALLEVIGSTTGALTAYILPPLTHVLLTRRRPQPHTARERLGHCCCVVFGCTVMLVS 468
           CNLGALLEVIGSTTGALTAYILPPLTHVLLTRRRPQPHTARERLGHCCCVVFGCTVMLVS
Sbjct: 409 CNLGALLEVIGSTTGALTAYILPPLTHVLLTRRRPQPHTARERLGHCCCVVFGCTVMLVS 468

Query: 469 TTQTLLDWSRSAGRGGRPLRVLSXXXXXXXXXXXXXXXNLDYRFR 513
           TTQTLLDWSRSAGRGGRPLRVLS               NLDYRFR
Sbjct: 469 TTQTLLDWSRSAGRGGRPLRVLSRRAVPARPRPPCAPPNLDYRFR 513

>NCAS0J01840 Chr10 (346195..347532) [1338 bp, 445 aa] {ON} Anc_1.80
           YEL064C
          Length = 445

 Score =  336 bits (861), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 168/311 (54%), Positives = 210/311 (67%), Gaps = 1/311 (0%)

Query: 18  ELHELENPLIAGIIETNEEKSPLHMAFMNMANSILGAGIISQPFAVREAGVLGAFVVYIA 77
           +L +    L   +IE NE+KS ++MAFMNMANSILGAGII+QP AV+ AG+LG+ + YI 
Sbjct: 13  QLPDTSEELAKELIEENEKKSNVYMAFMNMANSILGAGIITQPLAVKNAGILGSIICYIL 72

Query: 78  LGFLVDWTLRLIVQNLVITGTETYQESVAVALGEPGRLAILLANGLFAFGGCVAFCIIIG 137
           LGF+VDWTLRL+V N+ ++  +TYQ++V   +G+ G+  IL  NGLFA GGC+ F IIIG
Sbjct: 73  LGFIVDWTLRLLVINITLSSKQTYQDTVEHVMGKKGKFLILGCNGLFALGGCIGFSIIIG 132

Query: 138 DTIPHVLRTVCPPQYIERNWXXXXXXXXXXXXXXXXXXXXXXERASFLXXXXXXXXXXXX 197
           DTIPHVLR     + I RN                        +ASFL            
Sbjct: 133 DTIPHVLRIFFNSEKITRNMVIFLTTLFISYPLSLLRNIAALSKASFLALVSMVVIVFTV 192

Query: 198 XXRGPFLPSELKSQVSLFAPQWWFRKTIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKF 257
             RGP LPSELK +  L     +F  ++FKS+SI+SFALVCHHNTSFIFHS+RNKS+ KF
Sbjct: 193 VIRGPALPSELKGE-PLSHSSLFFSPSLFKSLSIISFALVCHHNTSFIFHSIRNKSLTKF 251

Query: 258 NRLTHWSCAVSVSVCMLMGYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTF 317
            +LTH S  +SV+ CMLMGY+GF  F +KTKGN+LNNF   D  IN+AR+ FGFNMLTTF
Sbjct: 252 TKLTHISVFISVAFCMLMGYSGFFIFTDKTKGNILNNFPAKDNIINIARICFGFNMLTTF 311

Query: 318 PLEIFVLRNVV 328
           PLEIFVLR+VV
Sbjct: 312 PLEIFVLRDVV 322

 Score = 71.2 bits (173), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 50/67 (74%), Gaps = 1/67 (1%)

Query: 409 CNLGALLEVIGSTTGALTAYILPPLTHVLLTRRRPQPHTARERLGHCCCVVFGCTVMLVS 468
           CNLGAL E+IGSTT ++ AYILPP  ++LL ++R +  +   +L H  C+ FG TVM++S
Sbjct: 368 CNLGALFELIGSTTASVMAYILPPYVNLLLRQQRNE-LSFTTKLPHYFCIFFGFTVMIIS 426

Query: 469 TTQTLLD 475
           +T+T+LD
Sbjct: 427 STETILD 433

>SAKL0C02574g Chr3 complement(236779..238200) [1422 bp, 473 aa] {ON}
           similar to uniprot|P39981 Saccharomyces cerevisiae
           YEL064C AVT2 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 473

 Score =  330 bits (846), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 166/313 (53%), Positives = 205/313 (65%), Gaps = 4/313 (1%)

Query: 21  ELENPLIAGIIETNEEKSPLHMAFMNMANSILGAGIISQPFAVREAGVLGAFVVYIALGF 80
           ++E+PL++GI+  N+ KS ++MAFMNMANSILGAGII QPFA+   G+ G     + L  
Sbjct: 50  DVEDPLVSGIVTENQTKSNIYMAFMNMANSILGAGIIGQPFAINNCGLAGGVAAIVLLTL 109

Query: 81  LVDWTLRLIVQNLVITGTETYQESVAVALGEPGRLAILLANGLFAFGGCVAFCIIIGDTI 140
           LVDWT+RLIV NL +TG  TYQ+SV  A+G  G+L IL ANGLFAFGGC+ FCIIIGDTI
Sbjct: 110 LVDWTIRLIVVNLKLTGKTTYQDSVEFAMGRRGKLLILAANGLFAFGGCIGFCIIIGDTI 169

Query: 141 PHVLRTVCPPQ--YIERNWXXXXXXXXXXXXXXXXXXXXXXERASFLXXXXXXXXXXXXX 198
           PHVLR   P       RN                        +AS L             
Sbjct: 170 PHVLRAFFPAHTALFHRNAIIFFVTLFVSYPLSLNRDISKLSKASMLALASMLLIVVIVI 229

Query: 199 XRGPFLPSELKSQVSLFAPQWWFRKTIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFN 258
            +GP L +  K   SL A + +    IF+ +S++SFALVCHHNTSFI+ SL+N S+ +FN
Sbjct: 230 VKGPMLDAAYKG--SLTASKLFITPRIFQGISVISFALVCHHNTSFIYFSLKNPSLKRFN 287

Query: 259 RLTHWSCAVSVSVCMLMGYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFP 318
           +LTH SC VS+ VC +MGY+GF  FK+KTKGN+LNNF  DD  INVAR  FGFNMLTTFP
Sbjct: 288 KLTHLSCLVSMVVCFVMGYSGFLVFKDKTKGNILNNFPSDDNVINVARFCFGFNMLTTFP 347

Query: 319 LEIFVLRNVVLDI 331
           LEIFVLR+VV D+
Sbjct: 348 LEIFVLRDVVRDL 360

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 51/66 (77%), Gaps = 3/66 (4%)

Query: 409 CNLGALLEVIGSTTGALTAYILPPLTHVLLTRRRPQPHTARERLGHCCCVVFGCTVMLVS 468
           CNLGAL E+IG+TT ++ AYILPPLT++LLT R     T R++L +  C+VFG  VM++S
Sbjct: 398 CNLGALFELIGATTASMMAYILPPLTNLLLTGR---AKTLRQKLPYYGCIVFGFAVMVIS 454

Query: 469 TTQTLL 474
           +TQT+L
Sbjct: 455 STQTIL 460

>Suva_5.3 Chr5 complement(5485..6936) [1452 bp, 483 aa] {ON} YEL064C
           (REAL)
          Length = 483

 Score =  328 bits (842), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 164/316 (51%), Positives = 210/316 (66%), Gaps = 7/316 (2%)

Query: 19  LHELENPLIAGIIETNEEKSPLHMAFMNMANSILGAGIISQPFAVREAGVLGAFVVYIAL 78
           + + ++ L+  ++  N++KS + MAFMN+ANSILGAGII+QPFA++ AG++G  + YIAL
Sbjct: 51  ISDTDDQLVNNVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIAL 110

Query: 79  GFLVDWTLRLIVQNLVITGTETYQESVAVALGEPGRLAILLANGLFAFGGCVAFCIIIGD 138
           GF+VDWTLRLIV NL + G  TYQ +V   +G+ G+L IL  NGLFAFGGC+ +CIIIGD
Sbjct: 111 GFIVDWTLRLIVINLTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFGGCIGYCIIIGD 170

Query: 139 TIPHVLRTVCPPQ------YIERNWXXXXXXXXXXXXXXXXXXXXXXERASFLXXXXXXX 192
           TIPHVLR V          ++ RN                        +ASFL       
Sbjct: 171 TIPHVLRAVFSQNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIV 230

Query: 193 XXXXXXXRGPFLPSELKSQVSLFAPQWWFRKTIFKSVSIVSFALVCHHNTSFIFHSLRNK 252
                  RGP LP + +   +L     + + TIF+S+S++SFALVCHHNTSFIF S+RN+
Sbjct: 231 IVLTVVIRGPMLPYDWRGH-TLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNR 289

Query: 253 SIYKFNRLTHWSCAVSVSVCMLMGYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFN 312
           S+ KF +LTH S  +SV  C LMGY+GF  FKEKTKGNVLN+F G D  INVARL FGFN
Sbjct: 290 SVAKFTKLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFN 349

Query: 313 MLTTFPLEIFVLRNVV 328
           MLTTFP+EIFVLR+VV
Sbjct: 350 MLTTFPMEIFVLRDVV 365

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 48/67 (71%), Gaps = 3/67 (4%)

Query: 409 CNLGALLEVIGSTTGALTAYILPPLTHVLLTRRRPQPHTARERLGHCCCVVFGCTVMLVS 468
           CNLGAL E+IG+TT +  AYILPP T++LLT ++      + +L +  C+ FG  +M+VS
Sbjct: 408 CNLGALFELIGATTASTMAYILPPYTNLLLTSKKKN---WKAKLPYYFCICFGFMIMIVS 464

Query: 469 TTQTLLD 475
           +TQT+LD
Sbjct: 465 STQTILD 471

>Skud_5.25 Chr5 complement(28970..30421) [1452 bp, 483 aa] {ON}
           YEL064C (REAL)
          Length = 483

 Score =  325 bits (834), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 172/333 (51%), Positives = 216/333 (64%), Gaps = 10/333 (3%)

Query: 5   QDEGLLRDPPPSYEL---HELENPLIAGIIETNEEKSPLHMAFMNMANSILGAGIISQPF 61
            D+G      P++      + ++PL+  ++  N++KS + MAFMN+ANSILGAGII+QP 
Sbjct: 34  SDDGSQGKDSPNFVYPITSDTDDPLVNSVLRENDKKSSMRMAFMNLANSILGAGIITQPV 93

Query: 62  AVREAGVLGAFVVYIALGFLVDWTLRLIVQNLVITGTETYQESVAVALGEPGRLAILLAN 121
           A++ AG+LG  + YIALGF+VDWTLRLIV NL + G  TYQ +V   +G+ G+L IL  N
Sbjct: 94  AIKNAGILGGLIAYIALGFIVDWTLRLIVINLTLAGKRTYQGTVEHVMGKKGKLLILFTN 153

Query: 122 GLFAFGGCVAFCIIIGDTIPHVLRTVCPPQ------YIERNWXXXXXXXXXXXXXXXXXX 175
           GLFAFGGC+ +CIIIGDTIPHVLR V          ++ RN                   
Sbjct: 154 GLFAFGGCIGYCIIIGDTIPHVLRAVFSQNDGEVHFWLRRNVIIVLVTIFISFPLSLKRN 213

Query: 176 XXXXERASFLXXXXXXXXXXXXXXRGPFLPSELKSQVSLFAPQWWFRKTIFKSVSIVSFA 235
                +ASFL              RGP LP + K   SL  P +  + TIF+S+S++SFA
Sbjct: 214 IEGLSKASFLAVISMIIIVLTVVIRGPMLPYDWKGH-SLKWPDFLVKTTIFRSLSVISFA 272

Query: 236 LVCHHNTSFIFHSLRNKSIYKFNRLTHWSCAVSVSVCMLMGYTGFHTFKEKTKGNVLNNF 295
           LVCHHNTSFIF S+RN+S+ KF RLTH S  +SV  C LMG++GF  FKEKTKGNVLNNF
Sbjct: 273 LVCHHNTSFIFFSMRNRSVAKFTRLTHISIIISVICCGLMGFSGFAAFKEKTKGNVLNNF 332

Query: 296 SGDDGWINVARLFFGFNMLTTFPLEIFVLRNVV 328
            G D  INVARL FGFNMLTTFP+EIFVLR+VV
Sbjct: 333 PGTDTAINVARLCFGFNMLTTFPMEIFVLRDVV 365

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 48/67 (71%), Gaps = 3/67 (4%)

Query: 409 CNLGALLEVIGSTTGALTAYILPPLTHVLLTRRRPQPHTARERLGHCCCVVFGCTVMLVS 468
           CNLGAL E+IGSTT +  AYILPP T++LLT ++      + +L +  C+ FG  +M+VS
Sbjct: 408 CNLGALFELIGSTTASTMAYILPPYTNLLLTSKKKN---WKAKLPYYLCICFGFMIMIVS 464

Query: 469 TTQTLLD 475
           +TQT+LD
Sbjct: 465 STQTILD 471

>YEL064C Chr5 complement(29797..31239) [1443 bp, 480 aa] {ON}
           AVT2Putative transporter, member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 480

 Score =  323 bits (829), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 165/314 (52%), Positives = 211/314 (67%), Gaps = 7/314 (2%)

Query: 21  ELENPLIAGIIETNEEKSPLHMAFMNMANSILGAGIISQPFAVREAGVLGAFVVYIALGF 80
           ++++ L+  ++  N++KS + MAFMN+ANSILGAGII+QPFA++ AG+LG  + Y+ALGF
Sbjct: 50  DMDDTLVNDVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGF 109

Query: 81  LVDWTLRLIVQNLVITGTETYQESVAVALGEPGRLAILLANGLFAFGGCVAFCIIIGDTI 140
           +VDWTLRLIV NL + G  TYQ +V   +G+ G+L IL  NGLFAFGGC+ +CIIIGDTI
Sbjct: 110 IVDWTLRLIVINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFGGCIGYCIIIGDTI 169

Query: 141 PHVLRTVCPPQ------YIERNWXXXXXXXXXXXXXXXXXXXXXXERASFLXXXXXXXXX 194
           PHVLR +          ++ RN                        +ASFL         
Sbjct: 170 PHVLRAIFSQNDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIV 229

Query: 195 XXXXXRGPFLPSELKSQVSLFAPQWWFRKTIFKSVSIVSFALVCHHNTSFIFHSLRNKSI 254
                RGP LP + K   SL    ++ + TIF+S+S++SFALVCHHNTSFIF S+RN+S+
Sbjct: 230 LTVVIRGPMLPYDWKGH-SLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSV 288

Query: 255 YKFNRLTHWSCAVSVSVCMLMGYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFNML 314
            KF RLTH S  +SV  C LMGY+GF  FKEKTKGNVLN+F G D  IN+ARL FGFNML
Sbjct: 289 AKFTRLTHISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNML 348

Query: 315 TTFPLEIFVLRNVV 328
           TTFP+EIFVLR+VV
Sbjct: 349 TTFPMEIFVLRDVV 362

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 49/67 (73%), Gaps = 3/67 (4%)

Query: 409 CNLGALLEVIGSTTGALTAYILPPLTHVLLTRRRPQPHTARERLGHCCCVVFGCTVMLVS 468
           CNLGAL E+IG+TT +  AYILPP T++LLT ++    + +ERL    C+ FG  +M++S
Sbjct: 405 CNLGALFELIGATTASTMAYILPPYTNLLLTSKKK---SWKERLPFYLCICFGFMIMIIS 461

Query: 469 TTQTLLD 475
           +TQT++D
Sbjct: 462 STQTIID 468

>Smik_5.23 Chr5 complement(32195..33646) [1452 bp, 483 aa] {ON}
           YEL064C (REAL)
          Length = 483

