Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0C002601.9ON74474437680.0
ZYRO0F18392g1.9ON72568426080.0
SAKL0C00550g1.9ON73268225790.0
NCAS0B090701.9ON73068325510.0
Kpol_2002.121.9ON73968425470.0
KAFR0D001801.9ON72368525370.0
TBLA0A075601.9ON74167825320.0
TPHA0E039701.9ON74768224660.0
NDAI0A001801.9ON74068324650.0
KLLA0C00572g1.9ON71268224090.0
YCL057W (PRD1)1.9ON71267823350.0
CAGL0B00418g1.9ON74368823330.0
Suva_3.1561.9ON71267623200.0
Skud_3.71.9ON71267922990.0
Smik_3.181.9ON71267822780.0
Ecym_1011na 1ON71668221180.0
AGR406C1.9ON68368417500.0
AGR405Cna 1ON71768516770.0
ABR185WsingletonON4574169851e-125
NDAI0E020102.432ON7785644718e-49
KNAG0A062002.432ON7895554719e-49
KAFR0D029502.432ON7776304585e-47
Kpol_297.82.432ON7876734489e-46
SAKL0E03938g2.432ON7676704311e-43
ZYRO0G20130g2.432ON7865604195e-42
CAGL0D02112g2.432ON7616414177e-42
Kwal_26.76162.432ON7705524151e-41
TPHA0G023902.432ON7956364142e-41
Skud_11.932.432ON7724814133e-41
NCAS0A042802.432ON7734354097e-41
TBLA0I007102.432ON7735514081e-40
KLTH0D04730g2.432ON7725734053e-40
Suva_11.912.432ON7756334001e-39
YKL134C (OCT1)2.432ON7724813991e-39
Smik_11.1022.432ON7724813946e-39
TDEL0A020802.432ON7875613921e-38
AFR198W2.432ON7766403875e-38
Ecym_60992.432ON7735503866e-38
KLLA0B12397g2.432ON7796313644e-35
ZYRO0F13002g7.429ON464112880.054
TDEL0C010608.77ON35550771.0
KNAG0F035007.463ON70746734.3
KNAG0B067304.355ON59660708.2
TDEL0G043706.32ON760149708.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0C00260
         (744 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0C00260 Chr3 (39428..41662) [2235 bp, 744 aa] {ON} Anc_1.9 Y...  1456   0.0  
ZYRO0F18392g Chr6 complement(1518902..1521079) [2178 bp, 725 aa]...  1009   0.0  
SAKL0C00550g Chr3 (48410..50608) [2199 bp, 732 aa] {ON} highly s...   998   0.0  
NCAS0B09070 Chr2 complement(1741718..1743910) [2193 bp, 730 aa] ...   987   0.0  
Kpol_2002.12 s2002 (21544..23763) [2220 bp, 739 aa] {ON} (21544....   985   0.0  
KAFR0D00180 Chr4 (18900..21071) [2172 bp, 723 aa] {ON} Anc_1.9 Y...   981   0.0  
TBLA0A07560 Chr1 complement(1871629..1873854) [2226 bp, 741 aa] ...   979   0.0  
TPHA0E03970 Chr5 complement(834023..836266) [2244 bp, 747 aa] {O...   954   0.0  
NDAI0A00180 Chr1 (14692..16914) [2223 bp, 740 aa] {ON} Anc_1.9        954   0.0  
KLLA0C00572g Chr3 (42069..44207) [2139 bp, 712 aa] {ON} similar ...   932   0.0  
YCL057W Chr3 (24768..26906) [2139 bp, 712 aa] {ON}  PRD1Zinc met...   904   0.0  
CAGL0B00418g Chr2 (26584..28815) [2232 bp, 743 aa] {ON} similar ...   903   0.0  
Suva_3.156 Chr3 (234520..236658) [2139 bp, 712 aa] {ON} YCL057W ...   898   0.0  
Skud_3.7 Chr3 (12763..14901) [2139 bp, 712 aa] {ON} YCL057W (REAL)    890   0.0  
Smik_3.18 Chr3 (26213..28351) [2139 bp, 712 aa] {ON} YCL057W (REAL)   882   0.0  
Ecym_1011 Chr1 (19924..22074) [2151 bp, 716 aa] {ON} similar to ...   820   0.0  
AGR406C Chr7 complement(1472496..1474547) [2052 bp, 683 aa] {ON}...   678   0.0  
AGR405C Chr7 complement(1469769..1471922) [2154 bp, 717 aa] {ON}...   650   0.0  
ABR185W Chr2 (758126..758380,758380..758709,758709..759029,75903...   384   e-125
NDAI0E02010 Chr5 complement(404579..406915) [2337 bp, 778 aa] {O...   186   8e-49
KNAG0A06200 Chr1 complement(937577..939946) [2370 bp, 789 aa] {O...   186   9e-49
KAFR0D02950 Chr4 complement(581305..583638) [2334 bp, 777 aa] {O...   181   5e-47
Kpol_297.8 s297 complement(11648..14011) [2364 bp, 787 aa] {ON} ...   177   9e-46
SAKL0E03938g Chr5 (317017..319320) [2304 bp, 767 aa] {ON} simila...   170   1e-43
ZYRO0G20130g Chr7 (1666665..1669025) [2361 bp, 786 aa] {ON} simi...   166   5e-42
CAGL0D02112g Chr4 complement(216204..218489) [2286 bp, 761 aa] {...   165   7e-42
Kwal_26.7616 s26 (444266..446578) [2313 bp, 770 aa] {ON} YKL134C...   164   1e-41
TPHA0G02390 Chr7 complement(486025..488412) [2388 bp, 795 aa] {O...   164   2e-41
Skud_11.93 Chr11 complement(175243..177561) [2319 bp, 772 aa] {O...   163   3e-41
NCAS0A04280 Chr1 complement(864327..866648) [2322 bp, 773 aa] {O...   162   7e-41
TBLA0I00710 Chr9 (128272..130593) [2322 bp, 773 aa] {ON} Anc_2.4...   161   1e-40
KLTH0D04730g Chr4 (432572..434890) [2319 bp, 772 aa] {ON} simila...   160   3e-40
Suva_11.91 Chr11 complement(175327..177654) [2328 bp, 775 aa] {O...   158   1e-39
YKL134C Chr11 complement(189124..191442) [2319 bp, 772 aa] {ON} ...   158   1e-39
Smik_11.102 Chr11 complement(175013..177331) [2319 bp, 772 aa] {...   156   6e-39
TDEL0A02080 Chr1 complement(373425..375788) [2364 bp, 787 aa] {O...   155   1e-38
AFR198W Chr6 (797448..799778) [2331 bp, 776 aa] {ON} Syntenic ho...   153   5e-38
Ecym_6099 Chr6 complement(186647..188968) [2322 bp, 773 aa] {ON}...   153   6e-38
KLLA0B12397g Chr2 complement(1084129..1086468) [2340 bp, 779 aa]...   144   4e-35
ZYRO0F13002g Chr6 complement(1061279..1062673) [1395 bp, 464 aa]...    39   0.054
TDEL0C01060 Chr3 (179005..180072) [1068 bp, 355 aa] {ON} Anc_8.7...    34   1.0  
KNAG0F03500 Chr6 (661869..663992) [2124 bp, 707 aa] {ON} Anc_7.4...    33   4.3  
KNAG0B06730 Chr2 (1330382..1332172) [1791 bp, 596 aa] {ON} Anc_4...    32   8.2  
TDEL0G04370 Chr7 complement(789063..791345) [2283 bp, 760 aa] {O...    32   8.7  

