Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0C002701.10ON1741748851e-123
ZYRO0F18370g1.10ON2201663522e-41
TDEL0C069301.10ON1841723413e-40
NDAI0A001901.10ON1711583385e-40
KAFR0D001901.10ON1851683135e-36
NCAS0B090601.10ON1671652977e-34
KLLA0C00594g1.10ON1941812721e-29
SAKL0C00572g1.10ON3381682801e-29
TPHA0E039601.10ON1771592249e-23
Kwal_33.130231.10ON1931622083e-20
KLTH0F00572g1.10ON1951691995e-19
TBLA0A049701.10ON181581752e-15
Kpol_2002.131.10ON164461522e-12
Ecym_10121.10ON1771371226e-08
YCL056C (PEX34)1.10ON144166830.009
KAFR0K018607.397ON64854760.19
NDAI0A016007.397ON64554760.20
Kpol_1050.1117.545ON15699730.25
Smik_3.191.10ON144166700.52
Skud_3.81.10ON144167700.60
KNAG0J028004.35ON63838710.86
Kwal_27.108177.397ON65054700.97
CAGL0G03795g4.35ON64038701.0
KAFR0I013804.35ON63838701.0
Smik_12.404.35ON63938701.0
YLL024C (SSA2)4.35ON63938701.0
NCAS0C057604.35ON64038701.0
Skud_1.58na 1ON64238701.0
YAL005C (SSA1)na 1ON64238701.0
Smik_1.63na 1ON64638701.0
Smik_1.64na 2ON56438701.0
Suva_10.494.35ON54738691.2
CAGL0G03289g7.397ON64754691.2
TBLA0E016004.35ON63938691.2
TDEL0F016204.35ON65238691.3
NDAI0H003504.35ON64238691.3
KNAG0B057404.183ON28654681.5
TDEL0C015007.397ON64554691.5
TPHA0F023502.68ON111143691.5
SAKL0H20020g4.35ON64138681.8
Ecym_62084.35ON64638681.8
Skud_12.444.35ON63938681.8
Kwal_14.21304.35ON64038672.2
KLLA0D04224g4.35ON64038672.2
KLTH0H08448g4.35ON64138672.2
AFR114W4.35ON64138672.2
ZYRO0B00836g4.35ON64138672.3
TPHA0K020904.35ON64138672.4
NCAS0A052204.148ON38989672.4
SAKL0F12606g7.397ON65538672.5
Ecym_46787.397ON64838662.9
AER187W7.397ON64938662.9
KNAG0C035307.397ON65038663.0
KLTH0C06556g7.397ON65754663.0
NDAI0B047801.316ON44078663.4
NCAS0E025807.397ON64638663.6
KLLA0B09196g3.370ON59099663.7
YBL075C (SSA3)7.397ON64954654.0
Suva_3.1571.10ON144170635.0
KLLA0E20527g7.397ON65038637.4
TBLA0D005807.397ON63838637.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0C00270
         (174 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0C00270 Chr3 complement(41823..42347) [525 bp, 174 aa] {ON} ...   345   e-123
ZYRO0F18370g Chr6 (1518178..1518840) [663 bp, 220 aa] {ON} conse...   140   2e-41
TDEL0C06930 Chr3 (1260938..1261492) [555 bp, 184 aa] {ON} Anc_1....   135   3e-40
NDAI0A00190 Chr1 complement(17031..17546) [516 bp, 171 aa] {ON} ...   134   5e-40
KAFR0D00190 Chr4 complement(21149..21706) [558 bp, 185 aa] {ON} ...   125   5e-36
NCAS0B09060 Chr2 (1741161..1741664) [504 bp, 167 aa] {ON} Anc_1....   119   7e-34
KLLA0C00594g Chr3 complement(44220..44804) [585 bp, 194 aa] {ON}...   109   1e-29
SAKL0C00572g Chr3 complement(51031..52047) [1017 bp, 338 aa] {ON...   112   1e-29
TPHA0E03960 Chr5 (833382..833915) [534 bp, 177 aa] {ON} Anc_1.10...    91   9e-23
Kwal_33.13023 s33 complement(43697..44278) [582 bp, 193 aa] {ON}...    85   3e-20
KLTH0F00572g Chr6 complement(42946..43533) [588 bp, 195 aa] {ON}...    81   5e-19
TBLA0A04970 Chr1 complement(1220824..1221369) [546 bp, 181 aa] {...    72   2e-15
Kpol_2002.13 s2002 complement(23954..24448) [495 bp, 164 aa] {ON...    63   2e-12
Ecym_1012 Chr1 complement(22226..22759) [534 bp, 177 aa] {ON} si...    52   6e-08
YCL056C Chr3 complement(26925..27359) [435 bp, 144 aa] {ON}  PEX...    37   0.009
KAFR0K01860 Chr11 (383797..385743) [1947 bp, 648 aa] {ON} Anc_7....    34   0.19 
NDAI0A01600 Chr1 complement(356196..358133) [1938 bp, 645 aa] {O...    34   0.20 
Kpol_1050.111 s1050 complement(248965..249435) [471 bp, 156 aa] ...    33   0.25 
Smik_3.19 Chr3 complement(28371..28805) [435 bp, 144 aa] {ON} YC...    32   0.52 
Skud_3.8 Chr3 complement(14921..15355) [435 bp, 144 aa] {ON} YCL...    32   0.60 
KNAG0J02800 Chr10 (533392..535308) [1917 bp, 638 aa] {ON} Anc_4....    32   0.86 
Kwal_27.10817 s27 complement(511677..513629) [1953 bp, 650 aa] {...    32   0.97 
CAGL0G03795g Chr7 (363008..364930) [1923 bp, 640 aa] {ON} highly...    32   1.0  
KAFR0I01380 Chr9 (285222..287138) [1917 bp, 638 aa] {ON} Anc_4.3...    32   1.0  
Smik_12.40 Chr12 complement(81503..81815,81873..83479) [1920 bp,...    32   1.0  
YLL024C Chr12 complement(95566..97485) [1920 bp, 639 aa] {ON}  S...    32   1.0  
NCAS0C05760 Chr3 (1183153..1185075) [1923 bp, 640 aa] {ON} Anc_2...    32   1.0  
Skud_1.58 Chr1 complement(114595..116523) [1929 bp, 642 aa] {ON}...    32   1.0  
YAL005C Chr1 complement(139503..141431) [1929 bp, 642 aa] {ON}  ...    32   1.0  
Smik_1.63 Chr1 complement(122625..122997,123054..124621) [1941 b...    32   1.0  
Smik_1.64 Chr1 complement(122927..124621) [1695 bp, 564 aa] {ON}...    32   1.0  
Suva_10.49 Chr10 complement(99921..101564) [1644 bp, 547 aa] {ON...    31   1.2  
CAGL0G03289g Chr7 (312871..314814) [1944 bp, 647 aa] {ON} highly...    31   1.2  
TBLA0E01600 Chr5 complement(379910..381829) [1920 bp, 639 aa] {O...    31   1.2  
TDEL0F01620 Chr6 (296605..298563) [1959 bp, 652 aa] {ON} Anc_4.3...    31   1.3  
NDAI0H00350 Chr8 complement(68865..70793) [1929 bp, 642 aa] {ON}...    31   1.3  
KNAG0B05740 Chr2 complement(1128540..1129400) [861 bp, 286 aa] {...    31   1.5  
TDEL0C01500 Chr3 complement(260222..262159) [1938 bp, 645 aa] {O...    31   1.5  
TPHA0F02350 Chr6 (516707..520042) [3336 bp, 1111 aa] {ON} Anc_2....    31   1.5  
SAKL0H20020g Chr8 complement(1752241..1754166) [1926 bp, 641 aa]...    31   1.8  
Ecym_6208 Chr6 (389653..391593) [1941 bp, 646 aa] {ON} similar t...    31   1.8  
Skud_12.44 Chr12 complement(86737..88656) [1920 bp, 639 aa] {ON}...    31   1.8  
Kwal_14.2130 s14 complement(627452..629374) [1923 bp, 640 aa] {O...    30   2.2  
KLLA0D04224g Chr4 (363732..365654) [1923 bp, 640 aa] {ON} highly...    30   2.2  
KLTH0H08448g Chr8 complement(736894..738819) [1926 bp, 641 aa] {...    30   2.2  
AFR114W Chr6 (641037..642962) [1926 bp, 641 aa] {ON} Syntenic ho...    30   2.2  
ZYRO0B00836g Chr2 (65436..67361) [1926 bp, 641 aa] {ON} highly s...    30   2.3  
TPHA0K02090 Chr11 (445610..447535) [1926 bp, 641 aa] {ON} Anc_4....    30   2.4  
NCAS0A05220 Chr1 (1032827..1033996) [1170 bp, 389 aa] {ON} Anc_4...    30   2.4  
SAKL0F12606g Chr6 (981486..983453) [1968 bp, 655 aa] {ON} highly...    30   2.5  
Ecym_4678 Chr4 complement(1322349..1324295) [1947 bp, 648 aa] {O...    30   2.9  
AER187W Chr5 (983874..985823) [1950 bp, 649 aa] {ON} Non-synteni...    30   2.9  
KNAG0C03530 Chr3 complement(690575..692527) [1953 bp, 650 aa] {O...    30   3.0  
KLTH0C06556g Chr3 complement(573847..575820) [1974 bp, 657 aa] {...    30   3.0  
NDAI0B04780 Chr2 complement(1176912..1178234) [1323 bp, 440 aa] ...    30   3.4  
NCAS0E02580 Chr5 complement(515573..517513) [1941 bp, 646 aa] {O...    30   3.6  
KLLA0B09196g Chr2 complement(803259..805031) [1773 bp, 590 aa] {...    30   3.7  
YBL075C Chr2 complement(84499..86448) [1950 bp, 649 aa] {ON}  SS...    30   4.0  
Suva_3.157 Chr3 complement(236677..237111) [435 bp, 144 aa] {ON}...    29   5.0  
KLLA0E20527g Chr5 (1822412..1824364) [1953 bp, 650 aa] {ON} high...    29   7.4  
TBLA0D00580 Chr4 complement(152874..154790) [1917 bp, 638 aa] {O...    29   7.5  