 Score =  319 bits (817), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 165/314 (52%), Positives = 211/314 (67%), Gaps = 7/314 (2%)

Query: 21  ELENPLIAGIIETNEEKSPLHMAFMNMANSILGAGIISQPFAVREAGVLGAFVVYIALGF 80
           + ++ L+  ++  N++KS + MAFMN+ANSILGAGII+QPFA++ AG+LG  + YIALGF
Sbjct: 53  DTDDTLVNKVLLENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLISYIALGF 112

Query: 81  LVDWTLRLIVQNLVITGTETYQESVAVALGEPGRLAILLANGLFAFGGCVAFCIIIGDTI 140
           +VDWTLRLIV NL + G  TYQ +V   +G+ G+L IL  NGLFAFGGC+ +CIIIGDTI
Sbjct: 113 IVDWTLRLIVINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFGGCIGYCIIIGDTI 172

Query: 141 PHVLRTVCPPQ------YIERNWXXXXXXXXXXXXXXXXXXXXXXERASFLXXXXXXXXX 194
           PHVLR +   +      ++ RN                        +ASFL         
Sbjct: 173 PHVLRAIFSQKDGDIHFWLRRNVIIIIVTIFISFPLSLKRNIEALSKASFLAVISMIIIV 232

Query: 195 XXXXXRGPFLPSELKSQVSLFAPQWWFRKTIFKSVSIVSFALVCHHNTSFIFHSLRNKSI 254
                RGP LP + K   SL    ++ + TIF+S+S++SFALVCHHNTSFIF S+RN+S+
Sbjct: 233 VTVVIRGPMLPYDWKGH-SLQLRDFFVKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSV 291

Query: 255 YKFNRLTHWSCAVSVSVCMLMGYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFNML 314
            KF RLTH S  +SV  C LMGY+GF  FKEKTKGN+LN+F G D  IN+ARL FGFNML
Sbjct: 292 AKFTRLTHISIIISVICCGLMGYSGFAAFKEKTKGNILNSFPGTDTAINIARLCFGFNML 351

Query: 315 TTFPLEIFVLRNVV 328
           TTFP+EIFVLR+VV
Sbjct: 352 TTFPMEIFVLRDVV 365

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 47/67 (70%), Gaps = 3/67 (4%)

Query: 409 CNLGALLEVIGSTTGALTAYILPPLTHVLLTRRRPQPHTARERLGHCCCVVFGCTVMLVS 468
           CNLGAL E+IG+TT +  AYILPP T++LLT ++    +   +L    C+ FG  +M++S
Sbjct: 408 CNLGALFELIGATTASTMAYILPPYTNLLLTSKKK---SWSAKLPFYLCICFGFMIMIIS 464

Query: 469 TTQTLLD 475
           +TQT+LD
Sbjct: 465 STQTILD 471

>Kwal_33.13386 s33 complement(195919..197328) [1410 bp, 469 aa] {ON}
           YEL064C - Hypothetical ORF [contig 118] FULL
          Length = 469

 Score =  310 bits (793), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 157/310 (50%), Positives = 194/310 (62%), Gaps = 4/310 (1%)

Query: 23  ENPLIAGIIETNEEKSPLHMAFMNMANSILGAGIISQPFAVREAGVLGAFVVYIALGFLV 82
           E+      +  N  KS + MAFMNMANSILGAG+I QPFA++  G++G     I L  LV
Sbjct: 48  EDESTTAFLRENRSKSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLV 107

Query: 83  DWTLRLIVQNLVITGTETYQESVAVALGEPGRLAILLANGLFAFGGCVAFCIIIGDTIPH 142
           DWT+RLIV N+ ITG  TYQ+SV  A+G  G+L ILL+NGLFAFGGCV FCIIIGDTIPH
Sbjct: 108 DWTIRLIVVNMKITGKTTYQDSVEFAMGRKGKLLILLSNGLFAFGGCVGFCIIIGDTIPH 167

Query: 143 VLRTVCP--PQYIERNWXXXXXXXXXXXXXXXXXXXXXXERASFLXXXXXXXXXXXXXXR 200
           VLR   P       RN                        +AS L              +
Sbjct: 168 VLRAFFPGHENLFHRNIIIILVTCFISFPLSLNRNISKLSKASMLALVSMVFIVVIVLVK 227

Query: 201 GPFLPSELKSQVSLFAPQWWFRKTIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRL 260
           GP +    K   S    + +F   IF+ +S++SFALVCHHNTSFI+ SL+  S+ +F+RL
Sbjct: 228 GPMIDDAYKG--SFNTTELFFTPRIFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRL 285

Query: 261 THWSCAVSVSVCMLMGYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFPLE 320
           TH+SC V++  C LMGYTGF  FK++TKGN+LNNF G D  +NVAR  FGFNMLTTFPLE
Sbjct: 286 THFSCFVAMIFCFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLE 345

Query: 321 IFVLRNVVLD 330
           IFVLR+V+ D
Sbjct: 346 IFVLRDVIRD 355

 Score = 76.3 bits (186), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 52/74 (70%), Gaps = 3/74 (4%)

Query: 409 CNLGALLEVIGSTTGALTAYILPPLTHVLLTRRRPQPHTARERLGHCCCVVFGCTVMLVS 468
           CNLGAL E+ G+TT +L AYILPP  ++LL  +R    T RE+L H  C++FG T+M+VS
Sbjct: 394 CNLGALFELTGATTASLMAYILPPSVNLLLIGKRS---TVREKLPHYACIIFGFTIMVVS 450

Query: 469 TTQTLLDWSRSAGR 482
           ++QT++ + R   +
Sbjct: 451 SSQTIIAYIRGGDQ 464

>TDEL0C06210 Chr3 (1130473..1131912) [1440 bp, 479 aa] {ON} Anc_1.80
           YEL064C
          Length = 479

 Score =  308 bits (789), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 155/344 (45%), Positives = 209/344 (60%), Gaps = 13/344 (3%)

Query: 2   TSAQDEGLLRDPPPSYELHELENPLIAGIIETNEEKSPLHMAFMNMANSILGAGIISQPF 61
           +   +E    +   S     ++  ++  ++  N++KS +  AFMNMANSILGAG++ QPF
Sbjct: 35  SDETEENDSNEAKASSSNSAIDESMVINLLRDNDKKSTMRWAFMNMANSILGAGVVGQPF 94

Query: 62  AVREAGVLGAFVVYIALGFLVDWTLRLIVQNLVITGTETYQESVAVALGEPGRLAILLAN 121
           A+R  G++G  + YI L  LVDWTLRLIV NL + G +TYQ++V  ALG  GR+ +LL+N
Sbjct: 95  AIRNCGIIGGILAYIILVLLVDWTLRLIVINLTLAGKKTYQDTVEFALGRKGRILVLLSN 154

Query: 122 GLFAFGGCVAFCIIIGDTIPHVLRTVCPPQ--YIERNWXXXXXXXXXXXXXXXXXXXXXX 179
           GLFAFGGC+ FCIIIGDTIPH L+++      +  RN                       
Sbjct: 155 GLFAFGGCIGFCIIIGDTIPHFLQSIFHSSNFFFRRNVVITIVTLFISYPLSLQRNIAAL 214

Query: 180 ERASFLXXXXXXXXXXXXXXRGPFLPSELKSQVSLFAPQW-----WFRKTIFKSVSIVSF 234
            +ASFL              +GP      +  +SL   +W     +    IF+ +S++SF
Sbjct: 215 SKASFLALISMVVIVFSVVVQGP------RVDMSLKGDKWSLTDIFISSAIFRGISVISF 268

Query: 235 ALVCHHNTSFIFHSLRNKSIYKFNRLTHWSCAVSVSVCMLMGYTGFHTFKEKTKGNVLNN 294
           ALVCHHNTSFIF S++N+S+ KF RLTH S  +S+  CMLMGY+G+  F++KTKGN+LNN
Sbjct: 269 ALVCHHNTSFIFFSIKNRSLQKFARLTHISTFISMIFCMLMGYSGYSVFRDKTKGNILNN 328

Query: 295 FSGDDGWINVARLFFGFNMLTTFPLEIFVLRNVVLDIWAGPTHR 338
           F  DD  IN+ARL FGFNMLTTFPLEIFVLR+V+     G    
Sbjct: 329 FPQDDLVINIARLCFGFNMLTTFPLEIFVLRDVIAAFLYGKKEE 372

 Score = 72.0 bits (175), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 54/74 (72%), Gaps = 3/74 (4%)

Query: 409 CNLGALLEVIGSTTGALTAYILPPLTHVLLTRRRPQPHTARERLGHCCCVVFGCTVMLVS 468
           CNLGAL E+IG+TT +  AYILPP T+++L++   + +T R+++ H  C+ FG  VM+VS
Sbjct: 404 CNLGALFELIGATTASTMAYILPPYTNLVLSK---EANTFRQKVPHYLCIFFGFMVMIVS 460

Query: 469 TTQTLLDWSRSAGR 482
           +TQT+++  + + +
Sbjct: 461 STQTIIEVVKGSDQ 474

>ZYRO0F16720g Chr6 (1385158..1386636) [1479 bp, 492 aa] {ON} similar
           to uniprot|P39981 Saccharomyces cerevisiae YEL064C AVT2
           Putative transporter member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 492

 Score =  308 bits (788), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 154/320 (48%), Positives = 207/320 (64%), Gaps = 11/320 (3%)

Query: 20  HELENPLIAGIIETNEEKSPLHMAFMNMANSILGAGIISQPFAVREAGVLGAFVVYIALG 79
           ++ ++  +  +I  N +KS +  AFMNMANSILGAG+I QP A++ +G++GA + Y+ L 
Sbjct: 71  YDNDDEFVNDVIRENNKKSTMKWAFMNMANSILGAGVIGQPIAIKNSGIVGAIIAYLVLF 130

Query: 80  FLVDWTLRLIVQNLVITGTETYQESVAVALGEPGRLAILLANGLFAFGGCVAFCIIIGDT 139
            LVDWTLRLIV NL + G +TYQ++VA A+G+ GR+A+L ANGLFAFGGC+ FCIIIGDT
Sbjct: 131 VLVDWTLRLIVINLTLAGKKTYQDTVAFAMGKRGRIAVLTANGLFAFGGCIGFCIIIGDT 190

Query: 140 IPHVLRTVCPPQ--YIERNWXXXXXXXXXXXXXXXXXXXXXXERASFLXXXXXXXXXXXX 197
           +PHV R        ++ R                         +ASFL            
Sbjct: 191 LPHVFRAFIHQNSVFLSRRLIITIVTICISYPLALQRNIAALSKASFLALISMVIIVFTV 250

Query: 198 XXRGPFLPSE---LKSQVSLFAPQWWFRKTIFKSVSIVSFALVCHHNTSFIFHSLRNKSI 254
             RGP + ++   L  +  L  P+      IF+ +S++SFALVCHHNTSFI+ S++N+S+
Sbjct: 251 IIRGPEIHAKRDPLTWEDILVTPR------IFRGISVISFALVCHHNTSFIYFSIKNRSL 304

Query: 255 YKFNRLTHWSCAVSVSVCMLMGYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFNML 314
            KFNRLTH S ++SV  CM+MG++GF  F + TKGNVLNNFS DD  +N+ARL FGFNML
Sbjct: 305 RKFNRLTHISTSISVVFCMIMGFSGFAAFGQNTKGNVLNNFSADDKAVNIARLCFGFNML 364

Query: 315 TTFPLEIFVLRNVVLDIWAG 334
           TTFPLEIFVLR+V+     G
Sbjct: 365 TTFPLEIFVLRDVIASFIGG 384

 Score = 72.8 bits (177), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 49/67 (73%), Gaps = 4/67 (5%)

Query: 409 CNLGALLEVIGSTTGALTAYILPPLTHVLLTRRRPQPHTARERLGHCCCVVFGCTVMLVS 468
           CNLGA+ E+IG+TT ++ AYILPP  ++LLT  +    T R++L H  C+ FG ++ML+S
Sbjct: 418 CNLGAIFELIGATTASMMAYILPPWVNLLLTSDK----TFRQKLPHFACIAFGFSIMLIS 473

Query: 469 TTQTLLD 475
           + QT+LD
Sbjct: 474 SIQTILD 480

>Ecym_1084 Chr1 complement(168749..170236) [1488 bp, 495 aa] {ON}
           similar to Ashbya gossypii AFR671W
          Length = 495

 Score =  307 bits (786), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 154/313 (49%), Positives = 199/313 (63%), Gaps = 4/313 (1%)

Query: 21  ELENPLIAGIIETNEEKSPLHMAFMNMANSILGAGIISQPFAVREAGVLGAFVVYIALGF 80
           + E+P ++ +   N  KS ++MAFMNMANSILGAG+I QPFA++  G++G   + + L  
Sbjct: 73  QFEDPNVSQLTNPNRGKSNMYMAFMNMANSILGAGVIGQPFAIKNCGLIGGVCLIVLLTI 132

Query: 81  LVDWTLRLIVQNLVITGTETYQESVAVALGEPGRLAILLANGLFAFGGCVAFCIIIGDTI 140
           +VDWT+RLIV NL +TG  TYQ+SV  A+G  G+L IL  NGLFAFGGCV FCIIIGD+I
Sbjct: 133 IVDWTIRLIVINLKLTGKTTYQDSVEFAMGTKGKLLILFVNGLFAFGGCVGFCIIIGDSI 192

Query: 141 PHVLRTVCP--PQYIERNWXXXXXXXXXXXXXXXXXXXXXXERASFLXXXXXXXXXXXXX 198
           PHVL+   P   +   RN                        +AS L             
Sbjct: 193 PHVLKAFFPSHSELFRRNVVISVVTLFISYPLSLNRNISKLSKASMLALVSLLLIVALVI 252

Query: 199 XRGPFLPSELKSQVSLFAPQWWFRKTIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFN 258
            R P +  E K Q +    + +    +F+ +SI+SFALVCHHNTSFIF SL+N S+ +F 
Sbjct: 253 IRAPKVEDEYKGQFTW--EEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPSLKRFG 310

Query: 259 RLTHWSCAVSVSVCMLMGYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFP 318
            LTH SC +S+ VC++ GY GF TFK+KTKGN+LNNF  +D +IN AR  FGFNMLTTFP
Sbjct: 311 NLTHISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFP 370

Query: 319 LEIFVLRNVVLDI 331
           LEIFVLR+VV D+
Sbjct: 371 LEIFVLRDVVRDL 383

 Score = 73.9 bits (180), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 36/67 (53%), Positives = 50/67 (74%), Gaps = 3/67 (4%)

Query: 409 CNLGALLEVIGSTTGALTAYILPPLTHVLLTRRRPQPHTARERLGHCCCVVFGCTVMLVS 468
           CNLGALLE++GSTT +LTAYILPP T + LT +     T +ER  +  C++FG ++M+VS
Sbjct: 420 CNLGALLELVGSTTASLTAYILPPATTLALTGKT---KTLKERTPYYACIMFGFSIMIVS 476

Query: 469 TTQTLLD 475
           +TQT+L 
Sbjct: 477 STQTILS 483

>NDAI0I00130 Chr9 (12635..13969) [1335 bp, 444 aa] {ON} Anc_1.80
           YEL064C
          Length = 444

 Score =  303 bits (776), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 155/316 (49%), Positives = 203/316 (64%), Gaps = 3/316 (0%)