>KNAG0C00260 Chr3 (39428..41662) [2235 bp, 744 aa] {ON} Anc_1.9
           YCL057W
          Length = 744

 Score = 1456 bits (3768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 709/744 (95%), Positives = 709/744 (95%)

Query: 1   MVNSGSLCKVTRFLVKVSRSKLTLLPFVVLPTALFATXXXXXXXXXXXXXXXXXXXXXPQ 60
           MVNSGSLCKVTRFLVKVSRSKLTLLPFVVLPTALFAT                     PQ
Sbjct: 1   MVNSGSLCKVTRFLVKVSRSKLTLLPFVVLPTALFATSHFYQSSRSYSSTSSGLSRMSPQ 60

Query: 61  LVPPAGALPRWEFPSAKIGEEATRIIESTNKFYDELVEISNPSIDNLVKPYMNHENSIGL 120
           LVPPAGALPRWEFPSAKIGEEATRIIESTNKFYDELVEISNPSIDNLVKPYMNHENSIGL
Sbjct: 61  LVPPAGALPRWEFPSAKIGEEATRIIESTNKFYDELVEISNPSIDNLVKPYMNHENSIGL 120

Query: 121 MVNQLCFLQHVSSDKEIREASNKATELLQNFEIETSLRHDLFLQFDKIWKELKPRKEEFS 180
           MVNQLCFLQHVSSDKEIREASNKATELLQNFEIETSLRHDLFLQFDKIWKELKPRKEEFS
Sbjct: 121 MVNQLCFLQHVSSDKEIREASNKATELLQNFEIETSLRHDLFLQFDKIWKELKPRKEEFS 180

Query: 181 HDEEQFEIYKFVEKCHKDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLGEQKEFLL 240
           HDEEQFEIYKFVEKCHKDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLGEQKEFLL
Sbjct: 181 HDEEQFEIYKFVEKCHKDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLGEQKEFLL 240

Query: 241 FSKEQLDGVSDTVMEQFEQVKDETTNETNYKVTFKYPDIFPVLKMAKNAETRKTAFCGDQ 300
           FSKEQLDGVSDTVMEQFEQVKDETTNETNYKVTFKYPDIFPVLKMAKNAETRKTAFCGDQ
Sbjct: 241 FSKEQLDGVSDTVMEQFEQVKDETTNETNYKVTFKYPDIFPVLKMAKNAETRKTAFCGDQ 300

Query: 301 NKVPQNEELFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTVXXXXXXXXXXXXXXG 360
           NKVPQNEELFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTV              G
Sbjct: 301 NKVPQNEELFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTVFKFLNDLKDKLKPLG 360

Query: 361 EKEIGILKSIKEAECKELGVPFDGRYYIWDHRYYDTKYLKDNFNVDHEAIAEYYPIDSTI 420
           EKEIGILKSIKEAECKELGVPFDGRYYIWDHRYYDTKYLKDNFNVDHEAIAEYYPIDSTI
Sbjct: 361 EKEIGILKSIKEAECKELGVPFDGRYYIWDHRYYDTKYLKDNFNVDHEAIAEYYPIDSTI 420

Query: 421 EGMLKIYETVFKLKFVEEKDTAKKNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLHPRDG 480
           EGMLKIYETVFKLKFVEEKDTAKKNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLHPRDG
Sbjct: 421 EGMLKIYETVFKLKFVEEKDTAKKNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLHPRDG 480

Query: 481 KYGHAANFGIASSYIREDGSRSYPVTALVCNFSKSSATKPSLLKHNEITTFFHELGHGIH 540
           KYGHAANFGIASSYIREDGSRSYPVTALVCNFSKSSATKPSLLKHNEITTFFHELGHGIH
Sbjct: 481 KYGHAANFGIASSYIREDGSRSYPVTALVCNFSKSSATKPSLLKHNEITTFFHELGHGIH 540

Query: 541 DLVGKNRAARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKHYKTGEQIPEKLLDSL 600
           DLVGKNRAARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKHYKTGEQIPEKLLDSL
Sbjct: 541 DLVGKNRAARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKHYKTGEQIPEKLLDSL 600

Query: 601 IATKHVNGALFALRQLHFGLFDMTVHTSKDVASLDLLKLWGDLRQEISLVENGGQYTKGY 660
           IATKHVNGALFALRQLHFGLFDMTVHTSKDVASLDLLKLWGDLRQEISLVENGGQYTKGY
Sbjct: 601 IATKHVNGALFALRQLHFGLFDMTVHTSKDVASLDLLKLWGDLRQEISLVENGGQYTKGY 660

Query: 661 DSFGHIMSDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSSVGMKYRDIVLANGGLYEID 720
           DSFGHIMSDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSSVGMKYRDIVLANGGLYEID
Sbjct: 661 DSFGHIMSDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSSVGMKYRDIVLANGGLYEID 720

Query: 721 DNLKEFLGREPSKDAFLKELGLQA 744
           DNLKEFLGREPSKDAFLKELGLQA
Sbjct: 721 DNLKEFLGREPSKDAFLKELGLQA 744

>ZYRO0F18392g Chr6 complement(1518902..1521079) [2178 bp, 725 aa]
           {ON} similar to uniprot|P25375 Saccharomyces cerevisiae
           YCL057W PRD1 Zinc metalloendopeptidase found in the
           cytoplasm and intermembrane space of mitochondria
          Length = 725

 Score = 1009 bits (2608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/684 (69%), Positives = 561/684 (82%), Gaps = 3/684 (0%)