>KNAG0C00270 Chr3 complement(41823..42347) [525 bp, 174 aa] {ON}
           Anc_1.10 YCL056C
          Length = 174

 Score =  345 bits (885), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 174/174 (100%), Positives = 174/174 (100%)

Query: 1   MKTAASLSWEDVLLGKLESICSIFDNIYLLKSLGIISKENFLYRKLNKGNVGSKVWFLTL 60
           MKTAASLSWEDVLLGKLESICSIFDNIYLLKSLGIISKENFLYRKLNKGNVGSKVWFLTL
Sbjct: 1   MKTAASLSWEDVLLGKLESICSIFDNIYLLKSLGIISKENFLYRKLNKGNVGSKVWFLTL 60

Query: 61  ILSIRKNLKRLVRLVQTRFKLVFEIEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIID 120
           ILSIRKNLKRLVRLVQTRFKLVFEIEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIID
Sbjct: 61  ILSIRKNLKRLVRLVQTRFKLVFEIEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIID 120

Query: 121 TFLDLAQLLIYLFIVSGDCFNIPPRFKKFKKYLGPMSNVVTILRMLVSVYTTIY 174
           TFLDLAQLLIYLFIVSGDCFNIPPRFKKFKKYLGPMSNVVTILRMLVSVYTTIY
Sbjct: 121 TFLDLAQLLIYLFIVSGDCFNIPPRFKKFKKYLGPMSNVVTILRMLVSVYTTIY 174

>ZYRO0F18370g Chr6 (1518178..1518840) [663 bp, 220 aa] {ON}
           conserved hypothetical protein
          Length = 220

 Score =  140 bits (352), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 74/166 (44%), Positives = 115/166 (69%), Gaps = 3/166 (1%)

Query: 8   SWEDVLLGKLESICSIFDNIYLLKSLGIISKENFLYRKLNKGNVGSKVWFLTLILSIRKN 67
           ++ED L+  LESIC +FDN+YLLK+LGIIS++N LYR+LNKG  GSK+WF+TL+LS RK+
Sbjct: 56  TFEDTLIAGLESICGLFDNVYLLKTLGIISEDNLLYRRLNKGEWGSKLWFVTLLLSARKS 115

Query: 68  LKRLVRLVQTRFKLVFEIEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTFLDLAQ 127
             RL+++++ + KL  E++++  + + D+ LV  V+ NK +  L+KC  +I D  L+L Q
Sbjct: 116 FSRLLKIMKAKSKLKEEMKEL--RTEGDEDLVKQVLRNKFTDALKKCSIIIKDVVLELLQ 173

Query: 128 LLIYLFIVSGDCFNIPPRFKKFKKYLGPMSNVVTILRMLVSVYTTI 173
            L YL IV  + F I    +K  K L P+S+ + ++R+  + YTT+
Sbjct: 174 TLAYLAIVVIEVFKINVS-QKVIKILEPLSHFIAVIRIFTTGYTTL 218

>TDEL0C06930 Chr3 (1260938..1261492) [555 bp, 184 aa] {ON} Anc_1.10
           YCL056C
          Length = 184

 Score =  135 bits (341), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 115/172 (66%), Gaps = 8/172 (4%)

Query: 4   AASLSWEDVLLGKLESICSIFDNIYLLKSLGIISKENFLYRKLNKGNVGSKVWFLTLILS 63
            +  S+ED L+  LES+CS FDN+Y  KSLGII + NFLYR+LNKG  GSK+WF+TL+LS
Sbjct: 17  GSKTSFEDNLIAGLESVCSFFDNVYFAKSLGIIGENNFLYRRLNKGGWGSKLWFVTLLLS 76

Query: 64  IRKNLKRLVRLVQTRFKLVFEIEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTFL 123
           +RK L+++ ++V+ R +L  EI+ + +  K    L+N+V+  K+   L+K + M+ +T L
Sbjct: 77  VRKCLRQIFQIVRNRIRLKTEIKGMDKNGK---GLMNDVLKEKILLMLQKSNAMMRETLL 133

Query: 124 DLAQLLIYLFIVSGDCF--NIPPRFKKFKKYLGPMSNVVTILRMLVSVYTTI 173
           DL Q  +YL IV  D F  NIP   K+ ++ L P+SN VTI+R     ++++
Sbjct: 134 DLLQNSVYLMIVVIDVFKLNIP---KRARQILEPLSNFVTIMRFFTMGFSSV 182

>NDAI0A00190 Chr1 complement(17031..17546) [516 bp, 171 aa] {ON}
           Anc_1.10 YCL056C
          Length = 171

 Score =  134 bits (338), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 110/158 (69%), Gaps = 2/158 (1%)