Query: 15  PSYELHELEN--PLIAGIIETNEEKSPLHMAFMNMANSILGAGIISQPFAVREAGVLGAF 72
           P+ E  +L++   L+  II+ N +KS ++MAF+NMANSILGAGII+QP AV+ AG+  + 
Sbjct: 7   PTDEEFQLQDSEALVKEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAGLCASI 66

Query: 73  VVYIALGFLVDWTLRLIVQNLVITGTETYQESVAVALGEPGRLAILLANGLFAFGGCVAF 132
           V+YI LGF+VDWTLRL++ N+ ++   TY ++V   +G  G+  IL  NGLFA GGC+ F
Sbjct: 67  VIYIMLGFIVDWTLRLLITNITLSSKLTYGDTVEYTMGRKGKYLILCCNGLFALGGCIGF 126

Query: 133 CIIIGDTIPHVLRTVCPPQYIERNWXXXXXXXXXXXXXXXXXXXXXXERASFLXXXXXXX 192
           CIIIGDTIPHVLR      ++ RN                          SFL       
Sbjct: 127 CIIIGDTIPHVLRIFIHSHFVTRNSVIFFSTLFISYPLSLLRDISALSSTSFLALISMTV 186

Query: 193 XXXXXXXRGPFLPSELKSQVSLFAPQWWFRKTIFKSVSIVSFALVCHHNTSFIFHSLRNK 252
                   GP LP+ELK    + +  +    ++F+S+SIVSFALVCHHNTSFIFHS+RNK
Sbjct: 187 IVMTVVVFGPSLPAELKGS-GIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFHSIRNK 245

Query: 253 SIYKFNRLTHWSCAVSVSVCMLMGYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFN 312
           S+ KF +LTH S  +SV  CM+MGY GF  F  KTKGN+LNNF  +   IN+AR+ FGFN
Sbjct: 246 SLTKFTKLTHLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFN 305

Query: 313 MLTTFPLEIFVLRNVV 328
           MLTT PLE+FVLR+V+
Sbjct: 306 MLTTLPLELFVLRDVI 321

 Score = 69.7 bits (169), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 50/67 (74%), Gaps = 1/67 (1%)

Query: 409 CNLGALLEVIGSTTGALTAYILPPLTHVLLTRRRPQPHTARERLGHCCCVVFGCTVMLVS 468
           CNLGAL E++G+TT ++ AYILPP  ++LL R+  +P   + ++ H  C++FG TVM+VS
Sbjct: 367 CNLGALFELVGATTASVMAYILPPYVNLLL-RQEKEPLPIKSKIPHYFCILFGFTVMIVS 425

Query: 469 TTQTLLD 475
           + QT+++
Sbjct: 426 SFQTIVE 432

>KLTH0F02332g Chr6 complement(192112..193521) [1410 bp, 469 aa] {ON}
           similar to uniprot|P39981 Saccharomyces cerevisiae
           YEL064C AVT2 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 469

 Score =  298 bits (764), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 155/313 (49%), Positives = 196/313 (62%), Gaps = 4/313 (1%)

Query: 21  ELENPLIAGIIETNEEKSPLHMAFMNMANSILGAGIISQPFAVREAGVLGAFVVYIALGF 80
           + E+   +  +     KS + MAFMNMANSILGAGII QPFAV+  G+LG  +  + L  
Sbjct: 46  DSEDRFTSTFLHEQRSKSNILMAFMNMANSILGAGIIGQPFAVKNCGLLGGVLAIVLLSL 105

Query: 81  LVDWTLRLIVQNLVITGTETYQESVAVALGEPGRLAILLANGLFAFGGCVAFCIIIGDTI 140
           LVDWT+RLIV NL I+G  TYQ+SV +A+G  G+L ILL+NGLFAFGGC+ FCIIIGDTI
Sbjct: 106 LVDWTIRLIVVNLRISGKTTYQDSVELAMGRKGKLLILLSNGLFAFGGCIGFCIIIGDTI 165

Query: 141 PHVLRTVCP--PQYIERNWXXXXXXXXXXXXXXXXXXXXXXERASFLXXXXXXXXXXXXX 198
           PHVLR           RN                        +AS L             
Sbjct: 166 PHVLRAFFSGHDNLFHRNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMVVIVVIVV 225

Query: 199 XRGPFLPSELKSQVSLFAPQWWFRKTIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFN 258
            +GP   S  K   S  +        IF+ +S++SFALVCHHNTSFI+ SL+  S+ +F+
Sbjct: 226 IKGPGTDSAYKG--SFNSSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLKRFD 283

Query: 259 RLTHWSCAVSVSVCMLMGYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFP 318
           RLTH+SC +++  C LMG+TGF  FK+KTKGN+LNNF G+D  +NVAR  FGFNMLTTFP
Sbjct: 284 RLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFP 343

Query: 319 LEIFVLRNVVLDI 331
           LEIFVLR+V+ D+
Sbjct: 344 LEIFVLRDVIKDL 356

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 31/68 (45%), Positives = 46/68 (67%), Gaps = 3/68 (4%)

Query: 409 CNLGALLEVIGSTTGALTAYILPPLTHVLLTRRRPQPHTARERLGHCCCVVFGCTVMLVS 468
           CNLGAL E+IG+TT +L AYILPP  ++ L     +    R+R+ H  C+ FG  +ML+S
Sbjct: 394 CNLGALFELIGATTASLMAYILPPWVNLKLVGGNLK---WRDRIPHYVCIGFGFAIMLIS 450

Query: 469 TTQTLLDW 476
           +TQT++ +
Sbjct: 451 STQTIISY 458

>KLLA0C02277g Chr3 complement(192607..194004) [1398 bp, 465 aa] {ON}
           similar to uniprot|P39981 Saccharomyces cerevisiae
           YEL064C AVT2 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 465

 Score =  296 bits (757), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 159/335 (47%), Positives = 197/335 (58%), Gaps = 6/335 (1%)

Query: 1   MTSAQDEGLLRDPPPSYELHEL--ENPLIAGIIETNEEKSPLHMAFMNMANSILGAGIIS 58
           +TS  D     D      +  +  E+PL   I  +NE KS  +MAFMNMANSILG+G+I 
Sbjct: 30  LTSFDDTAKTADSAVDQNIFNVNEEDPLTDDIYLSNEAKSNRYMAFMNMANSILGSGVIG 89

Query: 59  QPFAVREAGVLGAFVVYIALGFLVDWTLRLIVQNLVITGTETYQESVAVALGEPGRLAIL 118
           QPFA++  G++G     I +  LVDWT+RLIV NL +TG  TYQ SV  A+G+ G L IL
Sbjct: 90  QPFAMKNCGIIGGLFATILMSILVDWTIRLIVINLKLTGKSTYQASVETAMGQWGGLLIL 149

Query: 119 LANGLFAFGGCVAFCIIIGDTIPHVLRTVCPP--QYIERNWXXXXXXXXXXXXXXXXXXX 176
           ++NGLFAFGGCV FCIIIGD+IPHVL    P       RN                    
Sbjct: 150 VSNGLFAFGGCVGFCIIIGDSIPHVLSAFFPSHTDLFHRNVIITLVTLFISFPLSLNRDI 209

Query: 177 XXXERASFLXXXXXXXXXXXXXXRGPFLPSELKSQVSLFAPQWWFRKTIFKSVSIVSFAL 236
               + S L              + P +  E K    L   Q +    IF+ +S++SFAL
Sbjct: 210 SKLSKTSMLALLGLIAIVIIIVVKAPLVSGEYKGTFHLH--QLFITPRIFQGISVISFAL 267

Query: 237 VCHHNTSFIFHSLRNKSIYKFNRLTHWSCAVSVSVCMLMGYTGFHTFKEKTKGNVLNNFS 296
           VCHHNTSFIF SLRN S+ +FN+LTH S  +S  VC+   Y+GF  FK+KT GN+LNNF 
Sbjct: 268 VCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSCIVCLTTAYSGFLNFKDKTVGNILNNFP 327

Query: 297 GDDGWINVARLFFGFNMLTTFPLEIFVLRNVVLDI 331
            DD  IN ARL  GFNMLTTFPLEIFVLR+V+ DI
Sbjct: 328 SDDNVINFARLLLGFNMLTTFPLEIFVLRDVIRDI 362

 Score = 75.5 bits (184), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 52/66 (78%), Gaps = 3/66 (4%)

Query: 410 NLGALLEVIGSTTGALTAYILPPLTHVLLTRRRPQPHTARERLGHCCCVVFGCTVMLVST 469
           NLGALLE+IG+T+ +L AYILPPLT++++T ++    + +E+L +C C+VFG  +M VST
Sbjct: 400 NLGALLEIIGATSASLMAYILPPLTNLVITGKK---KSLKEKLPYCGCIVFGVILMFVST 456

Query: 470 TQTLLD 475
            QT+L+
Sbjct: 457 AQTILE 462

>AFR671W Chr6 (1670758..1672224) [1467 bp, 488 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL064C (AVT2)
          Length = 488

 Score =  258 bits (658), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 129/278 (46%), Positives = 174/278 (62%), Gaps = 4/278 (1%)

Query: 63  VREAGVLGAFVVYIALGFLVDWTLRLIVQNLVITGTETYQESVAVALGEPGRLAILLANG 122
           ++  G+LG  V+ + L  +VDWT+RLI+ NL +TG  TYQ++V  A+G PG+ A+L ANG
Sbjct: 108 LKNCGLLGGLVLTMLLTVIVDWTIRLIIINLKLTGKTTYQDTVEFAMGRPGKYAVLFANG 167

Query: 123 LFAFGGCVAFCIIIGDTIPHVLRTVCPP--QYIERNWXXXXXXXXXXXXXXXXXXXXXXE 180
           +FAFGGCV FCIIIGD+IPHVLR   P   +Y  RN                        
Sbjct: 168 MFAFGGCVGFCIIIGDSIPHVLRAFFPNYIEYFNRNMIITIVTIFVSYPLSLNRNISKLS 227

Query: 181 RASFLXXXXXXXXXXXXXXRGPFLPSELKSQVSLFAPQWWFRKTIFKSVSIVSFALVCHH 240
           +AS L              RGP + ++ +    L   + + +  +F+ +S++SFALVC H
Sbjct: 228 KASMLALVSLLLIVVIIVVRGPTVGNDYRGSFDL--EELFVKPRLFQGISVISFALVCLH 285

Query: 241 NTSFIFHSLRNKSIYKFNRLTHWSCAVSVSVCMLMGYTGFHTFKEKTKGNVLNNFSGDDG 300
           NTSFI+ SLR  S+ +FN LTH SC +S+ VC++ GY+GF TFK KTKGN+LNNF   D 
Sbjct: 286 NTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSDN 345

Query: 301 WINVARLFFGFNMLTTFPLEIFVLRNVVLDIWAGPTHR 338
           +IN AR  FGFNMLTTFPLEIFVLR+V+ D+ +  T +
Sbjct: 346 YINFARFCFGFNMLTTFPLEIFVLRDVIRDLISTETPK 383

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 53/66 (80%), Gaps = 3/66 (4%)

Query: 409 CNLGALLEVIGSTTGALTAYILPPLTHVLLTRRRPQPHTARERLGHCCCVVFGCTVMLVS 468
           CNLGALLE++GSTT +L+AYILPP+T+++LT  R     A+E+L H  C++FG ++M++S
Sbjct: 413 CNLGALLELVGSTTASLSAYILPPMTNLILTGER---RAAKEKLPHYACILFGFSIMVIS 469

Query: 469 TTQTLL 474
           +TQ ++
Sbjct: 470 STQAII 475

>Ecym_7133 Chr7 (264196..265569) [1374 bp, 457 aa] {ON} similar to
           Ashbya gossypii AGL285C
          Length = 457

 Score = 71.2 bits (173), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 68/304 (22%), Positives = 130/304 (42%), Gaps = 12/304 (3%)

Query: 37  KSPLHMAFMNMANSILGAGIISQPFAVREAGVLGAFVVYIALGF--LVDWTLRLIVQNLV 94
           +S +    + + ++  GAGI++ P+A R  G+L  F++ +  GF  L    L+  V   V
Sbjct: 2   RSSVQSGVLTLLHTACGAGILAMPYAFRSFGLLPGFLIIVFCGFSALTGLVLQSYVSKYV 61

Query: 95  ITGTETYQESVAVALGEPGRLAILL--ANGLFAFGGCVAFCIIIGDTIPHVLRTVCPPQY 152
                ++ E   ++  E   L+I+   A  +  FG  +++ +++GD +P ++ T    Q+
Sbjct: 62  APRHVSFFELAQISYPE---LSIVFDCAIAVKCFGVGISYMVVVGDLMPQIVSTFTSNQW 118

Query: 153 I-ERNWXXXXXXXXXXXXXXXXXXXXXXERASFLXXXXXXXXXXXXXXRGPFLPSEL--- 208
           + ER                          AS +                 F  S++   
Sbjct: 119 LLERTLQITLCMLFIVTPLCFMRKLDSLRYASMVAISSVAYLCVLVVYHFLFPSSDIRQA 178

Query: 209 KSQVSLFAPQWWFRKTIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRLTHWSCAVS 268
           K  VS+  P+     ++  S  I  FA  CHHN   I + LR+ S+    R+   +  ++
Sbjct: 179 KGIVSIGFPENNSAASMLSSFPIFVFAYTCHHNMFSIVNELRDNSLTNCVRVVLIAMGLA 238

Query: 269 VSVCMLMGYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFPLEIFVLRNVV 328
           VS+  ++G +G+ TF +   GN++  +        +AR+     ++  FPL+    R  +
Sbjct: 239 VSLYTVIGGSGYLTFGDNITGNIVTIYPRSVSS-TLARIAIVLLVMLAFPLQCHPARASI 297

Query: 329 LDIW 332
            +IW
Sbjct: 298 NNIW 301

>SAKL0F13134g Chr6 complement(1038673..1040205) [1533 bp, 510 aa]
           {ON} similar to uniprot|P40074 Saccharomyces cerevisiae
           YER119C AVT6 Vacuolar transporter exports aspartate and
           glutamate from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 510

 Score = 67.8 bits (164), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 67/275 (24%), Positives = 117/275 (42%), Gaps = 11/275 (4%)

Query: 53  GAGIISQPFAVREAGVLGAFVVYIALGFLVDWTLRLIVQNLVITGTETYQES-VAVALGE 111
           GAGI++ P+A +  G+L  F+V +  G  V  T  L++Q  V       Q S  ++A   
Sbjct: 60  GAGILAMPYAFKAYGLLPGFLVLVLCG--VFSTTGLLLQGQVSKYVPRRQASFFSLAQIT 117

Query: 112 PGRLAIL--LANGLFAFGGCVAFCIIIGDTIPHVLRTVCPPQ-YIERNWXXXXXXXXXXX 168
             +L+I+  LA  +   G  V++ ++IGD +P +       +  +ERN+           
Sbjct: 118 YPQLSIIFDLAIAVKCLGVGVSYMVVIGDLLPQIFSNFTSHEILLERNFHITVVMIFIVA 177

Query: 169 XXXXXXXXXXXERASFLXXXXXXXXXXXXXXRGPFLPSE---LKSQVSLFAPQWWFRKTI 225
                        AS +                 F   E   LK  VSLF P+     ++
Sbjct: 178 PLCFMKRLDSLRYASMIAISAVGYLCVLVVAHFLFPSQEIKDLKGTVSLFRPK-GLHTSM 236

Query: 226 FKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRLTHWSCAVSVSVCMLMGYTGFHTFKE 285
             S  I  FA  CHHNT  I + L++ S+    ++   +  ++V + + +G +G+ TF +
Sbjct: 237 LSSFPIFVFAYTCHHNTFSIVNELKDNSVENVRKVVIGAMGLAVCLYIAIGGSGYGTFGD 296