Query: 59  PQLVPPAGALPRWEFPSAKIGEEATRIIESTNKFYDELVEISNPSIDNLVKPYMNHENSI 118
           P L     + P W F    + +E  R+IES+ +FYD L ++SNP+++NLVKPYM+HEN +
Sbjct: 44  PNLFIAPQSAPSWAFTPQSLLDETHRLIESSKQFYDSLAQLSNPTVENLVKPYMHHENGV 103

Query: 119 GLMVNQLCFLQHVSSDKEIREASNKATELLQNFEIETSLRHDLFLQFDKIWKELKPRKEE 178
           GL+ +QL F Q VS+DKEIR+AS +ATE LQNF IE SLRHDLFLQFDKIW ELK +   
Sbjct: 104 GLIESQLTFPQQVSADKEIRDASVQATEFLQNFGIEQSLRHDLFLQFDKIWNELKDKS-- 161

Query: 179 FSHDEEQFEIYKFVEKCHKDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLGEQKEF 238
           F    +++EIYK+VEK H+D+ R GL L E+ R+KVK +KIKIA+NSLEFSKNLGEQKEF
Sbjct: 162 FEQGSQEYEIYKYVEKIHRDYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLGEQKEF 221

Query: 239 LLFSKEQLDGVSDTVMEQFEQVKDETTNETNYKVTFKYPDIFPVLKMAKNAETRKTAFCG 298
           + F+KE+LDGVS++VM+QFEQ KDE    T YKVTFKYPDIFPVLK AKN +TRK AF  
Sbjct: 222 VAFTKEELDGVSESVMDQFEQFKDENGT-TKYKVTFKYPDIFPVLKTAKNPKTRKLAFAR 280

Query: 299 DQNKVPQNEELFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTVXXXXXXXXXXXXX 358
           DQ+KVPQNE+LFV TL+LR+ELA +LGY TYANYNLE+KMAK Q  V             
Sbjct: 281 DQDKVPQNEKLFVETLQLRNELADILGYSTYANYNLELKMAKNQDNVWKFLNELKDKLKP 340

Query: 359 XGEKEIGILKSIKEAECKELGVPFDGRYYIWDHRYYDTKYLKDNFNVDHEAIAEYYPIDS 418
            G KE   LK IK+ EC+ LG+P+DG YY+WDHRYYD KYLKDN+NVD E I+EYYPI+S
Sbjct: 341 LGLKEAENLKQIKQKECESLGLPYDGHYYVWDHRYYDNKYLKDNYNVDLEKISEYYPIES 400

Query: 419 TIEGMLKIYETVFKLKFVEEKDTAKKNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLHPR 478
           TI GML IYET+ KLKFVEE D  K++VW+EDVKQ+AVWKMDN   P FVGWIYFDLHPR
Sbjct: 401 TISGMLSIYETLLKLKFVEETDPEKRSVWHEDVKQLAVWKMDNPSKPEFVGWIYFDLHPR 460

Query: 479 DGKYGHAANFGIASSYIREDGSRSYPVTALVCNFSKSSATKPSLLKHNEITTFFHELGHG 538
           DGKYGHAANFGI++SY++EDG+RSYPVTALVCNFSK SA KPSLLKHNEI+TFFHELGHG
Sbjct: 461 DGKYGHAANFGISASYVKEDGTRSYPVTALVCNFSKPSAKKPSLLKHNEISTFFHELGHG 520

Query: 539 IHDLVGKNRAARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKHYKTGEQIPEKLLD 598
           IHDLVG+NR   FNGPGA PWDFVEAPSQMLEF+TW++  L  LS HY++GE+IP+ LL 
Sbjct: 521 IHDLVGENRLTTFNGPGAVPWDFVEAPSQMLEFWTWNERELHELSSHYESGEKIPKDLLQ 580

Query: 599 SLIATKHVNGALFALRQLHFGLFDMTVHTSKDVASLDLLKLWGDLRQEISLVENGGQYTK 658
           SLI+TKHV+GALFALRQLHFGLFDM VHTSK+VA LDLLKLW +LR+E+SLVENG  +TK
Sbjct: 581 SLISTKHVDGALFALRQLHFGLFDMYVHTSKNVAKLDLLKLWNELREEVSLVENGDTFTK 640

Query: 659 GYDSFGHIMSDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSSVGMKYRDIVLANGGLYE 718
           GYDSFGHIMSDSYSAGYYGYMWAEVFA DMY T+FA +PLDS  G++YRDIVL  GGLYE
Sbjct: 641 GYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTRFAADPLDSKAGVQYRDIVLGRGGLYE 700

Query: 719 IDDNLKEFLGREPSKDAFLKELGL 742
            +DNL+EFLGREPS++AFLKELGL
Sbjct: 701 TNDNLREFLGREPSEEAFLKELGL 724

>SAKL0C00550g Chr3 (48410..50608) [2199 bp, 732 aa] {ON} highly
           similar to gnl|GLV|KLLA0C00572g Kluyveromyces lactis
           KLLA0C00572g and similar to YCL057W uniprot|P25375
           Saccharomyces cerevisiae YCL057W PRD1 Zinc
           metalloendopeptidase found in the cytoplasm and
           intermembrane space of mitochondria
          Length = 732

 Score =  998 bits (2579), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/682 (69%), Positives = 561/682 (82%), Gaps = 6/682 (0%)

Query: 61  LVPPAGALPRWEFPSAKIGEEATRIIESTNKFYDELVEISNPSIDNLVKPYMNHENSIGL 120
           LVPP  A P W++    I +     I ST+  +D L  + NP++++LVKP++ HEN+   
Sbjct: 56  LVPPQAA-PSWKYSPEDILQLTNETIASTSALHDALAGVENPTVESLVKPFLEHENTTQP 114

Query: 121 MVNQLCFLQHVSSDKEIREASNKATELLQNFEIETSLRHDLFLQFDKIWKELKPRKEEFS 180
           ++NQL FLQHVS+DKE+R+AS KATELLQ+FEIE SLRHDLF+QFDK+W+  K   ++  
Sbjct: 115 LINQLTFLQHVSADKEVRDASTKATELLQDFEIEASLRHDLFVQFDKVWQACK---DDAK 171

Query: 181 HDEEQFEIYKFVEKCHKDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLGEQKEFLL 240
             +E FE+YKFVEKCHKD+VRAGLNL EE RN+VK+++ KI++NSL+FSKNLGEQKEF+ 
Sbjct: 172 FKKEHFELYKFVEKCHKDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLGEQKEFVA 231