Query: 8   SWEDVLLGKLESICSIFDNIYLLKSLGIISKENFLYRKLNKGNVGSKVWFLTLILSIRKN 67
           + ED ++G LE IC+IFDN+YLLKSLGIIS+ N LYR LNKGN GSK+WF+TLIL+ RK 
Sbjct: 4   TMEDSIIGGLEYICNIFDNVYLLKSLGIISENNLLYRNLNKGNFGSKIWFVTLILTTRKL 63

Query: 68  LKRLVRLVQTRFKLVFEIEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTFLDLAQ 127
           + +L+R V+ R +LV E +   R  + +++LV++V+  KL   ++KC  MI+D  L+L Q
Sbjct: 64  VHQLIRAVKARIRLVKERKNSKRITR-NENLVSSVLHEKLDIGIKKCSSMIMDLLLELFQ 122

Query: 128 LLIYLFIVSGDCFNIPPRFKKFKKYLGPMSNVVTILRM 165
            L+YLF+VS + F +     K    L  +SN++ ++RM
Sbjct: 123 TLVYLFLVSINIFKLKFS-DKMVYVLEHLSNLLVLIRM 159

>KAFR0D00190 Chr4 complement(21149..21706) [558 bp, 185 aa] {ON}
           Anc_1.10 YCL056C
          Length = 185

 Score =  125 bits (313), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 116/168 (69%), Gaps = 4/168 (2%)

Query: 6   SLSWEDVLLGKLESICSIFDNIYLLKSLGIISKENFLYRKLNKGNVGSKVWFLTLILSIR 65
           S++ ED+L+ KLE IC++FDNIY LK+LG+I ++NF+Y+KLNKGN+GSK+W ++LILSIR
Sbjct: 16  SITLEDILIDKLEGICTVFDNIYFLKNLGVIKEDNFIYKKLNKGNLGSKIWLVSLILSIR 75

Query: 66  KNLKRLVRLVQTRFKLVFEIEQIL--RQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTFL 123
           +  K L  + +TR K V E+  +   R +  ++ LVN ++ +KL  +L+KC+ +I D  L
Sbjct: 76  RCFKNLTHMYRTRRKYVTELSIVSKKRNQSSENGLVNGILKDKLLQSLQKCNSIIRDLLL 135

Query: 124 DLAQLLIYLFIVSGDCFNIP--PRFKKFKKYLGPMSNVVTILRMLVSV 169
           +  Q+L+YL IV  + F +    R+ K  + L  +SN++T+ R++ + 
Sbjct: 136 EFLQVLLYLIIVIIEVFKVKSLERYVKGIRNLEILSNLITVTRIITAT 183

>NCAS0B09060 Chr2 (1741161..1741664) [504 bp, 167 aa] {ON} Anc_1.10
           YCL056C
          Length = 167

 Score =  119 bits (297), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 114/165 (69%), Gaps = 3/165 (1%)

Query: 10  EDVLLGKLESICSIFDNIYLLKSLGIISKENFLYRKLNKGNVGSKVWFLTLILSIRKNLK 69
           ED +L  LESIC+IFDN+Y  KS+G++S++N LYR LNKG+ GSK+WFLTL+LS +K + 
Sbjct: 5   EDNVLNALESICNIFDNVYFFKSIGVLSEKNILYRTLNKGDFGSKLWFLTLLLSSKKLIT 64

Query: 70  RLVRLVQTRFKLVFEIEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTFLDLAQLL 129
           RL + ++ R K+  EI++  ++   D SLVN+++  KL  +L KC  +I +  L+L Q +
Sbjct: 65  RLTKSLKIRAKIKKEIDESPKENDEDKSLVNSLLREKLELSLAKCMDIIRNNVLELLQTM 124

Query: 130 IYLFIVSGDCFNIP-PRFKKFKKYLGPMSNVVTILRMLVSVYTTI 173
           +YL I   + F +  P+  K+K  L  +SN++TI+R+ +S Y+++
Sbjct: 125 MYLSIAFINVFKVKVPQ--KWKHLLEQLSNIITIIRVFISGYSSL 167

>KLLA0C00594g Chr3 complement(44220..44804) [585 bp, 194 aa] {ON}
           conserved hypothetical protein
          Length = 194

 Score =  109 bits (272), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 109/181 (60%), Gaps = 28/181 (15%)

Query: 2   KTAASLSWEDVLLGKLESICSIFDNIYLLKSLGIISKENFLYRKLNKGNVGSKVWFLTLI 61
           + A S S ED+L+  L S+ S FD++YLL+S GIIS  NFLY+KLNKG++GSKVW ++L+
Sbjct: 26  EDAPSNSLEDLLIDSLTSVSSFFDDLYLLRSFGIISDTNFLYQKLNKGDIGSKVWLVSLL 85

Query: 62  LSIRKNLKRLVRLVQTRFKLVFE-----------IEQILRQKKLDDSLVNNVVLNKLSTN 110
           LSIR++L RL  L++ + KL  E            ++++++K L +S       N+LS  
Sbjct: 86  LSIRRSLTRLYTLIRLKLKLRKECMNIASTYSPGFKKLVKEKILAES-------NQLSLK 138

Query: 111 LRK-CHFMIIDTFLDLAQLLIYLFIVSGDCFNIPPRFKKFKKYLGPMSNVVTILRMLVSV 169
           +R  C        +DL Q L+Y+ IVS D F I     KFK+ L  +S+  T+L+ + S 
Sbjct: 139 IRSLC--------MDLLQDLLYMIIVSIDIFKINLSL-KFKRALELISSAATVLKFVSSS 189

Query: 170 Y 170
           Y
Sbjct: 190 Y 190

>SAKL0C00572g Chr3 complement(51031..52047) [1017 bp, 338 aa] {ON}
           conserved hypothetical protein
          Length = 338

 Score =  112 bits (280), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 63/168 (37%), Positives = 106/168 (63%), Gaps = 8/168 (4%)

Query: 8   SWEDVLLGKLESICSIFDNIYLLKSLGIISKENFLYRKLNKGNVGSKVWFLTLILSIRKN 67
           S+ED+L+G LES+ ++FD++YLLK+ GII + NF+YR LNKG +GSK+W  TL+LS+RK+
Sbjct: 175 SFEDILIGGLESLTNVFDDVYLLKNFGIIGETNFVYRHLNKGGLGSKLWLATLVLSLRKS 234

Query: 68  LKRLVRLVQTRFKLVFEIEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTFLDLAQ 127
           L +L RL + R  L  + E+     K   +    ++ +K +  + +    I D  LD+ Q
Sbjct: 235 LGQLFRLARARHML--QKERRSTPHKCSKTFA-KIIADKFTQKIGQLDRQIKDVLLDVLQ 291

Query: 128 LLIYLFIVSGDCF--NIPPRFKKFKKYLGPMSNVVTILRMLVSVYTTI 173
            L YL +V+ D F   +P R+++  ++   +S++VT+ R   + ++TI
Sbjct: 292 NLAYLLVVAVDVFKLKLPHRWRRLLEW---VSSLVTVSRFFFTGFSTI 336

>TPHA0E03960 Chr5 (833382..833915) [534 bp, 177 aa] {ON} Anc_1.10
           YCL056C
          Length = 177

 Score = 90.9 bits (224), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 60/159 (37%), Positives = 93/159 (58%), Gaps = 5/159 (3%)