Query: 286 KTKGNVLNNFSGDDGWINVARLFFGFNMLTTFPLE 320
              GN++  +        V R+     ++  FPL+
Sbjct: 297 NIGGNIIMLYPHSTS-TTVGRIAIVLLVMLAFPLQ 330

>Kwal_27.10702 s27 (455802..457205) [1404 bp, 467 aa] {ON} YER119C -
           Hypothetical ORF [contig 33] FULL
          Length = 467

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 64/300 (21%), Positives = 122/300 (40%), Gaps = 11/300 (3%)

Query: 28  AGIIETNEEKSPLHMAFMNMANSILGAGIISQPFAVREAGVLGAFVVYIALGFLVDWTLR 87
           + I   N   S +    + + ++  GAGI++ P+A +  G++  F + +  G     T  
Sbjct: 16  SSIYNPNAMSSSVGSGVLTLLHTACGAGILAMPYAFKPFGLVLGFCMIVFCG-ACSATGL 74

Query: 88  LIVQNLVITGTETYQESVAVALGEPGRLAIL--LANGLFAFGGCVAFCIIIGDTIPHVLR 145
           ++   +     E      A++     +L+++  LA  +  FG  V++ +++GD +P +  
Sbjct: 75  MLQARVSKYAKERNASFFALSQITYPQLSVVFDLAIAVKCFGVGVSYLVVVGDLMPRIFA 134

Query: 146 TVCPPQYI-ERNWXXXXXXXXXXXXXXXXXXXXXXERASFLXXXXXXXXXXXXXXRGPFL 204
           T      +  RN+                        AS +                 F 
Sbjct: 135 TFTSHSLLLNRNFHITLVMALIVSPLCFMRRLDSLRYASMIAVSSVAYLCVLVVVHFLF- 193

Query: 205 PSE----LKSQVSLFAPQWWFRKTIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRL 260
           PSE    LK  VS+  P   F   +     I  FA  CHHN   I + LR+ S+    ++
Sbjct: 194 PSEELRELKGYVSIQKPAGSF-SALLSCFPIFVFAYTCHHNMFSIINELRDNSLKGIYKV 252

Query: 261 THWSCAVSVSVCMLMGYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFPLE 320
              S A+S+++ +L+G +G+ TF +   GN++  +        + R+     ++  FPL+
Sbjct: 253 CAISVALSMTLYLLIGGSGYATFGDNVPGNIITLYP-QSTTTTIGRVAIALLVMLAFPLQ 311

>KLTH0C06006g Chr3 (518793..520130) [1338 bp, 445 aa] {ON} similar
           to uniprot|P40074 Saccharomyces cerevisiae YER119C AVT6
           Vacuolar transporter exports aspartate and glutamate
           from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 445

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 76/319 (23%), Positives = 129/319 (40%), Gaps = 29/319 (9%)

Query: 37  KSPLHMAFMNMANSILGAGIISQPFAVREAGVLGAFVVYIALGF-LVDWTLRLIVQNLVI 95
            S L    + + ++  GAGI++ P+A R  GVL        LGF ++ +     +  L+I
Sbjct: 2   SSSLGSGVLTLLHTACGAGILAMPYAFRPFGVL--------LGFGMIAFCGACSLAGLMI 53

Query: 96  TG------TETYQESVAVALGEPGRLAIL--LANGLFAFGGCVAFCIIIGDTIPHVLRTV 147
            G       E      A+A     +L+++  LA  +  FG  V++ +++GD +P +  T 
Sbjct: 54  QGRVSKYAAERNASFFALAQVTYPQLSVIFDLAIAVKCFGVGVSYLVVVGDLMPRIFATF 113

Query: 148 CPPQYI-ERNWXXXXXXXXXXXXXXXXXXXXXXERASFLXXXXXXXXXXXXXXRGPFLPS 206
                +  RN                         AS +                 + PS
Sbjct: 114 TSHGLLLSRNLHITLVMLFVVSPLCFMKRLDSLRYASMVAISSVAYLCVLVLVHYVW-PS 172

Query: 207 ----ELKSQVSLFAPQWWFRKTIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRLTH 262
               EL+  VSL  P   F   +     I  FA  CHHN   I + LR+ S+    +++ 
Sbjct: 173 DEIRELRGHVSLGKPVGSF-AALLSCFPIFVFAYTCHHNMFSIVNELRDNSLKGIYKVSI 231

Query: 263 WSCAVSVSVCMLMGYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFPLEIF 322
            S A+++S+ +L+G +G+ TF +   GN++  +        V R+     ++  FPL+  
Sbjct: 232 ISVALAMSLYLLIGGSGYATFGDNVAGNIIMLYP-QSAATTVGRVAIALLVMLAFPLQCH 290

Query: 323 VLRNVVLDIW----AGPTH 337
             R  V  I     AG +H
Sbjct: 291 PARASVDHILHYFGAGKSH 309

>AGL285C Chr7 complement(175831..177153) [1323 bp, 440 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER119C
           (AVT6) and YBL089W (AVT5)
          Length = 440

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 66/303 (21%), Positives = 121/303 (39%), Gaps = 10/303 (3%)

Query: 37  KSPLHMAFMNMANSILGAGIISQPFAVREAGVLGAFVVYIALGFLVDWTLRLIVQNLVIT 96
            S +    + + ++  GAG+++ P+A R  G+L    +    G      + L++Q+ V  
Sbjct: 2   SSSVQSGVLTLLHTACGAGVLAMPYAFRAFGLLAGGAILACCG--ASAMVGLVLQSHVAQ 59

Query: 97  GTETYQES-VAVALGEPGRLAILL--ANGLFAFGGCVAFCIIIGDTIPHVLRTV-CPPQY 152
                Q S  ++A      L+++   A  +  FG  V++ +++GD +P +  TV   P  
Sbjct: 60  YVPPRQASFFSLAQISNPELSVVFDCAIAVKCFGVGVSYLVVLGDLMPQLAGTVTAAPWL 119

Query: 153 IERNWXXXXXXXXXXXXXXXXXXXXXXERASFLXXXXXXXXXXXXXXRGPFLPSE---LK 209
           ++RN                       + AS +              R  +   E   L+
Sbjct: 120 LDRNVQITFWTAAVIAPLCCMRHLHSLKYASMVAVAAVAYLGALVAARAAWPSPELERLR 179

Query: 210 SQVSLFAPQWWFRKTIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRLTHWSCAVSV 269
             VSL  P       +  S  I  FA  CHHN   I + LR+ S+    R+   + A++V
Sbjct: 180 GPVSLGLPPGTSGGAMLSSFPIFVFAYTCHHNMFSIVNELRDNSLGACLRVVVAAIALAV 239

Query: 270 SVCMLMGYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFPLEIFVLRNVVL 329
           ++   +G  G+ TF +   GN++  +        + R      ++  FPL+    R  + 
Sbjct: 240 ALYATIGGAGYLTFGDHITGNIIAQYPPAPA-TTLGRAAIAVLVMLAFPLQCHPARASIN 298

Query: 330 DIW 332
            IW
Sbjct: 299 HIW 301

>KNAG0A05380 Chr1 (791957..793381) [1425 bp, 474 aa] {ON} Anc_2.295
           YIL088C
          Length = 474

 Score = 56.6 bits (135), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 55/110 (50%), Gaps = 4/110 (3%)

Query: 220 WFR----KTIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRLTHWSCAVSVSVCMLM 275
           WF     K +  + SI+ FA V   N   I + L + +I   +++ + S A+S    + +
Sbjct: 183 WFEIYSGKGLLSTFSIIIFAYVGAMNLFTIINELSDNNITNISKIINRSIAISTVAFLSV 242

Query: 276 GYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFPLEIFVLR 325
           G TG+ TF   T GN++ N+  +  W+N+ +      +L +FPL    LR
Sbjct: 243 GITGYLTFGSNTLGNIILNYDPNSIWVNIGKFSLASMLLLSFPLLFHPLR 292

>TDEL0G02250 Chr7 complement(441289..442692) [1404 bp, 467 aa] {ON}
           Anc_2.295 YIL088C
          Length = 467

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 52/104 (50%), Gaps = 4/104 (3%)

Query: 220 WFR----KTIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRLTHWSCAVSVSVCMLM 275
           WF+    K +  + SI+ FA     N   I + L+  S+     + + S  +S +V + +
Sbjct: 181 WFKVYDFKGLLSTFSIIVFAYTGSMNLFSIINELKENSMANITSVINTSITISTAVFLAV 240

Query: 276 GYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFPL 319
           G  G+ TF   T GN++ N+  D  W+ V +L  G  ++ +FPL
Sbjct: 241 GICGYLTFGSNTLGNIMLNYDPDSTWVYVGKLCLGSMVMLSFPL 284

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 24/34 (70%), Gaps = 1/34 (2%)

Query: 45 MNMANSILGAGIISQPFAVREAG-VLGAFVVYIA 77
          +N+  +I+GAG+++ PFA R  G V+GA +  IA
Sbjct: 12 VNLVKTIIGAGLLAIPFAFRNDGVVIGALLTLIA 45

>NCAS0B06210 Chr2 (1171270..1172715) [1446 bp, 481 aa] {ON}
           Anc_2.295
          Length = 481

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 59/123 (47%), Gaps = 6/123 (4%)

Query: 220 WFR----KTIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRLTHWSCAVSVSVCMLM 275
           W R    K +  + SI+ FA V   N   I   L N S+    ++ + S  +S    +L+
Sbjct: 180 WIRIYDGKGLLSTFSIIIFAYVGAMNLFSICRELENDSMENILKVINGSIGISSIFFLLV 239

Query: 276 GYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFPLEIFVLRNVV--LDIWA 333
           G +G+ TF    +GN++ N+  +  WI + +    F +L +FPL    LR  V  L +W 
Sbjct: 240 GISGYLTFGSNVQGNIILNYDPNSIWIYLGKFCLAFMLLLSFPLLFHPLRIAVNNLVVWF 299

Query: 334 GPT 336
           G T
Sbjct: 300 GMT 302

>ADL205C Chr4 complement(341897..343303) [1407 bp, 468 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL088C
          Length = 468

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 49/104 (47%), Gaps = 4/104 (3%)

Query: 220 WFR----KTIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRLTHWSCAVSVSVCMLM 275
           W R    + +  + SI+ FA     N   I + L + S+    R+ ++S A S ++ +L+
Sbjct: 180 WLRPASLREMVSTFSIIVFAFTGSMNMFSIINELGDNSMRNIQRIVYYSIAASTALFILV 239

Query: 276 GYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFPL 319
           G  G+ TF      NV+ NF  D     V  L  G  +L +FPL
Sbjct: 240 GMAGYLTFGSNVAQNVILNFDPDAVSTQVGSLALGLMVLLSFPL 283

>KAFR0L01910 Chr12 complement(362409..363746) [1338 bp, 445 aa] {ON}
           Anc_7.420 YER119C
          Length = 445

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 58/293 (19%), Positives = 113/293 (38%), Gaps = 8/293 (2%)

Query: 45  MNMANSILGAGIISQPFAVREAGVLGAFVVYIALGFLVDWTLRLIVQNLVITGTETYQES 104
           + + ++  GAGI++ P+A +  G++  F++    GF     L L  Q    T + +    
Sbjct: 10  ITLLHTACGAGILAMPYAFKPFGLVPGFLMIAICGFCALSGLILQAQVAKYTASGSASFF 69

Query: 105 VAVALGEPGRLAIL-LANGLFAFGGCVAFCIIIGDTIPHVLRTVCPPQ-YIERNWXXXXX 162
               L  P    +  LA  +  FG  V++ I++GD +P +          + R++     
Sbjct: 70  TLSQLISPSLSVVFDLAIAVKCFGVGVSYMIVVGDLMPQIFAVFTTSHILLNRDFHISLI 129

Query: 163 XXXXXXXXXXXXXXXXXERASFLXXXXXXXXXXXXXXRGPFLPSE---LKSQVSLFAPQW 219
                              AS +                 F   +   LK  VS+  P+ 
Sbjct: 130 MLFIVSPLCFLRKLNSLRYASMIAISAVAYLCVLVVAHFIFQTEDVHDLKGVVSIGLPKH 189

Query: 220 WFRKTIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRLTHWSCAVSVSVCMLMGYTG 279
               +   ++ I  FA  CHHN   + +   N +     ++   +  ++  + +L+G++G
Sbjct: 190 --EPSPLTTLPIFVFAYTCHHNFFSVINEQSNIAFTHIKKIPIIAMILAYLLYILIGFSG 247

Query: 280 FHTFKEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFPLEIFVLRNVVLDIW 332
           + TF +   GN++  +        + RL   F ++  FPL+    R  +  IW
Sbjct: 248 YLTFGDNIVGNIITLYPRTASS-TIGRLAIVFLVMLAFPLQCHPCRASIHHIW 299

>Kpol_1003.44 s1003 complement(104836..106248) [1413 bp, 470 aa]
           {ON} complement(104836..106248) [1413 nt, 471 aa]
          Length = 470

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 57/119 (47%), Gaps = 2/119 (1%)

Query: 207 ELKSQVSLFAPQWWFRKTIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRLTHWSCA 266
           E +  V+ F+   W    +  + SI+ FA     N   I + L N SI    ++ + S  
Sbjct: 177 ETRGDVNWFSVYDW--TGLCSTFSIIIFAFTGAMNLFSIINELENNSIRNITKVINRSIG 234

Query: 267 VSVSVCMLMGYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFPLEIFVLR 325
           +S  + +L+G +G+ TF   T GN++ N+  D  W  + +   G  ++ +FPL    LR
Sbjct: 235 ISTFLFLLVGISGYLTFGSNTLGNIMLNYDPDSKWCYIGKFCLGSMIVLSFPLLFHPLR 293

>ZYRO0B04026g Chr2 complement(339245..340555) [1311 bp, 436 aa] {ON}
           similar to uniprot|P40074 Saccharomyces cerevisiae
           YER119C AVT6 Vacuolar transporter exports aspartate and
           glutamate from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 436

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 60/290 (20%), Positives = 121/290 (41%), Gaps = 20/290 (6%)

Query: 53  GAGIISQPFAVREAGVLGAFVVYIALGF-----LVDWTLRLIVQNLVITGTETYQESVAV 107
           GAGI++ P+  +  G+       +ALGF     +    L+  V   V   T ++      
Sbjct: 18  GAGILAMPYGFKTLGLTFGI---LALGFCSLCAMTGLLLQAQVARYVPERTASFFS--LT 72

Query: 108 ALGEPGRLAIL--LANGLFAFGGCVAFCIIIGDTIPHVLRTVCPPQ-YIERNWXXXXXXX 164
            L  P +L+++  LA  +  FG  V++ I++GD IP +  T    +  +ERN+       
Sbjct: 73  QLIHP-KLSVVFDLAIAIKCFGVGVSYMIVVGDLIPQIFTTFTSNKILLERNFHITMVML 131

Query: 165 XXXXXXXXXXXXXXXERASFLXXXXXXXXXXXXXXRGPFLPSEL---KSQVSLFAPQWWF 221
                           +AS +                 +  +E+   K +VS+  P+   
Sbjct: 132 FLVSPLCFMKRLTSLRKASLVALSSVAYLCCLVVVHFIWPSNEIDQRKGKVSIGFPRN-- 189

Query: 222 RKTIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRLTHWSCAVSVSVCMLMGYTGFH 281
             T   ++ I  FA  CHHN   +++  ++ S  + N++  +  +++  +  ++G  G+ 
Sbjct: 190 EPTPLTTLPIFVFAYTCHHNAFSVYNEQKDTSTRQLNKIGRYGMSIAFVLYTIIGGAGYL 249