Query: 241 FSKEQLDGVSDTVMEQFEQVKDETTNETNYKVTFKYPDIFPVLKMAKNAETRKTAFCGDQ 300
           F+ E+LDGVS +VM+QFE+  D T     +KV+FKYPDI PVLK AKN ETRK AF GDQ
Sbjct: 232 FTTEELDGVSASVMDQFEKFTD-TDGVEKHKVSFKYPDILPVLKTAKNPETRKRAFGGDQ 290

Query: 301 NKVPQNEELFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTVXXXXXXXXXXXXXXG 360
           NKVPQNE LF+ TL+LRDELA LLGY TYANYNL+IKMAKKQ TV              G
Sbjct: 291 NKVPQNEVLFLETLRLRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLG 350

Query: 361 EKEIGILKSIKEAECKELGVPFDGRYYIWDHRYYDTKYLKDNFNVDHEAIAEYYPIDSTI 420
            KEI  LKS+KE +CKEL +PFD  YYIWD+RYYD KYLK+N+NVD E I+EY+P++ TI
Sbjct: 351 VKEIEALKSLKEKDCKELAIPFDNHYYIWDNRYYDNKYLKENYNVDEEKISEYFPLEPTI 410

Query: 421 EGMLKIYETVFKLKFVEEKDTAKKNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLHPRDG 480
            GMLKIYETV KLKFVEE D  KK VW+EDVKQ+AVWK+D  ++P FVGWIYFDLHPRDG
Sbjct: 411 GGMLKIYETVLKLKFVEETDAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHPRDG 470

Query: 481 KYGHAANFGIASSYIREDGSRSYPVTALVCNFSKSSATKPSLLKHNEITTFFHELGHGIH 540
           KYGHAANFGIASSY+R DG+RS+PVTALVCNFSK SA KP+LLKH+EITTFFHELGHGIH
Sbjct: 471 KYGHAANFGIASSYVR-DGARSHPVTALVCNFSKPSAKKPALLKHSEITTFFHELGHGIH 529

Query: 541 DLVGKNRAARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKHYKTGEQIPEKLLDSL 600
           DLVG N   RFNGPGATPWDFVEAPSQMLEF+TW+KN L +LS+HY+TGE+IPE+LLDSL
Sbjct: 530 DLVGGNHIGRFNGPGATPWDFVEAPSQMLEFWTWNKNELSTLSQHYETGEKIPEQLLDSL 589

Query: 601 IATKHVNGALFALRQLHFGLFDMTVHTSKDVASLDLLKLWGDLRQEISLVENGGQYTKGY 660
           IATKHVNGALFALRQL FGLFDMTVHT KD+ SLD+  LW DLRQE+SLVENG Q TKG+
Sbjct: 590 IATKHVNGALFALRQLTFGLFDMTVHTCKDLESLDVTSLWNDLRQEVSLVENGDQVTKGF 649

Query: 661 DSFGHIMSDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSSVGMKYRDIVLANGGLYEID 720
           +SFGHIMS +YSAGYYGYMWAEVFA DMY TKFA +PL+  VG++YRDIVL+ GGLYEID
Sbjct: 650 NSFGHIMSGAYSAGYYGYMWAEVFAADMYHTKFAADPLNGDVGVRYRDIVLSRGGLYEID 709

Query: 721 DNLKEFLGREPSKDAFLKELGL 742
           DNL+EFLGREP+ +AFLKELGL
Sbjct: 710 DNLREFLGREPNNEAFLKELGL 731

>NCAS0B09070 Chr2 complement(1741718..1743910) [2193 bp, 730 aa]
           {ON} Anc_1.9
          Length = 730

 Score =  987 bits (2551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/683 (69%), Positives = 556/683 (81%), Gaps = 3/683 (0%)

Query: 61  LVPPAGALPRWEFPSAKIGEEATRIIESTNKFYDELVEISNPSIDNLVKPYMNHENSIGL 120
           LV P G  P W++    I  +   +I++    YD L  I  PS+++LVKPYM++EN  GL
Sbjct: 50  LVAPTGTAPTWKWSPESILAKTKEVIDNATNLYDSLAAIEEPSVESLVKPYMHYENDEGL 109

Query: 121 MVNQLCFLQHVSSDKEIREASNKATELLQNFEIETSLRHDLFLQFDKIWKELKPRKEEFS 180
           +VNQL FLQHVS+DK IR+AS +ATELLQ+F IE S+R DLF QFDKIW ++K   +  S
Sbjct: 110 IVNQLTFLQHVSADKLIRDASVEATELLQDFSIEASMRLDLFQQFDKIWNQVKDDDDLKS 169

Query: 181 HDEEQFEIYKFVEKCHKDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLGEQKEFLL 240
              + FE YKF+EK HKD+VR GLNL EE RN+VKDIK KIASNSL +SKNLGEQKE++ 
Sbjct: 170 ---KDFETYKFIEKVHKDYVRNGLNLPEEKRNQVKDIKKKIASNSLNYSKNLGEQKEYVS 226

Query: 241 FSKEQLDGVSDTVMEQFEQVKDETTNETNYKVTFKYPDIFPVLKMAKNAETRKTAFCGDQ 300
           F+KEQL GVS++VMEQFE+  D  TNE  YKVTFKYPDIFPVLK A+  +TRK A+  DQ
Sbjct: 227 FTKEQLKGVSESVMEQFEKFVDPKTNEEKYKVTFKYPDIFPVLKTAQVPKTRKLAYISDQ 286

Query: 301 NKVPQNEELFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTVXXXXXXXXXXXXXXG 360
           NKVPQNE LFV TLKLR++LA LLGY TYANYNL+IKMAK Q TV              G
Sbjct: 287 NKVPQNEALFVETLKLRNQLAQLLGYSTYANYNLDIKMAKNQETVFDFVNNLKDKLKPLG 346

Query: 361 EKEIGILKSIKEAECKELGVPFDGRYYIWDHRYYDTKYLKDNFNVDHEAIAEYYPIDSTI 420
           +KEI  LK++K+ +C+ELG+ +D  YYIWDHRYYD K+LKDN+NVD E I+EYYP++STI
Sbjct: 347 QKEIETLKTLKKKDCEELGLAYDDHYYIWDHRYYDNKFLKDNYNVDLEQISEYYPLESTI 406

Query: 421 EGMLKIYETVFKLKFVEEKDTAKKNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLHPRDG 480
           +GML IYET+ KLKFV+E +   K+VW+EDVKQ+AVWKMD+ K P F+GWIYFDLHPRDG
Sbjct: 407 KGMLGIYETLLKLKFVDETNPKIKDVWHEDVKQLAVWKMDDEKNPEFIGWIYFDLHPRDG 466