Query: 9   WEDVLLGKLESICSIFDNIYLLKSLGIISKENFLYRKLNKGNVGSKVWFLTLILSIRKNL 68
           +E  LL  LESI +IFD ++ L+S G+I + NF YR LN+ N+GSK+WF+TLILSIRK  
Sbjct: 17  FESTLLNYLESITNIFDLVFFLRSTGLIKENNFFYRNLNRSNIGSKIWFVTLILSIRKLY 76

Query: 69  KRLVRLVQTRFKLVFEIEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTFLDLAQL 128
           K +++  +    L  E+ +I +    ++ L ++++L K+  N       I +  ++L Q 
Sbjct: 77  KNILKSTKLLSLLKTELTKIEK----NNDLTSDIILQKIQNNNTILKKKIKNFIIELIQD 132

Query: 129 LIYLFIVSGDCFNIPPRFKKFKKYLGPMSNVVTILRMLV 167
            IYL IVS + F I    KK    L  +SN V++L+   
Sbjct: 133 FIYLIIVSLEIFKISIS-KKLNHRLEILSNSVSMLKFFT 170

>Kwal_33.13023 s33 complement(43697..44278) [582 bp, 193 aa] {ON}
           [contig 123] FULL
          Length = 193

 Score = 84.7 bits (208), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 56/162 (34%), Positives = 98/162 (60%), Gaps = 5/162 (3%)

Query: 10  EDVLLGKLESICSIFDNIYLLKSLGIISKENFLYRKLNKGNVGSKVWFLTLILSIRKNLK 69
           E+  +  +ES+  +FD+I+LLKS GIIS+ N++YRKLNK    SKVW L+L+LS RK ++
Sbjct: 34  ENFCISGMESVAGLFDDIHLLKSFGIISESNYVYRKLNKSGFCSKVWLLSLVLSTRKCIR 93

Query: 70  RLVRLVQTRFKLVFEIEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTFLDLAQLL 129
            L  L  +R +L    E++       +SL    + +K++  ++  +  +I   L++ Q +
Sbjct: 94  DLNNLWMSRSRL--RKEEVHFTMHSSNSL-RRALSDKIALKIKDVNRRLILVALEIMQNI 150

Query: 130 IYLFIVSGDCFNIPPRFKKFKKYLGPMSNVVTILRML-VSVY 170
            YL IV+ D F +    +++K  L   S+++T+L+ L +S+Y
Sbjct: 151 AYLIIVAADVFTLNL-VERWKNLLEKCSSLLTVLKFLFLSIY 191

>KLTH0F00572g Chr6 complement(42946..43533) [588 bp, 195 aa] {ON}
           conserved hypothetical protein
          Length = 195

 Score = 81.3 bits (199), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 97/169 (57%), Gaps = 14/169 (8%)

Query: 10  EDVLLGKLESICSIFDNIYLLKSLGIISKENFLYRKLNKGNVGSKVWFLTLILSIRKNLK 69
           E  L+  LE+I  IFD++ LL+S G+I + N  Y+KLNK    SK W ++L LS R+N  
Sbjct: 34  ESALVSGLETIAGIFDDLQLLRSFGVIGENNVFYQKLNKSGFCSKAWLVSLTLSSRRNAS 93

Query: 70  RLVRLVQTRFKLVFEIEQILRQKKLDDSLVNNV--VLN-KLSTNLRKCHFMIIDTFLDLA 126
            ++ L  +R +L  E  + +R+       VN V  VLN K++  +++ +  +I   L+L 
Sbjct: 94  DIINLAISRSRLKREQAEFMRRP------VNPVRKVLNAKVTARIQEINQKLILVALELI 147

Query: 127 QLLIYLFIVSGD--CFNIPPRFKKFKKYLGPMSNVVTILRMLVSVYTTI 173
           Q + YL +V+ D   F +    +K+K+ L  +S++  I R+L S ++++
Sbjct: 148 QNIGYLTLVAADVLAFGL---TEKWKRLLERVSSIFAIARLLFSGFSSL 193

>TBLA0A04970 Chr1 complement(1220824..1221369) [546 bp, 181 aa]
          {ON} Anc_1.10 YCL056C
          Length = 181

 Score = 72.0 bits (175), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 34/58 (58%), Positives = 46/58 (79%), Gaps = 2/58 (3%)

Query: 9  WE-DVLLGKLESICSIFDNIYLLKSLGIISKENFLYRKLNKGNVGSKVWFLTLILSIR 65
          W+ D+L G LESICS+FDNIY L+S+G+IS  N  YR LN+  +GSK+W +TL+L+IR
Sbjct: 9  WKFDILYG-LESICSVFDNIYFLRSIGLISDTNLFYRLLNRSELGSKIWLITLVLNIR 65

>Kpol_2002.13 s2002 complement(23954..24448) [495 bp, 164 aa] {ON}
          complement(23954..24448) [495 nt, 165 aa]
          Length = 164

 Score = 63.2 bits (152), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 27/46 (58%), Positives = 38/46 (82%)

Query: 5  ASLSWEDVLLGKLESICSIFDNIYLLKSLGIISKENFLYRKLNKGN 50
          ASL WED++L  LE ICS+FD+IY +K+LGII+ ++FLYRK+ + N
Sbjct: 2  ASLGWEDIVLDGLEGICSLFDSIYFIKTLGIITDKSFLYRKIIQNN 47

>Ecym_1012 Chr1 complement(22226..22759) [534 bp, 177 aa] {ON}
           similar to XP_452220 - K. lactis - KLLA0C00594g
          Length = 177

 Score = 51.6 bits (122), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 69/137 (50%), Gaps = 13/137 (9%)

Query: 4   AASLSWEDVLLGKLESICSIFDNIYLLKSLGIISKENFLYRKLNKGNVGSKVWFLTLILS 63
            +  ++ED L   L S  + +D IYL +S+GII K+N +Y+ L  G + S    L L+L 
Sbjct: 28  GSPTTFEDQLTENLRSAVTFYDLIYLFQSIGIIKKDNVIYKALAVGKINSGSRLLFLLLV 87

Query: 64  IRKNLKRLVRLVQTRFKLVFEIEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTFL 123
            RK   +L+RLV    +L + ++ +L    +          N+  + +++    I+   +
Sbjct: 88  ARKTFLKLLRLV----RLWYALKNVLPPASIKKK------YNETKSRVKRS---ILRLSV 134

Query: 124 DLAQLLIYLFIVSGDCF 140
           DL   L+YL +V  D F
Sbjct: 135 DLLDTLVYLIVVLIDLF 151

>YCL056C Chr3 complement(26925..27359) [435 bp, 144 aa] {ON}
           PEX34Peroxisomal integral membrane protein that
           regulates peroxisome populations; interacts with Pex11p,
           Pex25p, and Pex27p to control both constitutive
           peroxisome division and peroxisome morphology and
           abundance during peroxisome proliferation
          Length = 144

 Score = 36.6 bits (83), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 44/166 (26%), Positives = 79/166 (47%), Gaps = 26/166 (15%)

Query: 2   KTAASLSWEDVLLGKLESICSIFDNIYLLKSLGIISKENFLYRKLNKGNVGSKVWFLTLI 61
           K  A +S +D+       + S+ D   +L++LG+++       KL    +  KVW     
Sbjct: 5   KNTAEISAKDIWENIWSGVSSLLDFFAVLENLGVVND------KLYVSGLLRKVWLCYSC 58

Query: 62  LSIRKNLKRLVRLVQTRFKLVFEIEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDT 121
           +S+ K + +L++L + +FK    I+Q L      D   N +V +KL    +K +  I   
Sbjct: 59  ISVIKCVWKLIKLCKVKFK----IDQRL------DGEGNGLVKDKLINFKKKYNEHIRHI 108