Query: 282 TFKEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFPLEIFVLRNVVLDI 331
           TF +   GN++  +        + R+     ++  FPL+    R+ + +I
Sbjct: 250 TFGDHIAGNIITLYPPSLS-TTIGRVAIVLLVMLAFPLQCHPARSSINNI 298

>KLLA0E08559g Chr5 complement(766878..768260) [1383 bp, 460 aa] {ON}
           similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088C AVT7 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 460

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 52/104 (50%), Gaps = 4/104 (3%)

Query: 220 WF----RKTIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRLTHWSCAVSVSVCMLM 275
           WF    R  +  + SI+ FA     N   I + L+  S+    ++ + S  VS +  +++
Sbjct: 174 WFSISDRSGVLTTFSIIVFAFTGSMNLFSIINELKENSMTNIKKIINNSIVVSSACFIIL 233

Query: 276 GYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFPL 319
           G  G+ TF ++T GNV+ N+  D   +  AR   G  ++ +FPL
Sbjct: 234 GLFGYLTFGKETLGNVILNYDADKLSVRFARFNLGLMVVLSFPL 277

>CAGL0M06611g Chr13 complement(681693..683150) [1458 bp, 485 aa]
           {ON} similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088c
          Length = 485

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 59/129 (45%), Gaps = 12/129 (9%)

Query: 215 FAPQW--------WFR----KTIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRLTH 262
           FAP+         WF+    K +  + SI+ FA V   N   I + L++ S+    ++  
Sbjct: 170 FAPEISFERGEISWFKVYDYKGLLSTFSIIIFAYVGAMNIFTIVNELQDNSMTNVRKVVD 229

Query: 263 WSCAVSVSVCMLMGYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFPLEIF 322
            S  +S  + + +G  G+ TF   T GN+L N+  D   I + +      ++ TFPL   
Sbjct: 230 SSILISTILFLFVGLFGYLTFGSLTMGNILLNYDSDSLAIGIGKFCLAMMLILTFPLLFH 289

Query: 323 VLRNVVLDI 331
            LR  + +I
Sbjct: 290 PLRTAINNI 298

>Smik_9.97 Chr9 complement(176731..178203) [1473 bp, 490 aa] {ON}
           YIL088C (REAL)
          Length = 490

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 57/113 (50%), Gaps = 3/113 (2%)

Query: 219 WWF---RKTIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRLTHWSCAVSVSVCMLM 275
           WW     K +  + SI+ FA     N   + + L++ S+     + + S ++S ++ +++
Sbjct: 181 WWKIHDLKGLLSTFSIIIFAYTGSMNLFPMINELKDNSMENITSVINNSISLSTALFLIV 240

Query: 276 GYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFPLEIFVLRNVV 328
           G +G+ TF  KT GN++ N+     WI + +   G  ++ +FPL    LR  V
Sbjct: 241 GLSGYLTFGNKTLGNLILNYDPTSIWIVIGKFCLGLMLILSFPLLFQPLRIAV 293

>KLTH0G10604g Chr7 complement(895162..896568) [1407 bp, 468 aa] {ON}
           similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088C AVT7
          Length = 468

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 50/98 (51%)

Query: 222 RKTIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRLTHWSCAVSVSVCMLMGYTGFH 281
           +K +  + +I+ FA     N   I + L++ S+   N++   S + S ++ + +G  G+ 
Sbjct: 187 KKGLVSTFTIIVFAFTASMNLFSIINELKDNSMQNINKVITSSISTSAALFLSVGVCGYL 246

Query: 282 TFKEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFPL 319
           TF     GN++ N+  +  W  + +L  G  ++ +FPL
Sbjct: 247 TFGSNVVGNIMLNYDPESIWTTIGKLCLGTMVILSFPL 284

>NDAI0B03510 Chr2 (882507..883997) [1491 bp, 496 aa] {ON} Anc_2.295
          Length = 496

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 59/124 (47%), Gaps = 6/124 (4%)

Query: 219 WWFR----KTIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRLTHWSCAVSVSVCML 274
           +WF     + +  + SI+ FA     N   +   L + S+     + + S  +S  + +L
Sbjct: 182 YWFHVYDFRGLLSTFSIIIFAYTGAMNLFSMIRELEDISMQNIKNVINGSIIISTGLFLL 241

Query: 275 MGYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFPLEIFVLRNVV--LDIW 332
           +G +G+ TF    +GN++ N++ +  WI + +   G  ++ +FPL    LR  V  L +W
Sbjct: 242 VGISGYLTFGSNVEGNIILNYNPNSNWIYIGKFCLGTMLILSFPLLFHPLRIAVNNLVVW 301

Query: 333 AGPT 336
              T
Sbjct: 302 MKMT 305

>KNAG0B02190 Chr2 (418852..420237) [1386 bp, 461 aa] {ON} Anc_7.420
           YER119C
          Length = 461

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 64/121 (52%), Gaps = 17/121 (14%)

Query: 207 ELKSQVSLFAPQWWFRKTIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFN---RLTHW 263
           +LK ++S+  P+      I  ++ I  FA  CHHN   +F  +  +   KFN   ++  +
Sbjct: 180 DLKGRISIGLPRD--EPPILTTLPIFVFAYTCHHN---MFSVINEQVDQKFNVITKIAKY 234

Query: 264 SCAVSVSVCMLMGYTGFHTFKEKTKGNVL----NNFSGDDGWINVARLFFGFNMLTTFPL 319
           S +++  + +++GY+G+ TF +K  GN++    NN S   G I +A L     +  TFPL
Sbjct: 235 SMSLAFLLYIVIGYSGYLTFGDKIVGNIVTLYPNNASSTIGRIAIAIL-----VTLTFPL 289

Query: 320 E 320
           +
Sbjct: 290 Q 290

>YIL088C Chr9 complement(197931..199403) [1473 bp, 490 aa] {ON}
           AVT7Putative transporter, member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 490

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 63/124 (50%), Gaps = 5/124 (4%)

Query: 219 WWFR---KTIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRLTHWSCAVSVSVCMLM 275
           WW     K +  + SI+ FA     N   + + L++ S+     + + S ++S ++ +++
Sbjct: 181 WWKIHDFKGLLSTFSIIIFAFTGSMNLFPMINELKDNSMENITFVINNSISLSTALFLIV 240

Query: 276 GYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFPLEIFVLRNVVLD--IWA 333
           G +G+ TF  +T GN++ N+  +  WI + +   G  ++ +FPL    LR  V +  IW 
Sbjct: 241 GLSGYLTFGNETLGNLMLNYDPNSIWIVIGKFCLGSMLILSFPLLFHPLRIAVNNVIIWI 300

Query: 334 GPTH 337
             T+
Sbjct: 301 EITY 304

>NDAI0E04010 Chr5 (888700..890115) [1416 bp, 471 aa] {ON} Anc_7.420
          Length = 471

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 64/306 (20%), Positives = 124/306 (40%), Gaps = 30/306 (9%)

Query: 38  SPLHMAFMNMANSILGAGIISQPFAVREAGVLGAFVVYIALGFLVDWTLRLIVQNLVITG 97
           S +    + + ++  GAGI++ P+A +  G++  F++    G    W   LI+Q  V   
Sbjct: 3   STIRYGVLTLLHTACGAGILAMPYAFKPFGLIPGFIMIAICGLCSLW--GLILQARVTKY 60

Query: 98  TETYQ-------ESVA----VALGEPGRLAIL-LANGLFAFGGCVAFCIIIGDTIPHVLR 145
           ++T          SV+      +  P    I  LA  +  FG  V++ I++GD +P +L 
Sbjct: 61  SKTDDNDDTANDRSVSFFSLTQIINPNLSVIFDLAIAIKCFGVGVSYMIVVGDLMPQILS 120

Query: 146 TVCPPQYIE------RNWXXXXXXXXXXXXXXXXXXXXXXERASFLXXXXXXXXXXXXXX 199
            + P  +        RN+                        AS +              
Sbjct: 121 HLIPESHSTSSLLLSRNFHITIMMLCIVSPLCFMKNLSSLRYASMVAISSVVYLCVLVVF 180

Query: 200 RGPFL-PSE----LKSQVSLFAPQWWFRKTIFKSVSIVSFALVCHHNTSFIFHSLRNKSI 254
              FL PS+    LK ++S + P      +   ++ I  FA  CHHN   + +   + S 
Sbjct: 181 H--FLSPSQEIKDLKGELSYWLPNN--EPSPLVTLPIFVFAYTCHHNMFSVINEQIDNSF 236

Query: 255 YKFNRLTHWSCAVSVSVCMLMGYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFNML 314
           +   +L   + +++ S+ +++G +G++TF +   GN++  +        + R+   F + 
Sbjct: 237 HNIKKLAIIAMSLAFSLYIIIGGSGYYTFGDNIVGNIITLYPQSVSS-TIGRMAIVFLVT 295

Query: 315 TTFPLE 320
             FPL+
Sbjct: 296 LAFPLQ 301

>SAKL0E07392g Chr5 (602503..603921) [1419 bp, 472 aa] {ON} similar
           to uniprot|P40501 Saccharomyces cerevisiae YIL088C AVT7
           Putative transporter member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 472

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 47/95 (49%)

Query: 225 IFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRLTHWSCAVSVSVCMLMGYTGFHTFK 284
           +  + SI+ FA  C  N   I + L + S+    ++ + S  ++  + + +G TG+ TF 
Sbjct: 191 LISTFSIIIFAYTCTMNIFSIINELTDNSVSNVTKVANSSIGIATFLILSVGITGYLTFG 250

Query: 285 EKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFPL 319
               GN++ N+  D  W  V +   G  ++ +FPL
Sbjct: 251 SNVLGNIILNYDPDSIWTRVGKFCLGCMVVLSFPL 285

>Suva_9.112 Chr9 complement(191885..193360) [1476 bp, 491 aa] {ON}
           YIL088C (REAL)
          Length = 491

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 58/116 (50%), Gaps = 3/116 (2%)

Query: 219 WW---FRKTIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRLTHWSCAVSVSVCMLM 275
           WW     K +  + SI+ FA     N   + + L++ S+     + + S  +S  + +++
Sbjct: 181 WWKIHDVKGLLSTFSIIIFAYTGSMNLFPMINELKDNSMENITLVINNSITLSTILFLIV 240

Query: 276 GYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFPLEIFVLRNVVLDI 331
           G +G+ TF  KT GN++ N+  +  WI + +   G  ++ +FPL    LR  V ++
Sbjct: 241 GLSGYLTFGNKTSGNLMLNYDPNSIWIVIGKFCLGSMLILSFPLLFQPLRVAVNNV 296

>TPHA0C03460 Chr3 complement(757629..759050) [1422 bp, 473 aa] {ON}
           Anc_2.295 YIL088C
          Length = 473

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 58/119 (48%), Gaps = 2/119 (1%)

Query: 223 KTIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRLTHWSCAVSVSVCMLMGYTGFHT 282
           K    + +I+ FA     N   I + L   S+   + + ++S  +S  + + +G TG+ T
Sbjct: 188 KGFVTTFNIIIFAFTGAMNLFSIINELEENSMKNISHVINYSIGISTILFLSVGITGYLT 247

Query: 283 FKEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFPLEIFVLRNVVLDIWAGPTHRWYQ 341
           F   T GN++ N+  +  W NV     G  ++ +FPL    LR+ V +I     +++Y+
Sbjct: 248 FGSNTVGNIMLNYDPNSVWTNVGNFCLGAMVILSFPLLFHPLRDAVNNIIV--YYQYYK 304

>Kwal_27.11485 s27 (819908..821323) [1416 bp, 471 aa] {ON} YIL088C -
           Hypothetical ORF [contig 27] FULL
          Length = 471

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 50/104 (48%), Gaps = 4/104 (3%)

Query: 220 WFRKTIFKSV----SIVSFALVCHHNTSFIFHSLRNKSIYKFNRLTHWSCAVSVSVCMLM 275
           W R   FK +    +IV FA     N   I + L++ S+   N++   +  +S  + + +
Sbjct: 184 WIRVYDFKGLISTFTIVIFAYTGSMNMFSIINELKDNSMTNINKVVSTTITISSFLFLAV 243

Query: 276 GYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFPL 319
           G  G+ TF   T GN++ N+  +  W    +L  G  ++ +FPL
Sbjct: 244 GLCGYLTFGSNTLGNIMLNYDPNSAWTTTGKLCLGSMVILSFPL 287

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 26/44 (59%)

Query: 31 IETNEEKSPLHMAFMNMANSILGAGIISQPFAVREAGVLGAFVV 74
          + TN   +    + +N+  +I+GAG+++ P+A R  GVL   V+
Sbjct: 1  MNTNTGTATAFFSTINLVKTIVGAGMLAIPYAFRSDGVLVGIVL 44

>Skud_9.86 Chr9 complement(173889..175361) [1473 bp, 490 aa] {ON}
           YIL088C (REAL)
          Length = 490

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 64/127 (50%), Gaps = 8/127 (6%)

Query: 208 LKSQVSLFAPQWWFR---KTIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRLTHWS 264
           LK+ VS     WW     K +  + SI+ FA     N   + + L++ S+     + + S
Sbjct: 175 LKNDVS-----WWKIHDFKGLLSTFSIIIFAYTGSMNLFPMINELKDNSMGNITLVINNS 229

Query: 265 CAVSVSVCMLMGYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFPLEIFVL 324
            ++S ++ +++G +G+ TF   T GN++ N+  +  WI + +   G  ++ +FPL    L
Sbjct: 230 ISLSTALFLIVGLSGYLTFGNSTLGNLILNYDPNSVWIIIGKFCLGSMLILSFPLLFQPL 289

Query: 325 RNVVLDI 331
           R  V ++
Sbjct: 290 RVAVNNV 296

>Suva_5.240 Chr5 complement(375238..376584) [1347 bp, 448 aa] {ON}
           YER119C (REAL)
          Length = 448

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 60/285 (21%), Positives = 117/285 (41%), Gaps = 14/285 (4%)

Query: 45  MNMANSILGAGIISQPFAVREAGVLGAFVVYIALGFLVDWTLRLI--VQNLVITGTETYQ 102
           + + ++  GAGI++ P+A +  G++   V+ +  G     +L +   V   V  G  ++ 
Sbjct: 10  LTLLHTACGAGILAMPYAFKPFGLVPGVVMIVICGACAMQSLLIQARVARYVAPGKASF- 68

Query: 103 ESVAVALGEPGRLAIL--LANGLFAFGGCVAFCIIIGDTIPHVLRTVCPPQYI-ERNWXX 159
            S    L  P RL+I+  LA  +  FG  V++ I++GD +P ++ +     ++  RN   
Sbjct: 69  -STLTRLINP-RLSIVFDLAIAVKCFGVGVSYMIVVGDLMPQIMSSWTGNAWLLSRNVQI 126

Query: 160 XXXXXXXXXXXXXXXXXXXXERASFLXXXXXXXXXXXXXXRGPFLPSE----LKSQVSLF 215
                                 AS +                  +PS+    LK +VS  
Sbjct: 127 SLIMLFFVAPLSFLKKLNSLRYASMVAISSVAYLCVLVLVHY-VVPSDEILRLKGRVSYL 185

Query: 216 APQWWFRKTIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRLTHWSCAVSVSVCMLM 275
            PQ         ++ I  FA  CHHN   I +  ++       ++   S ++++++ + +
Sbjct: 186 FPQQSHDLNFLNTLPIFVFAYTCHHNMFSIINEQKSVRFEHVMKIPLISISLALALYIAI 245