Query: 481 KYGHAANFGIASSYIREDGSRSYPVTALVCNFSKSSATKPSLLKHNEITTFFHELGHGIH 540
           KY HAANFGI+SSYI +DG RS+PVTALVCNFSKS+  KPSLLKHNEITTFFHELGHGIH
Sbjct: 467 KYSHAANFGISSSYITQDGDRSFPVTALVCNFSKSTDKKPSLLKHNEITTFFHELGHGIH 526

Query: 541 DLVGKNRAARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKHYKTGEQIPEKLLDSL 600
           DLVGKN+ ARFNGPGATPWDFVEAPSQMLEF+TW+KN L SLS HY+TGE+I E LLDSL
Sbjct: 527 DLVGKNKCARFNGPGATPWDFVEAPSQMLEFWTWNKNELLSLSGHYQTGEKISEDLLDSL 586

Query: 601 IATKHVNGALFALRQLHFGLFDMTVHTSKDVASLDLLKLWGDLRQEISLVENGGQYTKGY 660
           IATKHVNGALFALRQLHFGLFDMTVHT+K+V  L+LLKLW +LR++I LVENG + TKGY
Sbjct: 587 IATKHVNGALFALRQLHFGLFDMTVHTTKNVEDLNLLKLWNELREKICLVENGNELTKGY 646

Query: 661 DSFGHIMSDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSSVGMKYRDIVLANGGLYEID 720
           DSFGHIMSDSYSAGYYGYMWAEVFA DMY TKFA +PL+S  G++YRDIVLANGGLYEI 
Sbjct: 647 DSFGHIMSDSYSAGYYGYMWAEVFAADMYYTKFASDPLNSQAGVQYRDIVLANGGLYEIA 706

Query: 721 DNLKEFLGREPSKDAFLKELGLQ 743
           D LKEFLGREP+ DAFLKELGL 
Sbjct: 707 DKLKEFLGREPTNDAFLKELGLH 729

>Kpol_2002.12 s2002 (21544..23763) [2220 bp, 739 aa] {ON}
           (21544..23763) [2220 nt, 740 aa]
          Length = 739

 Score =  985 bits (2547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/684 (67%), Positives = 557/684 (81%), Gaps = 2/684 (0%)

Query: 61  LVPPAGALPRWEFPSAKIGEEATRIIESTNKFYDELVEISNPSIDNLVKPYMNHENSIGL 120
           L+ P  A P W +    I ++A  +I+ +N+ +D L  IS+P+++N + PYMNHEN +  
Sbjct: 57  LIAPQPA-PTWNWTPEGIVKDAESLIKDSNRIFDNLAAISSPTVENFIVPYMNHENKVSP 115

Query: 121 MVNQLCFLQHVSSDKEIREASNKATELLQNFEIETSLRHDLFLQFDKIWKELKPRKE-EF 179
           ++NQL FLQHVS+DK+IR++S KATEL+QNFEIE SLR DLF+QFDKIW ++K   E   
Sbjct: 116 LINQLTFLQHVSADKDIRDSSMKATELIQNFEIEASLRKDLFIQFDKIWTDVKDNSEFNE 175

Query: 180 SHDEEQFEIYKFVEKCHKDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLGEQKEFL 239
             D + +E Y+F+EKCHKDF+R+GLNLS+E R  VKDI+ KIASNSL FSKNLGEQKEF+
Sbjct: 176 KSDSKNYESYRFIEKCHKDFIRSGLNLSDEKREIVKDIQKKIASNSLNFSKNLGEQKEFI 235

Query: 240 LFSKEQLDGVSDTVMEQFEQVKDETTNETNYKVTFKYPDIFPVLKMAKNAETRKTAFCGD 299
            F+KE+LDGVSD VMEQFE+ KDE T E  +KVTFKYPDI PVLK AKN  TRK AF  D
Sbjct: 236 AFTKEELDGVSDAVMEQFEKFKDEKTGEEKFKVTFKYPDILPVLKSAKNPNTRKLAFNAD 295

Query: 300 QNKVPQNEELFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTVXXXXXXXXXXXXXX 359
           QNKVP+NE LFV TLKLR++L+T+L Y  YANYNLE+KMAK + TV              
Sbjct: 296 QNKVPENEALFVDTLKLRNDLSTVLDYSNYANYNLEMKMAKNEETVFNFLDDLKTKLRPL 355

Query: 360 GEKEIGILKSIKEAECKELGVPFDGRYYIWDHRYYDTKYLKDNFNVDHEAIAEYYPIDST 419
           G KEI ILK +KE + KEL +P+D  YYIWDHRYYD KYLKDNFNVD E I+EYYPI+S+
Sbjct: 356 GLKEIEILKQLKEKDMKELNLPYDNHYYIWDHRYYDNKYLKDNFNVDLEKISEYYPIESS 415

Query: 420 IEGMLKIYETVFKLKFVEEKDTAKKNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLHPRD 479
           I+GMLKIYETV KLKFVEE D AK+NVW+EDVKQ++VWKMDN   P F+GWIYFDLHPRD
Sbjct: 416 IDGMLKIYETVMKLKFVEETDPAKRNVWHEDVKQLSVWKMDNPDAPEFIGWIYFDLHPRD 475

Query: 480 GKYGHAANFGIASSYIREDGSRSYPVTALVCNFSKSSATKPSLLKHNEITTFFHELGHGI 539
           GKYGHAANFGI+SSY+ E+  RSYPVTALVCNFSK ++ KPSLLKHNE+TTFFHELGHGI
Sbjct: 476 GKYGHAANFGISSSYVDENDKRSYPVTALVCNFSKPTSDKPSLLKHNELTTFFHELGHGI 535

Query: 540 HDLVGKNRAARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKHYKTGEQIPEKLLDS 599
           HDLVG NR +R NGPG+ PWDFVEAPSQMLEF+TW+KN L SLSKHYKTGE+IPE L++S
Sbjct: 536 HDLVGANRCSRLNGPGSVPWDFVEAPSQMLEFWTWNKNELISLSKHYKTGEKIPESLIES 595

Query: 600 LIATKHVNGALFALRQLHFGLFDMTVHTSKDVASLDLLKLWGDLRQEISLVENGGQYTKG 659
           L++TKHVNGALFALRQLHF  FDM VHT++DV+ L+LL+LW  LR++I LVENG + +KG
Sbjct: 596 LVSTKHVNGALFALRQLHFSTFDMEVHTAEDVSKLNLLELWNGLREQICLVENGDEMSKG 655