Query: 122 FLDLAQLLIYLFIVSGDCFNIPPRFKKFKKYLGPMSNVVTILRMLV 167
              L Q L YL ++      I P  + FK+    +SN++T+ R++V
Sbjct: 109 TAALLQDLSYLMVL------IYPGTRLFKR----LSNIITLCRIIV 144

>KAFR0K01860 Chr11 (383797..385743) [1947 bp, 648 aa] {ON} Anc_7.397
           YER103W
          Length = 648

 Score = 33.9 bits (76), Expect = 0.19,   Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 70  RLVRLVQTRFKLVFE-IEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTF 122
           R   L    F+   E +E++LR  KLD S +N +VL   ST + K   ++ D F
Sbjct: 299 RFEELCADLFRSTLEPVERVLRDSKLDKSQINEIVLVGGSTRIPKVQKLVTDFF 352

>NDAI0A01600 Chr1 complement(356196..358133) [1938 bp, 645 aa] {ON}
           Anc_7.397
          Length = 645

 Score = 33.9 bits (76), Expect = 0.20,   Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 70  RLVRLVQTRFKLVFE-IEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTF 122
           R   L    F+   E +E++LR  KLD S VN +VL   ST + K   ++ D F
Sbjct: 299 RFEELCADLFRSTLEPVEKVLRDSKLDKSQVNEIVLVGGSTRIPKVQKLVSDFF 352

>Kpol_1050.111 s1050 complement(248965..249435) [471 bp, 156 aa]
           {ON} complement(248965..249435) [471 nt, 157 aa]
          Length = 156

 Score = 32.7 bits (73), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 43/99 (43%), Gaps = 24/99 (24%)

Query: 30  LKSLGIISKENFLYRKLNKGNVGSKVWFLTLILSIRKNLKRLVRLVQTRFKLVFEIEQIL 89
            K+LG+   EN L   LN G VG +V F              +R++   F      EQ  
Sbjct: 44  FKTLGVTIGENELDGMLNSGGVGEEVSF-----------PEFLRVMSGSF------EQFS 86

Query: 90  RQKKLDDSLVN-------NVVLNKLSTNLRKCHFMIIDT 121
            +K+L+DS  N       NV   +L+ +L++  F   ++
Sbjct: 87  SKKELEDSFKNISSESDGNVSQQELTMHLKEAGFQDAES 125

>Smik_3.19 Chr3 complement(28371..28805) [435 bp, 144 aa] {ON}
           YCL056C (REAL)
          Length = 144

 Score = 31.6 bits (70), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 77/166 (46%), Gaps = 26/166 (15%)

Query: 2   KTAASLSWEDVLLGKLESICSIFDNIYLLKSLGIISKENFLYRKLNKGNVGSKVWFLTLI 61
           K +A +S +++ +     + S+ D   +L++LG++        KL    V  KVW     
Sbjct: 5   KKSAEVSGKNLWINVWNGVSSLLDFFAVLENLGVVDD------KLYVSGVLRKVWLCYSW 58

Query: 62  LSIRKNLKRLVRLVQTRFKLVFEIEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDT 121
           +S+ K + +L+ L + +FK    I+Q L      +   N +V  KL    ++    I   
Sbjct: 59  ISVIKCVWKLINLCKVKFK----IDQRL------NGPGNGLVKEKLMNFKKRYRDQIRQI 108

Query: 122 FLDLAQLLIYLFIVSGDCFNIPPRFKKFKKYLGPMSNVVTILRMLV 167
              L Q L YL ++      I P  + FK+    +SN++T+ R+++
Sbjct: 109 TATLLQDLSYLMVL------IYPGTRLFKR----LSNIITLCRIII 144

>Skud_3.8 Chr3 complement(14921..15355) [435 bp, 144 aa] {ON}
           YCL056C (REAL)
          Length = 144

 Score = 31.6 bits (70), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 80/167 (47%), Gaps = 28/167 (16%)

Query: 2   KTAASLSWEDVLLGKLESICSIFDNIYLLKSLGIISKENFLYRKLNKGNVGSKVWFLTLI 61
           K+ A +  +D+      S  S+ D   +L++LG++  + +L        +  KVW     
Sbjct: 5   KSTAEIGGKDIWTNIWNSASSLLDFFAVLENLGVVDDKLYL------SGILRKVWLCYSW 58

Query: 62  LSIRKNLKRLVRLVQTRFKLVFEIEQILRQKKLDDSLVNNVVLNKLSTNLRKCHF-MIID 120
           +S+ + + +L++L + +FK    I++ L  +       N ++  KL  N RK +   I  
Sbjct: 59  VSVVRCIWKLIKLCKVKFK----IDERLNGQG------NGLIKEKL-VNFRKMYNDQIRQ 107

Query: 121 TFLDLAQLLIYLFIVSGDCFNIPPRFKKFKKYLGPMSNVVTILRMLV 167
              +L Q L YL ++      I P  + F++    +SN++T+ R+++
Sbjct: 108 IIANLLQDLSYLMVL------IYPGTRLFRR----LSNIMTLCRIII 144

>KNAG0J02800 Chr10 (533392..535308) [1917 bp, 638 aa] {ON} Anc_4.35
           YLL024C
          Length = 638

 Score = 32.0 bits (71), Expect = 0.86,   Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 85  IEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTF 122
           +E++LR  KLD S V+ +VL   ST + K   ++ D F
Sbjct: 314 VEKVLRDSKLDKSQVDEIVLVGGSTRIPKVQKLVTDYF 351

>Kwal_27.10817 s27 complement(511677..513629) [1953 bp, 650 aa] {ON}
           YBL075C (SSA3) - heat-inducible cytosolic member of the
           70 kDa heat shock protein family [contig 33] FULL
          Length = 650

 Score = 31.6 bits (70), Expect = 0.97,   Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 70  RLVRLVQTRFKLVFE-IEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTF 122
           R   L    F+   E +E++LR  KLD S V+ +VL   ST + K   ++ D F
Sbjct: 300 RFEELCADLFRSTLEPVEKVLRDAKLDKSQVDEIVLVGGSTRIPKVQKLVSDFF 353

>CAGL0G03795g Chr7 (363008..364930) [1923 bp, 640 aa] {ON} highly
           similar to uniprot|P10592 Saccharomyces cerevisiae
           YLL024c SSA2 or uniprot|P10591 Saccharomyces cerevisiae
           YAL005c SSA1 or uniprot|P09435 Saccharomyces cerevisiae
           YBL075c SSA3 or uniprot|P22202 Saccharomyces cerevisiae
           YER103w SSA4
          Length = 640

 Score = 31.6 bits (70), Expect = 1.0,   Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 85  IEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTF 122
           +E++LR  KLD S V+ +VL   ST + K   ++ D F
Sbjct: 314 VEKVLRDSKLDKSAVHEIVLVGGSTRIPKVQKLVTDFF 351

>KAFR0I01380 Chr9 (285222..287138) [1917 bp, 638 aa] {ON} Anc_4.35
           YLL024C
          Length = 638

 Score = 31.6 bits (70), Expect = 1.0,   Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 85  IEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTF 122
           +E++LR  KLD S V+ +VL   ST + K   ++ D F
Sbjct: 314 VEKVLRDAKLDKSQVDEIVLVGGSTRIPKVQKLVTDYF 351

>Smik_12.40 Chr12 complement(81503..81815,81873..83479) [1920 bp,
           639 aa] {ON} YLL024C (REAL)
          Length = 639