Query: 276 GYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFPLE 320
           G  G+ TF +   GN++  +        V R+     ++  FPL+
Sbjct: 246 GCAGYLTFGDNIIGNIIMLYPQTVSS-TVGRIAIVLLVMLAFPLQ 289

>Smik_5.264 Chr5 complement(408587..409933) [1347 bp, 448 aa] {ON}
           YER119C (REAL)
          Length = 448

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 59/277 (21%), Positives = 111/277 (40%), Gaps = 14/277 (5%)

Query: 53  GAGIISQPFAVREAGVLGAFVVYIALGFLVDWTL--RLIVQNLVITGTETYQESVAVALG 110
           GAGI++ P+A +  G++   ++ +  G     +L  +  V   V  G  ++  S    L 
Sbjct: 18  GAGILAMPYAFKPFGLVPGMIMIVICGACAMQSLFIQARVAKYVPQGRASF--STLTRLI 75

Query: 111 EPGRLAIL--LANGLFAFGGCVAFCIIIGDTIPHVLRTVCPPQYI-ERNWXXXXXXXXXX 167
            P  L+I+  LA  +  FG  V++ I++GD +P ++       ++  RN           
Sbjct: 76  NPS-LSIVFDLAIAVKCFGVGVSYMIVVGDLMPQIMSVWTNNAWLLSRNVQISLIMLFFV 134

Query: 168 XXXXXXXXXXXXERASFLXXXXXXXXXXXXXXRGPFLPSE----LKSQVSLFAPQWWFRK 223
                         AS +                   PSE    L+ Q+S F P      
Sbjct: 135 TPLCFLKKLNSLRYASMIAISSVAYLCALVLVHY-IAPSEDILRLRGQISYFFPPQSHDL 193

Query: 224 TIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRLTHWSCAVSVSVCMLMGYTGFHTF 283
            +  ++ I  FA  CHHN   I +  R+       ++   + ++++ + + +G TG+ TF
Sbjct: 194 NVLNTLPIFVFAYTCHHNMFSIINEQRSSRFEHIMKIPLIAVSLALILYIAIGCTGYLTF 253

Query: 284 KEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFPLE 320
            +   GN++  +        V R+     ++  FPL+
Sbjct: 254 GDNIIGNIIMLYPQTVSS-TVGRIAIVLLVMLAFPLQ 289

>KLLA0E06931g Chr5 (628083..629453) [1371 bp, 456 aa] {ON} similar
           to uniprot|P40074 Saccharomyces cerevisiae YER119C AVT6
           Vacuolar transporter exports aspartate and glutamate
           from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 456

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 62/296 (20%), Positives = 120/296 (40%), Gaps = 21/296 (7%)

Query: 37  KSPLHMAFMNMANSILGAGIISQPFAVREAG-VLG-AFVVYIALGFLVDWTLRLIVQNLV 94
            S +    + + ++  GAGI++ P+A +  G +LG + +++  L       L+  V   V
Sbjct: 2   SSSVQSGVITLLHTACGAGILAMPYAFKPFGLILGLSMIIFCGLCSSTGLYLQSYVSKYV 61

Query: 95  ITGTETYQESVAVALGEPGRLAILL--ANGLFAFGGCVAFCIIIGDTIPHVLRTVCPPQY 152
             G  ++       L  P  L+++   A  +  FG  V++ +++GD +P ++ T     +
Sbjct: 62  PPGHASFFT--LCRLTRP-ELSVVFDAAIAVKCFGVGVSYLVVVGDLLPQIMSTFTTHGW 118

Query: 153 I-ERNWXXXXXXXXXXXXXXXXXXXXXXERASFLXXXXXXXXXXXXXXRGPFLPSE---L 208
           +  R +                         S +                    SE   L
Sbjct: 119 LLSRQFHITAVTLIIVTPLCFIKKLDSLRYTSSIAITAVGYLCVLVVFHFAVPNSEIDHL 178

Query: 209 KSQVSLFAPQWWFRKTIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRLTHWSCAVS 268
           +  VS++ P      ++  S  I  FA  CHHN   I +   +KS+    +L   +  ++
Sbjct: 179 RGHVSIWKPSD-VDSSMLSSFPIFVFAYTCHHNMFSIINEQSDKSLDSITKLIRIAITLA 237

Query: 269 VSVCMLMGYTGFHTFKEKTKGNVL----NNFSGDDGWINVARLFFGFNMLTTFPLE 320
           +S+ + +G  G+ TF +   GN++    N+ S   G I +A L     ++  FPL+
Sbjct: 238 MSLYISIGALGYCTFGDHITGNIITLYPNSISSTIGRIAIALL-----VILAFPLQ 288

>Kpol_1045.20 s1045 (42443..43843) [1401 bp, 466 aa] {ON}
           (42445..43845) [1401 nt, 467 aa]
          Length = 466

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 59/277 (21%), Positives = 112/277 (40%), Gaps = 16/277 (5%)

Query: 53  GAGIISQPFAVREAGVLGAFVVYIALGFLVDWTLRLIVQNLVITGTETYQES--VAVALG 110
           GAGI++ P+A +  G++  F++ I  G  +   + L++Q+ V +       S      + 
Sbjct: 18  GAGILAMPYAFKPYGLITGFIMIIICG--ICAMIGLLLQSRVSSYVPVRNASFFTLTQIT 75

Query: 111 EPGRLAIL--LANGLFAFGGCVAFCIIIGDTIPHVLRTVCPPQY-IERNWXXXXXXXXXX 167
            P  L+I+  LA  +  FG  V++ I++GD +P VL T    ++ + RN           
Sbjct: 76  NP-NLSIVFDLAIAIKCFGVGVSYMIVVGDVLPQVLSTFTNHEWLLNRNVNITLVMLFIV 134

Query: 168 XXXXXXXXXXXXERASFLXXXXXXXXXXXXXXRGPFLPSE----LKSQVSLFAPQWWFRK 223
                         AS L                  +P++     K  VS   P+     
Sbjct: 135 TPLCFLKNLNSLRYASMLAISSVAYLCALVLIHF-IMPNDETHNFKGDVSWGLPKNGLNP 193

Query: 224 TIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRLTHWSCAVSVSVCMLMGYTGFHTF 283
               ++ I  FA  CHHN   + +   + +     ++   S  ++  + +L+G  G+ TF
Sbjct: 194 --LTTLPIYVFAYTCHHNMFSVINEQMDPTYNSVKKIAIISMILAGFLYILIGGAGYLTF 251

Query: 284 KEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFPLE 320
            +   GN++  +  +     + R+   F +   FPL+
Sbjct: 252 GDHITGNIITLYPQNIS-TTIGRIAIIFLVTLAFPLQ 287

>ZYRO0A02112g Chr1 complement(171184..172587) [1404 bp, 467 aa] {ON}
           similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088C AVT7 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 467

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 55/121 (45%), Gaps = 5/121 (4%)

Query: 218 QWWF---RKTIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRLTHWSCAVSVSVCML 274
            WW     K +  + SI+ FA     N   I + LRN ++     + + S A++    + 
Sbjct: 179 SWWSVYDYKGLMSTFSIIIFAYTGSMNLFSIVNELRNNTMTNITAVVNRSIAIATVFFIA 238

Query: 275 MGYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFPLEIFVLRNVV--LDIW 332
           +   G+ TF   T GN++ N+     ++++ +   G  ++ TFPL     R  V  L +W
Sbjct: 239 VALAGYLTFGSNTLGNIMLNYDDTSIYVHIGKFCLGSMVVLTFPLLFHPCRIAVNNLCVW 298

Query: 333 A 333
           A
Sbjct: 299 A 299

>KAFR0J01320 Chr10 (241859..243298) [1440 bp, 479 aa] {ON} Anc_2.295
           YIL088C
          Length = 479

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 59/119 (49%), Gaps = 6/119 (5%)

Query: 220 WFR----KTIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRLTHWSCAVSVSVCMLM 275
           WF     K +  + SI+ FA     N   I + L+N S+   + + + S ++S  + + +
Sbjct: 181 WFTVYDFKGLLSTFSIIIFAYTGAMNLFSIINELKNNSMENVSSIINHSISISTILFLTV 240

Query: 276 GYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFPLEIFVLRNVV--LDIW 332
           G  G+ TF   T GN+L N+  D  W+++A+      ++ +FPL    LR  V  L +W
Sbjct: 241 GIAGYLTFGCNTLGNILLNYDADSVWVSIAKFCLAIMLVLSFPLLFHPLRIAVNNLVVW 299

 Score = 31.6 bits (70), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query: 35 EEKSPLHMAFMNMANSILGAGIISQPFAVREAGVL-GAFVVYIA 77
             S  H + +N+  +I+GAG+++ P+A +  GVL G F+  +A
Sbjct: 2  HATSTAHSSTINLVKTIVGAGLLAIPYAFKNDGVLVGLFLTLLA 45

>Skud_5.260 Chr5 (420651..421997) [1347 bp, 448 aa] {ON} YER119C
           (REAL)
          Length = 448

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 58/277 (20%), Positives = 109/277 (39%), Gaps = 14/277 (5%)

Query: 53  GAGIISQPFAVREAGVLGAFVVYIALGFLVDWTL--RLIVQNLVITGTETYQESVAVALG 110
           GAGI++ P+A +  G++   ++    G     +L  +  V   V  G  ++  S    L 
Sbjct: 18  GAGILAMPYAFKPFGLMPGVIMIAVCGVCAMQSLFIQARVAKYVPQGRASF--SALTRLI 75

Query: 111 EPGRLAIL--LANGLFAFGGCVAFCIIIGDTIPHVLRTVCPPQYI-ERNWXXXXXXXXXX 167
            P  L+I+  LA  +  FG  V++ I++GD +P ++       ++  RN           
Sbjct: 76  NP-NLSIVFDLAIAIKCFGVGVSYMIVVGDLMPQIMSVWTRNAWLLSRNVQISLIMVFLV 134

Query: 168 XXXXXXXXXXXXERASFLXXXXXXXXXXXXXXRGPFLPSE----LKSQVSLFAPQWWFRK 223
                         AS +                   PSE    +K ++S F P+     
Sbjct: 135 APLSFLKKLNSLRYASMIAISSVAYLCVLVLVHY-IAPSEEILHMKGRISYFFPKQSHDL 193

Query: 224 TIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRLTHWSCAVSVSVCMLMGYTGFHTF 283
            I  +  I  FA  CHHN   I +  R+       ++   + ++++ + + +G  G+ TF
Sbjct: 194 NILNTFPIFVFAYTCHHNMFSIINEQRSSRFEHVMKIPLIAISLALILYVAIGCAGYLTF 253

Query: 284 KEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFPLE 320
            +   GN++  +        V R+     ++  FPL+
Sbjct: 254 GDNIIGNIIMLYPQTTSS-TVGRVAIVLLVMLAFPLQ 289

>TBLA0F01400 Chr6 complement(345013..346374) [1362 bp, 453 aa] {ON}
           Anc_7.420 YER119C
          Length = 453

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 63/279 (22%), Positives = 110/279 (39%), Gaps = 21/279 (7%)

Query: 53  GAGIISQPFAVREAGVLGAFVVYIALGFLVDWTLRLIVQNLVITGTETYQESVAVALGEP 112
           GAGI++ P+A +  GV+   ++ +         L L V+    T          +A    
Sbjct: 16  GAGILAVPYAFKPFGVIPGMLILLVCSSTAILGLLLQVKVTKYTPVGEKHSFFELASKIH 75

Query: 113 GRLAIL--LANGLFAFGGCVAFCIIIGDTIPHVLRTVCPPQYIERNWXXXXXXXXXXXXX 170
            RLA+L  +A  +  FG   ++ I +GD +P +L +      I   W             
Sbjct: 76  PRLAVLFDIAIAIKCFGVATSYLIAVGDLLPTLLHSSNRFLLITLVWGFIIAPLSFLKKI 135

Query: 171 XXXXXXXXXERASFLXXXXXXXXXXXXXXRGPFLPSELKSQVSLFAPQWWFRKTI--FKS 228
                       S +              +      +L+  VSLF P      ++  FK+
Sbjct: 136 TALRYTSFLAVVSVIYLSILVTFHYADPSQEII---DLRGNVSLFFPGEDQHNSVSPFKT 192

Query: 229 VSIVSFALVCHHNTSFIFHSLRNKSIYKFNRLTHWS-CAVSVSVCM--LMGYTGFHTFKE 285
           + I  FA  CHHN   +F  L  +S  +F++L +    A+S++  M  ++G  G+ TF  
Sbjct: 193 LPIFVFAYTCHHN---MFAVLNEQSTNEFSKLKYIPLTAISIACIMYLIVGTFGYVTFGS 249

Query: 286 KTKGNVLNNFSGDDGWINVARLFFGFNMLTT----FPLE 320
               N++  +  +    ++A +     MLT     FPL+
Sbjct: 250 NITSNIVAQYPTN----SIATILGQTAMLTVVTLAFPLQ 284

>TPHA0K00670 Chr11 (132771..134165) [1395 bp, 464 aa] {ON} Anc_7.420
           YER119C
          Length = 464

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 59/287 (20%), Positives = 116/287 (40%), Gaps = 20/287 (6%)

Query: 45  MNMANSILGAGIISQPFAVREAGVLGAFVVYIALGFLVDWTLRLIVQNLVITGTETYQES 104
           + + ++  GAGI++ P+A +  GV     +    G      L LI+Q+ V         S
Sbjct: 10  LTLLHTACGAGILAMPYAFQPFGVFPGLFLIAFCG--ACAMLGLILQSTVAKYVPERNAS 67

Query: 105 V-AVALGEPGRLAIL--LANGLFAFGGCVAFCIIIGDTIPHVLRTVCPPQY-IERNWXXX 160
             A++     + ++L  +A  +  FG  V++ I++GD +P +L T    ++ + RN    
Sbjct: 68  FFALSQVTNPKFSVLFDIAIAVKCFGVGVSYMIVVGDVMPQILGTFTDTEFFLNRNVNIT 127

Query: 161 XXXXXXXXXXXXXXXXXXXERASFLXXXXXXXXXXXXXXRGPFLPSE----LKSQVSLFA 216
                                AS                   F+P+E     +  VS   
Sbjct: 128 IVMLFIVTPLCFLKNLNSLRYASIAAISAVIYLCFLVMFHF-FIPNEEIRDTRGPVS--- 183

Query: 217 PQWWFRK---TIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRLTHWSCAVSVSVCM 273
             W F K       ++ I  FA  CHHN   + +  ++    K  ++  ++  ++ ++ +
Sbjct: 184 --WGFPKDGLNPLNTLPIFVFAYTCHHNMFSVINEQQDIHFNKLKQICIFAMLLACTLYI 241

Query: 274 LMGYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFPLE 320
           ++G +G+ TF     GN++  +S +     V R+     ++  FPL+
Sbjct: 242 IIGGSGYLTFGNAITGNIITLYS-NSAATTVGRIAIVILVMLAFPLQ 287

>Suva_2.28 Chr2 (46134..47513) [1380 bp, 459 aa] {ON} YBL089W (REAL)
          Length = 459

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 54/293 (18%), Positives = 111/293 (37%), Gaps = 20/293 (6%)

Query: 45  MNMANSILGAGIISQPFAVREAGVLGAFVVYIALGFLVDWTLRLIVQNLVIT---GTETY 101
           + + ++  GAG+++ PFA +  G+L A +     G  +     L++Q  ++     +E  
Sbjct: 10  LTLLHTACGAGVLAMPFAFKPFGLLPALITLTFCG--ICSLCGLLLQTRIVKYVPKSENA 67