Query: 660 YDSFGHIMSDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSSVGMKYRDIVLANGGLYEI 719
           YDSFGHIMS +YSAGYYGYMWAEVFATDMY TKFA +PL+S  G++YRDI+L+ GG+YE+
Sbjct: 656 YDSFGHIMSGAYSAGYYGYMWAEVFATDMYYTKFAADPLNSKSGVEYRDIILSRGGIYEV 715

Query: 720 DDNLKEFLGREPSKDAFLKELGLQ 743
           +DNL+EFLGREP+  AFLKE+GL 
Sbjct: 716 NDNLEEFLGREPNNSAFLKEMGLN 739

>KAFR0D00180 Chr4 (18900..21071) [2172 bp, 723 aa] {ON} Anc_1.9
           YCL057W
          Length = 723

 Score =  981 bits (2537), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/685 (70%), Positives = 563/685 (82%), Gaps = 5/685 (0%)

Query: 61  LVPPAGALPRWEFPSAKIGEEATRIIESTNKFYDELVEISNPSIDNLVKPYMNHENSIGL 120
            + P  A P W +  +++  +A  +I+++N+ YDEL  +  P+++NLV+PYM HEN I  
Sbjct: 42  FIAPQAA-PSWNWNPSRLLFDAECVIDNSNRLYDELSSLKKPTVENLVRPYMIHENKISP 100

Query: 121 MVNQLCFLQHVSSDKEIREASNKATELLQNFEIETSLRHDLFLQFDKIWKELKPRKEEFS 180
           ++N+LCFLQHVS D +IREAS KATELLQ FEIE SLRHDLFLQFDKIW+E+  +K++F 
Sbjct: 101 LINKLCFLQHVSEDPKIREASLKATELLQKFEIEASLRHDLFLQFDKIWQEISEKKDDFV 160

Query: 181 HDEEQFEIYKFVEKCHKDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLGEQKEFLL 240
             E  FE +KF+EK HKD+VR+GLNL E+ R K+K+IKIKI +NSL++SKNLGEQKE + 
Sbjct: 161 -KEYDFETWKFIEKVHKDYVRSGLNLPEDKREKIKEIKIKIGNNSLQYSKNLGEQKELIA 219

Query: 241 FSKEQLDGVSDTVMEQFEQVKDETTNETNYKVTFKYPDIFPVLKMAKNAETRKTAFCGDQ 300
           F++E+LDGVSD V EQFE+  DE T E  +KVTFKYPDIFPVLK AKN ETR+ AF  DQ
Sbjct: 220 FTREELDGVSDAVFEQFEKFIDEETGEEKFKVTFKYPDIFPVLKTAKNPETRRKAFLADQ 279

Query: 301 NKVPQNEELFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTVXXXXXXXXXXXXXXG 360
           NKVPQNE+LFV TLKLR+ELAT L Y TYANYNLE KMAK+Q TV               
Sbjct: 280 NKVPQNEDLFVETLKLRNELATTLNYSTYANYNLEEKMAKRQETVLDFLNDLKYRLKPLA 339

Query: 361 EKEIGILKSIKEAECKELGVPFDGRYYIWDHRYYDTKYLKDNFNVDHEAIAEYYPIDSTI 420
            KEI ILK IK+ ECKEL   +D  YYI+DHRYYD KYLKDNFNVD EAI+EYYP++ TI
Sbjct: 340 MKEISILKDIKQKECKELNREYDSHYYIYDHRYYDNKYLKDNFNVDLEAISEYYPLEHTI 399

Query: 421 EGMLKIYETVFKLKFVEEKDTAKKNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLHPRDG 480
            GMLKIYE +FKLKF EE  T  K+VW+EDVKQ+AVWKMDN + P FVGWIYFDLHPRDG
Sbjct: 400 NGMLKIYEELFKLKFNEE--TKNKSVWHEDVKQLAVWKMDNPEKPEFVGWIYFDLHPRDG 457

Query: 481 KYGHAANFGIASSYIR-EDGSRSYPVTALVCNFSKSSATKPSLLKHNEITTFFHELGHGI 539
           KYGHAANFGI+SSY+  E G RSYPVTALVCNFSKS+AT+PSLLKHNEITTFFHELGHGI
Sbjct: 458 KYGHAANFGISSSYVDIETGKRSYPVTALVCNFSKSTATRPSLLKHNEITTFFHELGHGI 517

Query: 540 HDLVGKNRAARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKHYKTGEQIPEKLLDS 599
           HDLVGKN+ +RFNGPGATPWDFVEAPSQMLEF+TW+ N L+SLS HY++ E+IP+ LL S
Sbjct: 518 HDLVGKNKLSRFNGPGATPWDFVEAPSQMLEFWTWNANELKSLSCHYESNEKIPDDLLTS 577

Query: 600 LIATKHVNGALFALRQLHFGLFDMTVHTSKDVASLDLLKLWGDLRQEISLVENGGQYTKG 659
           LI TKHVNGALFALRQLHFGLFDMTVHT+ +V SL+LLKLW +LR+EI LVE G + +KG
Sbjct: 578 LIKTKHVNGALFALRQLHFGLFDMTVHTTNNVESLNLLKLWNELREEICLVETGHELSKG 637

Query: 660 YDSFGHIMSDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSSVGMKYRDIVLANGGLYEI 719
           YDSFGHIMSDSYSAGYYGYMWAEVFA DMY TKF+PNPLDS VG++YRDIVLANGGLYEI
Sbjct: 638 YDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTKFSPNPLDSEVGVQYRDIVLANGGLYEI 697

Query: 720 DDNLKEFLGREPSKDAFLKELGLQA 744
            DNL++FLGREPSK+AFLKELGL A
Sbjct: 698 ADNLRDFLGREPSKNAFLKELGLDA 722

>TBLA0A07560 Chr1 complement(1871629..1873854) [2226 bp, 741 aa]
           {ON} Anc_1.9 YCL057W
          Length = 741

 Score =  979 bits (2532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/678 (69%), Positives = 559/678 (82%), Gaps = 1/678 (0%)

Query: 67  ALPRWEFPSAKIGEEATRIIESTNKFYDELVEISNPSIDNLVKPYMNHENSIGLMVNQLC 126
           A P W +  +++ ++A  +I+ +N FYD L  + +P  +N + PYMN+EN +G ++NQL 
Sbjct: 64  AAPTWNWTPSQLVKDAEDLIDQSNHFYDALTNLKSPDFNNFLVPYMNYENKVGSLINQLT 123