 Score = 31.6 bits (70), Expect = 1.0,   Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 85  IEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTF 122
           +E++LR  KLD S V+ +VL   ST + K   ++ D F
Sbjct: 314 VEKVLRDAKLDKSQVDEIVLVGGSTRIPKVQKLVTDYF 351

>YLL024C Chr12 complement(95566..97485) [1920 bp, 639 aa] {ON}
           SSA2ATP binding protein involved in protein folding and
           vacuolar import of proteins; member of heat shock
           protein 70 (HSP70) family; associated with the
           chaperonin-containing T-complex; present in the
           cytoplasm, vacuolar membrane and cell wall; 98%
           identical with Ssa1p, but subtle differences between the
           two proteins provide functional specificity with respect
           to propagation of yeast [URE3] prions and
           vacuolar-mediated degradations of gluconeogenesis
           enzymes
          Length = 639

 Score = 31.6 bits (70), Expect = 1.0,   Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 85  IEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTF 122
           +E++LR  KLD S V+ +VL   ST + K   ++ D F
Sbjct: 314 VEKVLRDAKLDKSQVDEIVLVGGSTRIPKVQKLVTDYF 351

>NCAS0C05760 Chr3 (1183153..1185075) [1923 bp, 640 aa] {ON}
           Anc_2.618 YKL073W
          Length = 640

 Score = 31.6 bits (70), Expect = 1.0,   Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 85  IEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTF 122
           +E++LR  KLD S V+ +VL   ST + K   ++ D F
Sbjct: 314 VEKVLRDAKLDKSAVHEIVLVGGSTRIPKVQKLVTDYF 351

>Skud_1.58 Chr1 complement(114595..116523) [1929 bp, 642 aa] {ON}
           YAL005C (REAL)
          Length = 642

 Score = 31.6 bits (70), Expect = 1.0,   Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 85  IEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTF 122
           +E++LR  KLD S V+ +VL   ST + K   ++ D F
Sbjct: 314 VEKVLRDAKLDKSQVDEIVLVGGSTRIPKVQKLVTDYF 351

>YAL005C Chr1 complement(139503..141431) [1929 bp, 642 aa] {ON}
           SSA1ATPase involved in protein folding and nuclear
           localization signal (NLS)-directed nuclear transport;
           member of heat shock protein 70 (HSP70) family; forms a
           chaperone complex with Ydj1p; localized to the nucleus,
           cytoplasm, and cell wall; 98% identical with Ssa2p, but
           subtle differences between the two proteins provide
           functional specificity with respect to propagation of
           yeast [URE3] prions and vacuolar-mediated degradations
           of gluconeogenesis enzymes
          Length = 642

 Score = 31.6 bits (70), Expect = 1.0,   Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 85  IEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTF 122
           +E++LR  KLD S V+ +VL   ST + K   ++ D F
Sbjct: 314 VEKVLRDAKLDKSQVDEIVLVGGSTRIPKVQKLVTDYF 351

>Smik_1.63 Chr1 complement(122625..122997,123054..124621) [1941 bp,
           646 aa] {ON} YAL005C (REAL)
          Length = 646

 Score = 31.6 bits (70), Expect = 1.0,   Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 85  IEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTF 122
           +E++LR  KLD S V+ +VL   ST + K   ++ D F
Sbjct: 314 VEKVLRDAKLDKSQVDEIVLVGGSTRIPKVQKLVTDYF 351

>Smik_1.64 Chr1 complement(122927..124621) [1695 bp, 564 aa] {ON}
           YAL005C (REAL)
          Length = 564

 Score = 31.6 bits (70), Expect = 1.0,   Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 85  IEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTF 122
           +E++LR  KLD S V+ +VL   ST + K   ++ D F
Sbjct: 314 VEKVLRDAKLDKSQVDEIVLVGGSTRIPKVQKLVTDYF 351

>Suva_10.49 Chr10 complement(99921..101564) [1644 bp, 547 aa] {ON}
           YLL024C (REAL)
          Length = 547

 Score = 31.2 bits (69), Expect = 1.2,   Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 85  IEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTF 122
           +E++LR  KLD S V+ +VL   ST + K   ++ D F
Sbjct: 314 VEKVLRDAKLDKSQVDEIVLVGGSTRIPKVQKLVTDYF 351

>CAGL0G03289g Chr7 (312871..314814) [1944 bp, 647 aa] {ON} highly
           similar to uniprot|P09435 Saccharomyces cerevisiae
           YBL075c SSA3 or uniprot|P22202 Saccharomyces cerevisiae
           YER103w SSA4 or uniprot|P10591 Saccharomyces cerevisiae
           YAL005c SSA1 or uniprot|P10592 Saccharomyces cerevisiae
           YLL024c SSA2
          Length = 647

 Score = 31.2 bits (69), Expect = 1.2,   Method: Composition-based stats.
 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 70  RLVRLVQTRFKLVFE-IEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTF 122
           R   L    F+   E +E++LR  KLD S ++ +VL   ST + K   ++ D F
Sbjct: 299 RFEELCADLFRSTLEPVEKVLRDSKLDKSQIDEIVLVGGSTRIPKVQKLVSDFF 352

>TBLA0E01600 Chr5 complement(379910..381829) [1920 bp, 639 aa] {ON}
           Anc_4.35 YLL024C
          Length = 639

 Score = 31.2 bits (69), Expect = 1.2,   Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 85  IEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTF 122
           +E++LR  KLD S V+ +VL   ST + K   ++ D F
Sbjct: 314 VEKVLRDAKLDKSAVHEIVLVGGSTRIPKVQKLVADYF 351

>TDEL0F01620 Chr6 (296605..298563) [1959 bp, 652 aa] {ON} Anc_4.35
           YLL024C
          Length = 652

 Score = 31.2 bits (69), Expect = 1.3,   Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 85  IEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTF 122
           +E++LR  KLD S V+ +VL   ST + K   ++ D F
Sbjct: 314 VEKVLRDSKLDKSQVHEIVLVGGSTRIPKVQKLVTDFF 351

>NDAI0H00350 Chr8 complement(68865..70793) [1929 bp, 642 aa] {ON}
           Anc_4.35
          Length = 642

 Score = 31.2 bits (69), Expect = 1.3,   Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 85  IEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTF 122
           +E++LR  KLD S V+ +VL   ST + K   ++ D F
Sbjct: 314 VEKVLRDAKLDKSQVHEIVLVGGSTRIPKVQKLVTDYF 351

>KNAG0B05740 Chr2 complement(1128540..1129400) [861 bp, 286 aa] {ON}
           Anc_4.183 YLR351C
          Length = 286

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 5/54 (9%)

Query: 122 FLDLA--QLLIYLFIVSGDCFNIPPRFKKFKKY---LGPMSNVVTILRMLVSVY 170
           F+D A  Q      +V  +CFN P    KF++Y   +GP++  V+ L  L S Y
Sbjct: 33  FIDKAMTQQPDTKIVVLPECFNSPYAVTKFREYAEEIGPLATSVSFLSQLASKY 86

>TDEL0C01500 Chr3 complement(260222..262159) [1938 bp, 645 aa] {ON}
           Anc_7.397 YER103W
          Length = 645

 Score = 31.2 bits (69), Expect = 1.5,   Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 70  RLVRLVQTRFKLVFE-IEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTF 122
           R   L   +F+   + +E++LR  KLD S ++ +VL   ST + K   ++ D F
Sbjct: 299 RFEELCADQFRSTLDPVEKVLRDSKLDKSQIDEIVLVGGSTRIPKIQKLVSDFF 352