Query: 102 QESVAVALGEPG-RLAILLANGLFAFGGCVAFCIIIGDTIPHVLRTVC------------ 148
             +    L  P   +    A  +  FG  V++ II+GD +P +L ++             
Sbjct: 68  SFAKLTQLINPSLSIVFDFAIAVKCFGVGVSYLIIVGDLMPQILSSILYRNDDSTGDSQE 127

Query: 149 PPQYIERNWXXXXXXXXXXXXXXXXXXXXXXERASFLXXXXXXXXXXXXXXRGPFLPSEL 208
              +++R                          AS +                 +     
Sbjct: 128 HHMFLDRRLCISLVMMFVIAPLCFKKSLNSLRHASMIAIVSVAYLCGLIIFHFLYRSELE 187

Query: 209 KSQVSLFAP-QWWFRKTIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRLTHWSCAV 267
           + QV    P Q     +   ++ I  FA  CHHN   + +   +KS     R+   + ++
Sbjct: 188 RGQVYFMTPHQDAQSHSPLTTLPIFVFAYTCHHNMFSVINEQADKSFKILRRIPILAISL 247

Query: 268 SVSVCMLMGYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFPLE 320
           +  + +++G TG+ TF +   GN++  +  +  +  + RL     +   FPL+
Sbjct: 248 AYVLYVVIGGTGYMTFGDNIVGNIITLYP-NSIYTTIGRLAMLLLVTLAFPLQ 299

>TBLA0F01390 Chr6 complement(342433..343719) [1287 bp, 428 aa] {ON} 
          Length = 428

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 53/249 (21%), Positives = 92/249 (36%), Gaps = 6/249 (2%)

Query: 53  GAGIISQPFAVREAGVLGAFVVYIALGFLVDWTLRLIVQNLVITGTETYQESVAVALGEP 112
           GAGI++ PFA +  G+    +V +  G    + L L  + +  T T        +A    
Sbjct: 16  GAGILAIPFAFKPFGLFPGLMVLVVCGIAAIFGLLLQAKIIKYTPTNEKHSFFILATKLH 75

Query: 113 GRLAIL--LANGLFAFGGCVAFCIIIGDTIPHVLRTVCPPQYIERNWXXXXXXXXXXXXX 170
             LAIL  LA  +  FG   ++ I IGD +  +L        I   W             
Sbjct: 76  PTLAILFDLAIAVKCFGVSTSYLIAIGDFLAVLLDNEYRMNTITFVWLFIILPLSYLRKI 135

Query: 171 XXXXXXXXXERASFLXXXXXXXXXXXXXXRGPFLPSELKSQVSLFAPQWWFRKTIFKSVS 230
                       S                      SEL+  VSLF P+     + FK++ 
Sbjct: 136 NALRYTSLLAVTSVFYLCILVTYHYCKPSEEI---SELRGTVSLFLPKSS-GISPFKTLP 191

Query: 231 IVSFALVCHHNTSFIFHSLRNKSIYKFNRLTHWSCAVSVSVCMLMGYTGFHTFKEKTKGN 290
           I  FA  CHHN   + +  ++    +   +   + +++  + +++G  G+ TF      N
Sbjct: 192 IFVFAYTCHHNMFAVINEQKHTDFKRLKFIPLIAISIACILYLIVGCLGYATFGANITSN 251

Query: 291 VLNNFSGDD 299
           ++  +  + 
Sbjct: 252 IVAKYPTNS 260

>TDEL0C02820 Chr3 complement(500004..501368) [1365 bp, 454 aa] {ON}
           Anc_7.420 YER119C
          Length = 454

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 57/276 (20%), Positives = 107/276 (38%), Gaps = 14/276 (5%)

Query: 53  GAGIISQPFAVREAGVLGAFVVYI--ALGFLVDWTLRLIVQNLVITGTETYQESVAVALG 110
           GAG+++ P+  +  G++   +V I  AL  L    L+  V   V   + ++     +   
Sbjct: 18  GAGVLAMPYGFKPFGLIPGLLVIIFCALCSLGGLLLQAKVARYVPEKSASFFTLTQII-- 75

Query: 111 EPGRLAIL-LANGLFAFGGCVAFCIIIGDTIPHVLRTVCPPQYI-ERNWXXXXXXXXXXX 168
            P    I  +A  +  FG  V++ I++GD  P +         + +RN            
Sbjct: 76  NPNLSVIFDIAIAIKCFGVGVSYMIVVGDLTPQIASVFTSNHLLLDRNVHITLIMLFIVS 135

Query: 169 XXXXXXXXXXXERASFLXXXXXXXXXXXXXXRGPFLPSE----LKSQVSLFAPQWWFRKT 224
                        AS +                 + PSE    LK  VSL+ P       
Sbjct: 136 PLCFLKRLSSLRYASLIALLSVAYLCVLIFIHFVW-PSEEIHDLKGHVSLWIPHD--ETN 192

Query: 225 IFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRLTHWSCAVSVSVCMLMGYTGFHTFK 284
              ++ I  FA  CHHN   + +  ++ S     ++  ++  +++S+ +L+G  G+ TF 
Sbjct: 193 PLTTLPIFVFAYTCHHNMFSVINEQKDTSFRHIKKVAIYAMFLALSLYLLIGGMGYLTFG 252

Query: 285 EKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFPLE 320
           +   GN++  +        V R+     ++  FPL+
Sbjct: 253 DHIIGNIIKLYP-QFASTTVGRIAIVLLVMLAFPLQ 287

>CAGL0H04587g Chr8 (431944..433281) [1338 bp, 445 aa] {ON} similar
           to uniprot|P40074 Saccharomyces cerevisiae YER119c
          Length = 445

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 52/114 (45%), Gaps = 3/114 (2%)

Query: 207 ELKSQVSLFAPQWWFRKTIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRLTHWSCA 266
           ELK +VS+  P      T   ++ I  FA  CHHN   + +  +N        +   S  
Sbjct: 176 ELKGEVSVGLPHG--EPTPLTTLPIFVFAYTCHHNMFSVINEQKNTGFTYVRYIAIVSIL 233

Query: 267 VSVSVCMLMGYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFPLE 320
           V+  + +++G TG+ TF +   GN++  +  D     + R+     ++  FPL+
Sbjct: 234 VAFVLYVVIGSTGYLTFGDNITGNIIALYP-DTLSTTIGRIAIVLLVMLAFPLQ 286

>YER119C Chr5 complement(399496..400842) [1347 bp, 448 aa] {ON}
           AVT6Vacuolar aspartate and glutamate exporter; member of
           a family of seven genes (AVT1-7) related to vesicular
           GABA-glycine transporters; involved in
           compartmentalizing acidic amino acids in response to
           nitrogen starvation
          Length = 448

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 55/277 (19%), Positives = 108/277 (38%), Gaps = 14/277 (5%)

Query: 53  GAGIISQPFAVREAGVLGAFVVYIALGFLVDWTL--RLIVQNLVITGTETYQESVAVALG 110
           GAGI++ P+A +  G++   ++ +  G     +L  +  V   V  G  ++  S    L 
Sbjct: 18  GAGILAMPYAFKPFGLIPGVIMIVLCGACAMQSLFIQARVAKYVPQGRASF--SALTRLI 75

Query: 111 EPGRLAIL--LANGLFAFGGCVAFCIIIGDTIPHVLRTVCPPQYI-ERNWXXXXXXXXXX 167
            P  L I+  LA  +  FG  V++ I++GD +P ++       ++  RN           
Sbjct: 76  NP-NLGIVFDLAIAIKCFGVGVSYMIVVGDLMPQIMSVWTRNAWLLNRNVQISLIMLFFV 134

Query: 168 XXXXXXXXXXXXERASFLXXXXXXXXXXXXXXRGPFLPSE----LKSQVSLFAPQWWFRK 223
                         AS +                   PS+    LK ++S   P      
Sbjct: 135 APLSFLKKLNSLRYASMVAISSVAYLCVLVLLHY-VAPSDEILRLKGRISYLLPPQSHDL 193

Query: 224 TIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRLTHWSCAVSVSVCMLMGYTGFHTF 283
            +  ++ I  FA  CHHN   I +  R+       ++   + ++++ + + +G  G+ TF
Sbjct: 194 NVLNTLPIFVFAYTCHHNMFSIINEQRSSRFEHVMKIPLIAISLALILYIAIGCAGYLTF 253

Query: 284 KEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFPLE 320
            +   GN++  +        + R+     ++  FPL+
Sbjct: 254 GDNIIGNIIMLYPQAVSS-TIGRIAIVLLVMLAFPLQ 289

>CAGL0G03619g Chr7 complement(349789..351171) [1383 bp, 460 aa] {ON}
           similar to uniprot|P40074 Saccharomyces cerevisiae
           YER119c or uniprot|P38176 Saccharomyces cerevisiae
           YBL089w or uniprot|P40501 Saccharomyces cerevisiae
           YIL088c
          Length = 460

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 54/299 (18%), Positives = 118/299 (39%), Gaps = 17/299 (5%)

Query: 45  MNMANSILGAGIISQPFAVREAGVLGAFVVYIALGFLVDWTLRLIVQNLVITGTETYQES 104
           + + ++  GAGI++ P+A +  G++   ++ +  G     TL  ++Q  V       + +
Sbjct: 10  LTLLHTACGAGILAMPYAFKPFGLIFGILMIMFCGLCSMMTL--LIQARVAGYAPDSKNA 67

Query: 105 VAVALGE--PGRLAIL--LANGLFAFGGCVAFCIIIGDTIPHVLRTVC-PPQYIERNWXX 159
              +L +     L+++  LA  +   G  +++ I++GD +P +  ++   P  + R++  
Sbjct: 68  SFFSLTQVINKNLSVIFDLAIAIKCLGVGISYLIVVGDLLPQIAGSITTKPLLLNRDFHI 127

Query: 160 XXXXXXXXXXXXXXXXXXXXERASFLXXXXXX-----XXXXXXXXRGPFLPSELKSQVSL 214
                                  S L                    G     ++K  VS+
Sbjct: 128 TLVMIFVVTPLCLKKRLNSLRHTSSLAIMSVAYLCVLVIIHLVSSDGDI--EQMKGHVSI 185

Query: 215 FAPQWWFRKTIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRLTHWSCAVSVSVCML 274
             P      +   ++ I  FA  CHHN   + +  ++        +   S +++  + +L
Sbjct: 186 GLPHHG--PSPLTTLPIFVFAYTCHHNMFSVINEQKDNRFKTTKYIPLISTSLACILYIL 243

Query: 275 MGYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFPLEIFVLRNVVLDIWA 333
           +G  G+ TF +K  GN++  +      I + R+     +   FPL+    R+ + +I A
Sbjct: 244 IGGCGYMTFGDKIVGNIITLYPHSVSSI-IGRIAIALLVTLAFPLQCHPARSSIHNILA 301

>TBLA0B07210 Chr2 (1705801..1707294) [1494 bp, 497 aa] {ON}
           Anc_2.295 YIL088C
          Length = 497

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 61/303 (20%), Positives = 118/303 (38%), Gaps = 28/303 (9%)

Query: 38  SPLHMAFMNMANSILGAGIISQPFAVRE----AGVLGAFVVYIALGFLVDWTLRLIVQNL 93
           + +H + +N+  +I+GAG+++ PFA R      G+L   +  I  GF + + L    + L
Sbjct: 6   ASIHSSIINLTKTIVGAGMLAIPFAFRNDGILVGILLTLLAAITSGFGL-FVLAKCSKTL 64

Query: 94  VITGTETYQESVAVALGEPGRLAILLANGLFAFGGCVAFCIIIGDTIPHVLRTVCPPQYI 153
           +     ++ +   +A      L+ + +  +  FG  +++ ++IGD  P +        Y 
Sbjct: 65  INPRNSSFFQLTMIAFPNLSPLSDI-SMIVQCFGVGLSYIVLIGDLFPTIFN-----NYG 118

Query: 154 ERNWXXXXXXXXXX----------XXXXXXXXXXXXERASFLXXXXXXXXXXXXXXRGPF 203
            RN+                                   SFL                PF
Sbjct: 119 SRNFYILTSTIVIVPLCLLKRLDHLKYSSIVGLFALSYLSFLIVFVFIKDIILTNNLPPF 178

Query: 204 LPSELKSQVSLFAPQWWFRKTIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRLTHW 263
               +   VS++         +  + +I+ FA     N   I + L    I     + + 
Sbjct: 179 ERGSIN-WVSIYD-----FNGLLSTFTIIIFAYTGSMNLFTIINELNYNDIDSIKIVINH 232

Query: 264 SCAVSVSVCMLMGYTGFHTFKEKTKGNVLNNFSGDDG-WINVARLFFGFNMLTTFPLEIF 322
           S A+S  + +++   G+ TF   T GN++ N++  +  +I + +L  G  ++ TFPL   
Sbjct: 233 SIAISTIIFLIISIFGYLTFGTLTLGNIMLNYNYSNSLYIILGKLALGIMVILTFPLLFH 292

Query: 323 VLR 325
            LR
Sbjct: 293 PLR 295

>YBL089W Chr2 (49574..50953) [1380 bp, 459 aa] {ON}  AVT5Putative
           transporter, member of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 459

 Score = 39.3 bits (90), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 50/104 (48%), Gaps = 1/104 (0%)

Query: 228 SVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRLTHWSCAVSVSVCMLMGYTGFHTFKEKT 287
           ++ I  FA  CHHN   + +   +KS     R+  ++  ++  + +++G TG+ TF E  
Sbjct: 208 TLPIFVFAYTCHHNMFSVINEQVDKSFKVIRRIPIFAIVLAYFLYIIIGGTGYMTFGENI 267

Query: 288 KGNVLNNFSGDDGWINVARLFFGFNMLTTFPLEIFVLRNVVLDI 331
            GN+L  +        + RL     ++  FPL+    R+ V +I
Sbjct: 268 VGNILTLYPNSIST-TIGRLAMLLLVMLAFPLQCHPCRSSVKNI 310

>Smik_2.31 Chr2 (43199..44578) [1380 bp, 459 aa] {ON} YBL089W (REAL)
          Length = 459

 Score = 37.4 bits (85), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 24/105 (22%), Positives = 50/105 (47%), Gaps = 1/105 (0%)

Query: 228 SVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRLTHWSCAVSVSVCMLMGYTGFHTFKEKT 287
           ++ I  FA  CHHN   + +   +K+     R+  ++ + +  + +++G  G+ TF E  
Sbjct: 208 TLPIFVFAYTCHHNMFSVINEQTDKTFRILRRIPIFAISFAYILYLIIGGAGYMTFGENI 267

Query: 288 KGNVLNNFSGDDGWINVARLFFGFNMLTTFPLEIFVLRNVVLDIW 332
            GN+L  +        + RL     ++  FPL+    R+ + +I+
Sbjct: 268 VGNILTLYPNSIST-TIGRLAMLLLVMLAFPLQCHPCRSSIKNIF 311

>KNAG0C03380 Chr3 (665325..666962) [1638 bp, 545 aa] {ON} Anc_7.420
           YER119C
          Length = 545

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 45/106 (42%), Gaps = 3/106 (2%)

Query: 231 IVSFALVCHHNTSFIFHSLRNKSIYKFNRLTHWSCAVSVSVCMLMGYTGFHTFKEKTK-- 288
           ++ F   CH N     +  R + +    R+     A   +VC++ G TG+ TF + T+  
Sbjct: 195 LLMFMFTCHQNIFPTLNCARERGLKHTLRVPLTYLAAYAAVCLICGITGYLTFHKSTRTI 254