Query: 127 FLQHVSSDKEIREASNKATELLQNFEIETSLRHDLFLQFDKIWKELKPRKEEFSHDEEQF 186
           FLQHVSS+K+IR+AS KAT+LLQNFEIETSLR+ LFLQFDKIW ++K  K+++  D +  
Sbjct: 124 FLQHVSSEKDIRDASFKATDLLQNFEIETSLRYGLFLQFDKIWNQIKDSKDKYEKDPKDL 183

Query: 187 EIYKFVEKCHKDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLGEQKEFLLFSKEQL 246
           E Y+FV K H+DFVRAGLNL E  R K+K+IK  IA+NSL+F+ NLGEQ EF+ F+KE+L
Sbjct: 184 ENYEFVRKVHRDFVRAGLNLDESKREKIKEIKKAIANNSLKFATNLGEQTEFVAFTKEEL 243

Query: 247 DGVSDTVMEQFEQVKDETTNETNYKVTFKYPDIFPVLKMAKNAETRKTAFCGDQNKVPQN 306
           DGVSD+VMEQFE+  DE T +  YKVTFKYPDIFPVLK A+N ETRK AF GDQNKV +N
Sbjct: 244 DGVSDSVMEQFEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETRKKAFAGDQNKVSEN 303

Query: 307 EELFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTVXXXXXXXXXXXXXXGEKEIGI 366
             LF  TLKLR++LA +LGY TYANYNLE+KMAK Q +V              G KEI I
Sbjct: 304 TVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRLKPLGSKEIEI 363

Query: 367 LKSIKEAECKELGVPFDGRYYIWDHRYYDTKYLKDNFNVDHEAIAEYYPIDSTIEGMLKI 426
           LKSIKE E KEL +PFD  YY+WDHRYYD KYLKDN+NVD E I+EYYP+DSTIEGML I
Sbjct: 364 LKSIKEKEFKELNLPFDNHYYVWDHRYYDNKYLKDNYNVDLEKISEYYPLDSTIEGMLNI 423

Query: 427 YETVFKLKFVEEKDTAK-KNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLHPRDGKYGHA 485
           YET+  LKF+EEKD +K KNVW+++VKQ+AVWKMDN + P FVGWIYFDLHPRDGKYGHA
Sbjct: 424 YETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHPRDGKYGHA 483

Query: 486 ANFGIASSYIREDGSRSYPVTALVCNFSKSSATKPSLLKHNEITTFFHELGHGIHDLVGK 545
           ANFGI+SSYI+ +  RSYPVTALVCNFSK +A KP+LLKHNEITTFFHELGHGIHDLVGK
Sbjct: 484 ANFGISSSYIKPNNERSYPVTALVCNFSKVTADKPALLKHNEITTFFHELGHGIHDLVGK 543

Query: 546 NRAARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKHYKTGEQIPEKLLDSLIATKH 605
           N  +RFNGPGA PWDFVEAPSQMLEF+TW+KN L SLSKHYKTGE+IP +LL+SL+ATKH
Sbjct: 544 NNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPTELLNSLVATKH 603

Query: 606 VNGALFALRQLHFGLFDMTVHTSKDVASLDLLKLWGDLRQEISLVENGGQYTKGYDSFGH 665
           VNGALFALRQLHFGLFDM VHTSKD+ +LD LKLW +LR+E+SLVENG  +TKGYDSFGH
Sbjct: 604 VNGALFALRQLHFGLFDMKVHTSKDLENLDFLKLWNELREEVSLVENGDLFTKGYDSFGH 663

Query: 666 IMSDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSSVGMKYRDIVLANGGLYEIDDNLKE 725
           IMSDSYSAGYYGYMWAEVFATDMY TKFA NPL++ VG++YRD VLA GGLYEI+DNL +
Sbjct: 664 IMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLETKVGVEYRDWVLARGGLYEIEDNLIQ 723

Query: 726 FLGREPSKDAFLKELGLQ 743
           FLGR+PS +AFLKELGL 
Sbjct: 724 FLGRKPSNEAFLKELGLN 741

>TPHA0E03970 Chr5 complement(834023..836266) [2244 bp, 747 aa] {ON}
           Anc_1.9 YCL057W
          Length = 747

 Score =  954 bits (2466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/682 (67%), Positives = 548/682 (80%), Gaps = 7/682 (1%)

Query: 69  PRWEFPSAKIGEEATRIIESTNKFYDELVEISNPSIDNLVKPYMNHENSIGLMVNQLCFL 128
           P+W+F   +I  +A +II+++N FY+ +V I NPSI+N V P +N EN   L +NQL FL
Sbjct: 66  PKWDFSPERILSDAKKIIDTSNDFYNAMVAIENPSIENFVIPSINFENENSLAINQLTFL 125

Query: 129 QHVSSDKEIREASNKATELLQNFEIETSLRHDLFLQFDKIWKELKPRK---EEFSHDEEQ 185
           QHVS DK IR+AS +ATEL+ NF+IE SLR+D+F QFDKI+ +LK  K   +  +   + 
Sbjct: 126 QHVSKDKLIRDASLEATELITNFDIEISLRYDMFKQFDKIFNDLKDNKKYNDLKTATPKD 185

Query: 186 FEIYKFVEKCHKDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLGEQKEFLLFSKEQ 245
           +EI+K+VEKCHKD+VR+GLNLSEE RN++K+IK +IA NSL+FSKNLGEQ EF+ F+KE+
Sbjct: 186 YEIFKYVEKCHKDYVRSGLNLSEEKRNEIKEIKKRIALNSLQFSKNLGEQNEFVAFTKEE 245

Query: 246 LDGVSDTVMEQFEQVKDETTNETNYKVTFKYPDIFPVLKMAKNAETRKTAFCGDQNKVPQ 305
           L+GVSD VM+QFE   DE T E  +KVTFKYPDIFPVLK AKN  TRK AF  DQNKVP+
Sbjct: 246 LEGVSDDVMKQFETYTDEQTGEQKFKVTFKYPDIFPVLKTAKNPNTRKIAFNADQNKVPE 305

Query: 306 NEELFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTVXXXXXXXXXXXXXXGEKEIG 365
           NE+LF+ TLKLR +L  +LGYDTYANYNL+IKMAK Q TV               EKEI 
Sbjct: 306 NEKLFIDTLKLRYQLGKILGYDTYANYNLDIKMAKNQETVMEFLVDLKDKLKPLAEKEIE 365