>TPHA0F02350 Chr6 (516707..520042) [3336 bp, 1111 aa] {ON} Anc_2.68
           YDL215C
          Length = 1111

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 23/43 (53%)

Query: 9   WEDVLLGKLESICSIFDNIYLLKSLGIISKENFLYRKLNKGNV 51
           W+  L GK  S+  I  + Y + SLG+ +  N LYR LN  N 
Sbjct: 722 WKSFLTGKSASLGGIPHDEYGMTSLGVRAYVNALYRTLNLENT 764

>SAKL0H20020g Chr8 complement(1752241..1754166) [1926 bp, 641 aa]
           {ON} highly similar to uniprot|P10592 Saccharomyces
           cerevisiae YLL024C SSA2 member of 70 kDa heat shock
           protein family
          Length = 641

 Score = 30.8 bits (68), Expect = 1.8,   Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 85  IEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTF 122
           +E++LR  KLD S V+ +VL   ST + K   ++ D F
Sbjct: 315 VEKVLRDSKLDKSQVHEIVLVGGSTRIPKVQKLVSDYF 352

>Ecym_6208 Chr6 (389653..391593) [1941 bp, 646 aa] {ON} similar to
           Ashbya gossypii AFR114W
          Length = 646

 Score = 30.8 bits (68), Expect = 1.8,   Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 85  IEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTF 122
           +E++LR  KLD S V+ +VL   ST + K   ++ D F
Sbjct: 315 VEKVLRDSKLDKSQVHEIVLVGGSTRIPKVQKLVSDYF 352

>Skud_12.44 Chr12 complement(86737..88656) [1920 bp, 639 aa] {ON}
           YLL024C (REAL)
          Length = 639

 Score = 30.8 bits (68), Expect = 1.8,   Method: Composition-based stats.
 Identities = 14/38 (36%), Positives = 23/38 (60%)

Query: 85  IEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTF 122
           +E++LR  K+D S V+ +VL   ST + K   ++ D F
Sbjct: 314 VEKVLRDAKMDKSQVDEIVLVGGSTRIPKVQKLVTDYF 351

>Kwal_14.2130 s14 complement(627452..629374) [1923 bp, 640 aa] {ON}
           YLL024C (SSA2) - member of 70 kDa heat shock protein
           family [contig 228] FULL
          Length = 640

 Score = 30.4 bits (67), Expect = 2.2,   Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 85  IEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTF 122
           +E++LR  KLD S V+ +VL   ST + K   ++ D F
Sbjct: 315 VEKVLRDAKLDKSQVHEIVLVGGSTRIPKVQKLVSDYF 352

>KLLA0D04224g Chr4 (363732..365654) [1923 bp, 640 aa] {ON} highly
           similar to uniprot|P10592 Saccharomyces cerevisiae
           YLL024C SSA2 member of 70 kDa heat shock protein family
          Length = 640

 Score = 30.4 bits (67), Expect = 2.2,   Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 85  IEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTF 122
           +E++LR  KLD S V+ +VL   ST + K   ++ D F
Sbjct: 315 VEKVLRDAKLDKSQVHEIVLVGGSTRIPKVQKLVSDYF 352

>KLTH0H08448g Chr8 complement(736894..738819) [1926 bp, 641 aa] {ON}
           highly similar to uniprot|P10592 Saccharomyces
           cerevisiae YLL024C SSA2 member of 70 kDa heat shock
           protein family
          Length = 641

 Score = 30.4 bits (67), Expect = 2.2,   Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 85  IEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTF 122
           +E++LR  KLD S V+ +VL   ST + K   ++ D F
Sbjct: 315 VEKVLRDAKLDKSQVHEIVLVGGSTRIPKVQKLVSDYF 352

>AFR114W Chr6 (641037..642962) [1926 bp, 641 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLL024C (SSA2)
          Length = 641

 Score = 30.4 bits (67), Expect = 2.2,   Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 85  IEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTF 122
           +E++LR  KLD S V+ +VL   ST + K   ++ D F
Sbjct: 315 VEKVLRDAKLDKSQVHEIVLVGGSTRIPKVQKLVSDYF 352

>ZYRO0B00836g Chr2 (65436..67361) [1926 bp, 641 aa] {ON} highly
           similar to uniprot|P10592 Saccharomyces cerevisiae
           YLL024C SSA2 member of 70 kDa heat shock protein family
          Length = 641

 Score = 30.4 bits (67), Expect = 2.3,   Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 85  IEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTF 122
           +E++LR  KLD S V+ +VL   ST + K   ++ D F
Sbjct: 314 VEKVLRDAKLDKSAVHEIVLVGGSTRIPKIQKLVSDFF 351

>TPHA0K02090 Chr11 (445610..447535) [1926 bp, 641 aa] {ON} Anc_4.35
           YLL024C
          Length = 641

 Score = 30.4 bits (67), Expect = 2.4,   Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 85  IEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTF 122
           +E++L   KLD SLV+ +VL   ST + K   ++ D F
Sbjct: 314 VEKVLIDSKLDKSLVHEIVLVGGSTRIPKVQKLVTDYF 351

>NCAS0A05220 Chr1 (1032827..1033996) [1170 bp, 389 aa] {ON}
           Anc_4.148
          Length = 389

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 41/89 (46%), Gaps = 12/89 (13%)

Query: 84  EIEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTF-------LDLAQLLI---YLF 133
           E E   R+ ++D +++  + LN+++ N RK    I  +        LD+A+ L     LF
Sbjct: 273 EKEGTRRRHQVD-TIIEGIGLNRITKNFRKGETFIDSSIRVSDQQALDMAKYLSVNDGLF 331

Query: 134 IVSGDCFNIPPRFKKFKKYLGPMSNVVTI 162
           + S    N      K  K LGP S +V I
Sbjct: 332 VGSSTAINAVAAV-KLAKELGPGSRIVII 359

>SAKL0F12606g Chr6 (981486..983453) [1968 bp, 655 aa] {ON} highly
           similar to uniprot|P09435 Saccharomyces cerevisiae
           YBL075C SSA3 heat-inducible cytosolic member of the 70
           kDa heat shock protein family
          Length = 655

 Score = 30.4 bits (67), Expect = 2.5,   Method: Composition-based stats.
 Identities = 14/38 (36%), Positives = 23/38 (60%)

Query: 85  IEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTF 122
           +E++LR  KLD S ++ +VL   ST + K   ++ D F
Sbjct: 315 VEKVLRDSKLDKSQIDEIVLVGGSTRIPKVQKLVSDFF 352

>Ecym_4678 Chr4 complement(1322349..1324295) [1947 bp, 648 aa] {ON}
           similar to Ashbya gossypii AER187W - AFR114W
          Length = 648

 Score = 30.0 bits (66), Expect = 2.9,   Method: Composition-based stats.
 Identities = 14/38 (36%), Positives = 23/38 (60%)

Query: 85  IEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTF 122
           +E++LR  KLD S ++ +VL   ST + K   ++ D F
Sbjct: 315 VEKVLRDSKLDKSQIDEIVLVGGSTRIPKIQKLVSDFF 352

>AER187W Chr5 (983874..985823) [1950 bp, 649 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YBL075C (SSA3) and
           YER103W (SSA4)
          Length = 649

 Score = 30.0 bits (66), Expect = 2.9,   Method: Composition-based stats.
 Identities = 14/38 (36%), Positives = 23/38 (60%)