Query: 289 -GNVLNNFSGDDGWINVARLFFGFNMLTTFPLEIFVLRNVVLDIWA 333
             NVL  +        + R+    ++  +FPL     R  +  IWA
Sbjct: 255 PSNVLLLYPQGSILGTLCRVTTLLSVTLSFPLLCHPTRAALNHIWA 300

>TPHA0B02980 Chr2 (679253..681502) [2250 bp, 749 aa] {ON} Anc_2.177
           YNL101W
          Length = 749

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 50/105 (47%)

Query: 30  IIETNEEKSPLHMAFMNMANSILGAGIISQPFAVREAGVLGAFVVYIALGFLVDWTLRLI 89
           +I+T + K+P   AF+ +  S +G GI+  P A  + G+L +  + +  G    W   ++
Sbjct: 331 MIQTAKGKTPTTKAFLLLLKSFIGTGILFLPNAFSKGGLLFSIGMLLFFGLYSYWCYFIL 390

Query: 90  VQNLVITGTETYQESVAVALGEPGRLAILLANGLFAFGGCVAFCI 134
           +++  IT   ++ +   +  G   +  IL +  L   G   A+ I
Sbjct: 391 IRSKQITKVSSFGDIGLILYGRWMKTIILCSLVLTQIGFSAAYVI 435

>KLLA0D09779g Chr4 complement(824518..826404) [1887 bp, 628 aa] {ON}
           similar to uniprot|P47082 Saccharomyces cerevisiae
           YJR001W AVT1 Vacuolar transporter imports large neutral
           amino acids into the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 628

 Score = 35.0 bits (79), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 50/99 (50%), Gaps = 7/99 (7%)

Query: 46  NMANSILGAGIISQPFAVREAG-VLGAFVVYIALGFLVDWTLRLIVQNL-VITGTETYQE 103
           N  N ++G G+++ P  +R AG VLG  +++I   F    + +LI + L       TY +
Sbjct: 242 NSINVLIGIGLLALPLGLRYAGWVLGVPILFI-FAFATFCSAQLISRCLDADPSISTYGD 300

Query: 104 SVAVALGEPGR--LAILLANGLFAFGGCVAFCIIIGDTI 140
               A G  GR  ++ L A  L A G  VA  I+ GD++
Sbjct: 301 LAYAAFGPKGRALISFLFAMDLLACG--VALIILFGDSL 337

>Kpol_1032.88 s1032 complement(188477..190204) [1728 bp, 575 aa]
           {ON} complement(188477..190204) [1728 nt, 576 aa]
          Length = 575

 Score = 34.7 bits (78), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 33/67 (49%), Gaps = 1/67 (1%)

Query: 410 NLGALLEVIGSTTGALTAYILPPLTHVLLTRRRPQPHTARERLGHCCCVVFGCTVMLVST 469
           +L   + ++GS       YI PPL H+   +R     T    +   C ++FG T+++ ++
Sbjct: 508 DLDKFVSLVGSFACIPLIYIYPPLLHIKALKRNGTV-TNLHLIVDSCMIIFGFTILIYTS 566

Query: 470 TQTLLDW 476
            QT+  W
Sbjct: 567 CQTIKLW 573

>Skud_2.19 Chr2 (33154..34533) [1380 bp, 459 aa] {ON} YBL089W (REAL)
          Length = 459

 Score = 34.3 bits (77), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 23/104 (22%), Positives = 49/104 (47%), Gaps = 1/104 (0%)

Query: 228 SVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRLTHWSCAVSVSVCMLMGYTGFHTFKEKT 287
           ++ I  FA  CHHN   + +   +K      R+   + +++  + +++G  G+ TF +  
Sbjct: 208 TLPIFVFAYTCHHNMFSVINEQADKGFRILKRIPIIAISLAFVLYVIIGGAGYMTFGKNI 267

Query: 288 KGNVLNNFSGDDGWINVARLFFGFNMLTTFPLEIFVLRNVVLDI 331
            GN+L  +  +     + RL     ++  FPL+    R+ + +I
Sbjct: 268 VGNILTLYP-NSVSTTIGRLAMLLLVMLAFPLQCHPCRSSIKNI 310

>Ecym_3335 Chr3 complement(639655..641079) [1425 bp, 474 aa] {ON}
           similar to Ashbya gossypii ADL205C
          Length = 474

 Score = 34.3 bits (77), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 20/93 (21%), Positives = 40/93 (43%)

Query: 227 KSVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRLTHWSCAVSVSVCMLMGYTGFHTFKEK 286
            + SI+  A     N   + + L++ S     R+ ++S  +S  + + +G  G+ TF   
Sbjct: 192 STFSIIILAYTGSMNMFSVINELKDNSTANAKRVVYYSVGISTLIFLSVGLGGYLTFGNN 251

Query: 287 TKGNVLNNFSGDDGWINVARLFFGFNMLTTFPL 319
              NV+ N+        +     G  ++ +FPL
Sbjct: 252 VLTNVILNYDESAITTRIGTFSLGTMVILSFPL 284

>KAFR0D02000 Chr4 (407474..409618) [2145 bp, 714 aa] {ON} Anc_2.177
           YNL101W
          Length = 714

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 29/142 (20%), Positives = 58/142 (40%), Gaps = 10/142 (7%)

Query: 16  SYELHELENPLIAGI----------IETNEEKSPLHMAFMNMANSILGAGIISQPFAVRE 65
           S    E  +PL+ G+          +ET +  +    AF+ +  S +G G++  P A   
Sbjct: 267 SLTFEEERSPLVTGLTLPDSVTRANVETIKGTTSTRKAFLLLLKSFVGTGVLFLPDAFHN 326

Query: 66  AGVLGAFVVYIALGFLVDWTLRLIVQNLVITGTETYQESVAVALGEPGRLAILLANGLFA 125
            G+  + +V   +G    W   ++VQ  V     ++ +  +   G+  +  IL+A  +  
Sbjct: 327 GGLAFSIIVLTLVGLYSYWCYYILVQTKVKVKACSFGDIGSQLYGKWMKSVILVAIFVSQ 386

Query: 126 FGGCVAFCIIIGDTIPHVLRTV 147
            G   A+ I     +   L+ +
Sbjct: 387 LGFSAAYMIFTAKNLGAFLQNI 408

>KLLA0C13277g Chr3 (1135255..1137420) [2166 bp, 721 aa] {ON} similar
           to uniprot|P50944 Saccharomyces cerevisiae YNL101W AVT4
           Vacuolar transporter exports large neutral amino acids
           from the vacuole member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 721

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 30/130 (23%), Positives = 57/130 (43%), Gaps = 14/130 (10%)

Query: 18  ELHELENPLIAG------------IIETNEEKSPLHMAFMNMANSILGAGIISQPFAVRE 65
           E +E E PL+              I   ++ K+    AF+ M  S +G G++  P A   
Sbjct: 273 EFNESEVPLLNASDRERLGHNKRVIARPSQVKTSTFKAFLLMLKSFIGTGVLFLPSAFAN 332

Query: 66  AGVLGAFVVYIALGFLVDWTLRLIVQNLVITGTETYQESVAVALGEP-GRLAILLANGLF 124
            G++ + ++    G    W   +++++ V TG  ++ + + + L  P  R AIL +  L 
Sbjct: 333 GGLIFSVLMLSFFGMYSYWCYYILIRSKVATGVSSFGD-IGIKLYGPWMRYAILASLILT 391

Query: 125 AFGGCVAFCI 134
             G   A+ +
Sbjct: 392 QLGFSAAYVV 401

>AER380C Chr5 complement(1349610..1351760) [2151 bp, 716 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL101W
           (AVT4)
          Length = 716

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 29/143 (20%), Positives = 56/143 (39%), Gaps = 9/143 (6%)

Query: 14  PPSYELHELEN-PLIAGIIETNEEKSPLHM--------AFMNMANSILGAGIISQPFAVR 64
           PP+Y     E+ PL+       +++ P H+        AF+ M  S +G G++  P A  
Sbjct: 266 PPTYATGVDEHTPLLLNTDPEQQQQVPAHLRVKTSTFKAFLLMIKSFIGTGVLFLPNAFS 325

Query: 65  EAGVLGAFVVYIALGFLVDWTLRLIVQNLVITGTETYQESVAVALGEPGRLAILLANGLF 124
             G+  +  +         W   ++V++   TG  ++ +   +  G   +  IL +  L 
Sbjct: 326 NGGLAFSISMLFFFSAYSYWCYYILVRSKDATGVSSFGDIGGILFGSWMKFIILFSLVLT 385

Query: 125 AFGGCVAFCIIIGDTIPHVLRTV 147
             G   A+ +     +   L  V
Sbjct: 386 QMGFAGAYVVFTAKNLIAFLDNV 408

>Smik_11.90 Chr11 (157718..159760) [2043 bp, 680 aa] {ON} YKL146W
           (REAL)
          Length = 680

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 34/70 (48%), Gaps = 4/70 (5%)

Query: 410 NLGALLEVIGSTTGALTAYILPPLTHVLLTRRRPQPHTARERLG-HCCCVVFGCTVMLVS 468
           +L   + ++GS       YI PPL H    +      T+R RL      +VFG  VM+ +
Sbjct: 614 DLDKFVSLVGSFACIPLIYIYPPLLHY---KASSISGTSRARLLLDLIVIVFGVAVMVYT 670

Query: 469 TTQTLLDWSR 478
           + QT+  WS+
Sbjct: 671 SWQTIKMWSK 680

>ACR051C Chr3 complement(448844..450880) [2037 bp, 678 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL146W
          Length = 678

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 36/82 (43%), Gaps = 4/82 (4%)

Query: 252 KSIYKFNRLTHWSCAVSVSVCMLMGYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGF 311
           +S  KF R   W      +V +  G   +  F  K +  +L NF  D       +L +  
Sbjct: 493 RSPEKFRRCLLWVMVAVTAVFISFGMLCYAAFGAKVETVILLNFPQDSALGTGVQLLYAA 552

Query: 312 NMLTTFPLEIF----VLRNVVL 329
            ++ + PL++F    +L NVV+
Sbjct: 553 AIMLSTPLQLFPAIRILENVVV 574

>NDAI0C03790 Chr3 complement(863178..865343) [2166 bp, 721 aa] {ON}
           Anc_5.252
          Length = 721

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 36/73 (49%), Gaps = 2/73 (2%)

Query: 265 CAVSVSVCMLMGYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFPLEIFVL 324
           C V++ + +  G   +  F EK +  VL NF  D  +  + +L +   +L + PL++F  
Sbjct: 549 CIVTI-IFISCGLICYSAFGEKVETVVLLNFPQDSAFTLMVQLLYSLAILLSTPLQLFPA 607

Query: 325 RNVVLDIWAGPTH 337
              +L+ W  P H
Sbjct: 608 IK-ILENWTFPIH 619

>SAKL0E10362g Chr5 complement(860653..862854) [2202 bp, 733 aa] {ON}
           similar to uniprot|P50944 Saccharomyces cerevisiae
           YNL101W AVT4 Vacuolar transporter exports large neutral
           amino acids from the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 733

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 28/136 (20%), Positives = 54/136 (39%), Gaps = 12/136 (8%)

Query: 24  NPLIAGIIETNEEKSPLHM------------AFMNMANSILGAGIISQPFAVREAGVLGA 71
           +PL++G IE+   ++ +H             AF+ M  S +G G++  P A    G+  +
Sbjct: 290 SPLLSGDIESRGGRAKVHAPRSAKGTTSTFKAFLLMIKSFIGTGVLFLPNAFANGGLTFS 349

Query: 72  FVVYIALGFLVDWTLRLIVQNLVITGTETYQESVAVALGEPGRLAILLANGLFAFGGCVA 131
             +    G    W   +++Q+ V T   ++ +      G   +  IL +  L   G   A
Sbjct: 350 VCMLSFFGIYSYWCYYILIQSKVATKVSSFGDIGFRLYGTWMKFVILFSLVLTQLGFSGA 409

Query: 132 FCIIIGDTIPHVLRTV 147
           + +     +   L  V
Sbjct: 410 YVVFTAKNLIAFLDNV 425

>NCAS0E02440 Chr5 (477113..478600) [1488 bp, 495 aa] {ON} Anc_7.420
          Length = 495

 Score = 31.6 bits (70), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 38/206 (18%), Positives = 74/206 (35%), Gaps = 7/206 (3%)

Query: 119 LANGLFAFGGCVAFCIIIGDTIPHVLRTVCPPQYI-ERNWXXXXXXXXXXXXXXXXXXXX 177
           LA  +  FG  V++ I++GD +P ++  +     + +R +                    
Sbjct: 89  LAIAIKCFGVGVSYMIVVGDLMPQIVSGLTKNALLLDRVFHITLIMAFVAGPLCLLKNLN 148

Query: 178 XXERASFLXXXXXXXXXXXXXXRGPFLPSELKSQVSLFAPQWWF---RKTIFKSVSIVSF 234
               AS +                 F   E+K     FA   WF     +   ++ I  F
Sbjct: 149 SLRYASMVAISAVAYLCILVLVHFIFPSQEIKDLKGDFA--VWFPHNEGSPLSTLPIFVF 206

Query: 235 ALVCHHNTSFIFHSLRNKSIYKFNRLTHWSCAVSVSVCMLMGYTGFHTFKEKTKGNVLNN 294
           A  CHHN   + +  +         +   +  +++ + +L+G  G+ TF     GN++  
Sbjct: 207 AYTCHHNVFAVINEQKKTRFAHVKVIAIIAMLLALVLYVLIGGAGYFTFGNHIVGNIITL 266

Query: 295 FSGDDGWINVARLFFGFNMLTTFPLE 320
           +        + R+   F +   FPL+
Sbjct: 267 YPHSITS-TIGRVAIVFLVTLAFPLQ 291

>NDAI0F02660 Chr6 complement(649723..651855) [2133 bp, 710 aa] {ON}
           Anc_2.177
          Length = 710

 Score = 30.8 bits (68), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 21/91 (23%), Positives = 38/91 (41%)

Query: 44  FMNMANSILGAGIISQPFAVREAGVLGAFVVYIALGFLVDWTLRLIVQNLVITGTETYQE 103
           F+ +  S +G GI+  P A    G+L + ++    G    W   ++ +  V TG  ++ +
Sbjct: 299 FLLLLKSFMGTGILFLPAAFHNGGLLFSIIMLFFFGIYSYWCYYILTKAKVATGQSSFGD 358

Query: 104 SVAVALGEPGRLAILLANGLFAFGGCVAFCI 134
                 G   +  IL +  L   G   A+ I
Sbjct: 359 IGLKLYGPSMKFIILFSLVLTQLGFSAAYMI 389

>Kpol_505.5 s505 complement(5011..7074) [2064 bp, 687 aa] {ON}
           complement(5011..7074) [2064 nt, 688 aa]
          Length = 687

 Score = 30.8 bits (68), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 32/58 (55%)

Query: 273 MLMGYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFPLEIFVLRNVVLD 330
           +++   G+ ++   T+  +L NF   +  +N+ +LF+   +L + PL+IF    +V D
Sbjct: 505 IIIATIGYLSYGSSTETIILQNFPQKNIVVNLIQLFYALAILLSTPLQIFPAIEIVED 562

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.140    0.451 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 38,826,546
Number of extensions: 1399379
Number of successful extensions: 4220
Number of sequences better than 10.0: 85
Number of HSP's gapped: 4219
Number of HSP's successfully gapped: 129
Length of query: 513
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 399
Effective length of database: 40,409,475
Effective search space: 16123380525
Effective search space used: 16123380525
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 68 (30.8 bits)