Query: 85  IEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTF 122
           +E++LR  KLD S ++ +VL   ST + K   ++ D F
Sbjct: 315 VEKVLRDSKLDKSQIDEIVLVGGSTRIPKIQKLVSDFF 352

>KNAG0C03530 Chr3 complement(690575..692527) [1953 bp, 650 aa] {ON}
           Anc_7.397 YER103W
          Length = 650

 Score = 30.0 bits (66), Expect = 3.0,   Method: Composition-based stats.
 Identities = 14/38 (36%), Positives = 23/38 (60%)

Query: 85  IEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTF 122
           +E++LR  KLD S ++ +VL   ST + K   ++ D F
Sbjct: 315 VEKVLRDAKLDKSQIDEIVLVGGSTRIPKVQKLVSDFF 352

>KLTH0C06556g Chr3 complement(573847..575820) [1974 bp, 657 aa] {ON}
           highly similar to uniprot|P09435 Saccharomyces
           cerevisiae YBL075C SSA3 heat-inducible cytosolic member
           of the 70 kDa heat shock protein family
          Length = 657

 Score = 30.0 bits (66), Expect = 3.0,   Method: Composition-based stats.
 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 70  RLVRLVQTRFKLVFE-IEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTF 122
           R   L    F+   E +E++LR  K+D S V+ +VL   ST + K   ++ D F
Sbjct: 300 RFEELCADLFRSTLEPVEKVLRDAKIDKSNVDEIVLVGGSTRIPKVQKLVSDFF 353

>NDAI0B04780 Chr2 complement(1176912..1178234) [1323 bp, 440 aa]
           {ON} Anc_1.316
          Length = 440

 Score = 30.0 bits (66), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 36/78 (46%), Gaps = 7/78 (8%)

Query: 86  EQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTFLDLAQLLIYLFIVSGDCFNIPPR 145
           E+ L +++L + L+N  + NK+   L +C F     F D    L ++F   G  F IP  
Sbjct: 156 EEDLTEEQLAERLMNQKLANKVDIPLEQCLFCTKRIFTDFETNLDHMFKSHG--FYIPE- 212

Query: 146 FKKFKKYLGPMSNVVTIL 163
               +KYL     +V  L
Sbjct: 213 ----QKYLEDKEGLVKYL 226

>NCAS0E02580 Chr5 complement(515573..517513) [1941 bp, 646 aa] {ON}
           Anc_7.397
          Length = 646

 Score = 30.0 bits (66), Expect = 3.6,   Method: Composition-based stats.
 Identities = 14/38 (36%), Positives = 23/38 (60%)

Query: 85  IEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTF 122
           +E++LR  KLD S ++ +VL   ST + K   ++ D F
Sbjct: 315 VEKVLRDAKLDKSQIDELVLVGGSTRIPKIQKLVTDFF 352

>KLLA0B09196g Chr2 complement(803259..805031) [1773 bp, 590 aa] {ON}
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 590

 Score = 30.0 bits (66), Expect = 3.7,   Method: Composition-based stats.
 Identities = 26/99 (26%), Positives = 47/99 (47%), Gaps = 11/99 (11%)

Query: 69  KRLVRLVQTRFKLVFEIEQILRQKKLDDSLVNNVVLNKLSTNLRKC-HFMIIDTFLDLAQ 127
           +RL+     RFK    IE+I++ KK     + N  L K    L+K   F+ ++  L+  Q
Sbjct: 83  RRLIESGMERFK---SIEKIMKTKKFSTEALTNPDLIKDPRELKKRDQFLFVEECLEELQ 139

Query: 128 LLIYLFIVSGDCFNIPPRFKKFKKYLGPMSNVVTILRML 166
             +       D F +    ++ +K+   +SN+  IL++L
Sbjct: 140 KQL-------DTFEVENNEEQIEKHTFHISNLENILKLL 171

>YBL075C Chr2 complement(84499..86448) [1950 bp, 649 aa] {ON}
           SSA3ATPase involved in protein folding and the response
           to stress; plays a role in SRP-dependent cotranslational
           protein-membrane targeting and translocation; member of
           the heat shock protein 70 (HSP70) family; localized to
           the cytoplasm
          Length = 649

 Score = 29.6 bits (65), Expect = 4.0,   Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 70  RLVRLVQTRFKLVFE-IEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTF 122
           R   L    F+   E +E++L+  KLD S ++ +VL   ST + K   ++ D F
Sbjct: 299 RFEELCADLFRSTLEPVEKVLKDSKLDKSQIDEIVLVGGSTRIPKIQKLVSDFF 352

>Suva_3.157 Chr3 complement(236677..237111) [435 bp, 144 aa] {ON}
           YCL056C (REAL)
          Length = 144

 Score = 28.9 bits (63), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 33/170 (19%), Positives = 79/170 (46%), Gaps = 34/170 (20%)

Query: 2   KTAASLSWEDVLLGKLESICSIFDNIYLLKSLGIISKENFLYRKLNKGNVGSKVWFLTLI 61
           + A  +   D        + S+ D   +L++LG++  + +L   L       KVW     
Sbjct: 5   ENAGEIGGRDPWTKVWNGVSSLLDFFAVLENLGVVDDKLYLSGIL------RKVWLCYSW 58

Query: 62  LSIRKNLKRLVRLVQTRFK----LVFEIEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFM 117
           +S+ + + +L++L + +FK    L  +   ++++K ++   + N  + +++ NL +    
Sbjct: 59  ISVVRCVWKLIKLCRVKFKINERLNGQGNGLIKEKLINFGKMYNDQIKQITANLLQ---- 114

Query: 118 IIDTFLDLAQLLIYLFIVSGDCFNIPPRFKKFKKYLGPMSNVVTILRMLV 167
                 DL+ L++ ++          P  + FK+    +SNV+T+ R+++
Sbjct: 115 ------DLSYLMVLIY----------PGTRLFKR----LSNVITLCRIII 144

>KLLA0E20527g Chr5 (1822412..1824364) [1953 bp, 650 aa] {ON} highly
           similar to uniprot|P09435 Saccharomyces cerevisiae
           YBL075C SSA3 heat-inducible cytosolic member of the 70
           kDa heat shock protein family
          Length = 650

 Score = 28.9 bits (63), Expect = 7.4,   Method: Composition-based stats.
 Identities = 13/38 (34%), Positives = 23/38 (60%)

Query: 85  IEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTF 122
           +E++L+  KLD S ++ +VL   ST + K   ++ D F
Sbjct: 315 VEKVLKDSKLDKSQIDEIVLVGGSTRIPKVQKLVSDFF 352

>TBLA0D00580 Chr4 complement(152874..154790) [1917 bp, 638 aa] {ON}
           Anc_7.397 YER103W
          Length = 638

 Score = 28.9 bits (63), Expect = 7.5,   Method: Composition-based stats.
 Identities = 14/38 (36%), Positives = 22/38 (57%)

Query: 85  IEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTF 122
           +E++LR  KL  S +N +VL   ST + K   ++ D F
Sbjct: 315 VEKVLRDSKLGKSEINEIVLVGGSTRIPKVQKLVSDFF 352

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.328    0.143    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 17,277,121
Number of extensions: 693467
Number of successful extensions: 3096
Number of sequences better than 10.0: 75
Number of HSP's gapped: 3158
Number of HSP's successfully gapped: 75
Length of query: 174
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 72
Effective length of database: 41,785,467
Effective search space: 3008553624
Effective search space used: 3008553624
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 62 (28.5 bits)