Query: 366 ILKSIKEAECKELGVPFDGRYYIWDHRYYDTKYLKDNFNVDHEAIAEYYPIDSTIEGMLK 425
           +LK+IK+ E +EL + +D  YYIWDHRYYD KYLKD FNVD E I+EYYP++STI+GMLK
Sbjct: 366 VLKAIKKTEAQELNMAYDDHYYIWDHRYYDNKYLKDKFNVDLEKISEYYPVESTIQGMLK 425

Query: 426 IYETVFKLKFVEEKDTAKKNVW-NEDVKQIAVWKMDNVKTPVFVGWIYFDLHPRDGKYGH 484
           IYETV  LKF+EE D   K+ W  +DVKQ+AVWKMD+   P FVGWIYFDLHPR+GKYGH
Sbjct: 426 IYETVMNLKFIEETDKDLKSTWAGDDVKQLAVWKMDDPSKPEFVGWIYFDLHPREGKYGH 485

Query: 485 AANFGIASSYIREDGSRSYPVTALVCNFSKSSATKPSLLKHNEITTFFHELGHGIHDLVG 544
           AANFG+A SYI +D  R YPVTALVCNFS ++A KP+LLKHNEITTFFHELGHGIHDLVG
Sbjct: 486 AANFGMAPSYIDKDSKRIYPVTALVCNFSAATADKPALLKHNEITTFFHELGHGIHDLVG 545

Query: 545 KNRAARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKHYKTGEQIPEKLLDSLIATK 604
            N   RFNGPGA PWDFVEAPSQMLEF+TW+KN L SLSKHYKTGE+IPE LL+SLIATK
Sbjct: 546 NNGIGRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPESLLESLIATK 605

Query: 605 HVNGALFALRQLHFGLFDMTVHTSKD---VASLDLLKLWGDLRQEISLVENGGQYTKGYD 661
           HVNGALFALRQLHFGLFDM VHT+ D   + ++DL++LW  LR+EISLVENG +  KGYD
Sbjct: 606 HVNGALFALRQLHFGLFDMKVHTTTDDNQIDNMDLVQLWNGLREEISLVENGDEMNKGYD 665

Query: 662 SFGHIMSDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSSVGMKYRDIVLANGGLYEIDD 721
           SFGHIMSDSYSAGYYGYMWAEVFATDMY +KFA +PL++  G++YRDI+LA GG+ E +D
Sbjct: 666 SFGHIMSDSYSAGYYGYMWAEVFATDMYYSKFAKDPLNTKSGIEYRDIILARGGIRETND 725

Query: 722 NLKEFLGREPSKDAFLKELGLQ 743
           NLKEFLGREPSK+AFLKELGLQ
Sbjct: 726 NLKEFLGREPSKEAFLKELGLQ 747

>NDAI0A00180 Chr1 (14692..16914) [2223 bp, 740 aa] {ON} Anc_1.9
          Length = 740

 Score =  954 bits (2465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/683 (67%), Positives = 555/683 (81%), Gaps = 6/683 (0%)

Query: 61  LVPPAGALPRWEFPSAKIGEEATRIIESTNKFYDELVEISNPSIDNLVKPYMNHENSIGL 120
            + PA  +P W +   +I +E    IE TNK+Y+ + EI +PSI+NL+ PYMN+EN +GL
Sbjct: 63  FIAPANTVPDWTWTPKQILDETKSYIEKTNKYYNSISEIESPSIENLIIPYMNYENKMGL 122

Query: 121 MVNQLCFLQHVSSDKEIREASNKATELLQNFEIETSLRHDLFLQFDKIWKELKPRKEEFS 180
           ++NQL FLQHVS+DK+IR+AS +AT LL++ +I TSLR +++ QF+K+W+ ++   ++F 
Sbjct: 123 LINQLTFLQHVSADKKIRDASLEATRLLEDHDILTSLRWEIWEQFEKVWETVQ-NDDDFL 181

Query: 181 HDEEQFEIYKFVEKCHKDFVRAGLNLSEEDRN-KVKDIKIKIASNSLEFSKNLGEQKEFL 239
            +  QFE YKF+EK HKD +R GL   + +RN ++K IK KI++++L FS NLGEQ E++
Sbjct: 182 KNH-QFETYKFIEKIHKDSLRNGL---KSERNYQLKYIKGKISADALTFSSNLGEQNEYV 237

Query: 240 LFSKEQLDGVSDTVMEQFEQVKDETTNETNYKVTFKYPDIFPVLKMAKNAETRKTAFCGD 299
            F+KE+LDGVS+TVM+QFE+  D  TNE  YKVTFKYPDIFPVLK AKN +TRK AF GD
Sbjct: 238 SFTKEELDGVSETVMDQFEKFIDPKTNEKKYKVTFKYPDIFPVLKTAKNPKTRKIAFLGD 297

Query: 300 QNKVPQNEELFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTVXXXXXXXXXXXXXX 359
           QNKVP+NE+L    LKLR ELA  LGY TYANYNL+IKMAK Q TV              
Sbjct: 298 QNKVPENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETVLKFLNDLKEKLKPL 357

Query: 360 GEKEIGILKSIKEAECKELGVPFDGRYYIWDHRYYDTKYLKDNFNVDHEAIAEYYPIDST 419
            EKEI ILK +K+ EC+ELG+P+DG YYIWDHRYYD KYLKDNFNVD E I+EYYP++ST
Sbjct: 358 AEKEIKILKDLKKKECEELGIPYDGHYYIWDHRYYDNKYLKDNFNVDIEKISEYYPLEST 417

Query: 420 IEGMLKIYETVFKLKFVEEKDTAKKNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLHPRD 479
           I+GMLKIYETV  LKF+EE D   KNVW+ DVKQ++VW MD+   P FVGWIYFDL+PRD
Sbjct: 418 IDGMLKIYETVLNLKFIEETDPLAKNVWHPDVKQLSVWNMDDRANPAFVGWIYFDLYPRD 477

Query: 480 GKYGHAANFGIASSYIREDGSRSYPVTALVCNFSKSSATKPSLLKHNEITTFFHELGHGI 539
           GKYGHAANFGIASSYI E+  RSYPVTALVCNFSK +  KP+LLKH+EITTFFHELGHGI
Sbjct: 478 GKYGHAANFGIASSYITEENKRSYPVTALVCNFSKPTKNKPALLKHSEITTFFHELGHGI 537

Query: 540 HDLVGKNRAARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKHYKTGEQIPEKLLDS 599
           HDLVG+N+AARFNGPG+ PWDFVEAPSQMLEF+TW+KN L SLSKHYKTGE+IPE LLDS
Sbjct: 538 HDLVGQNKAARFNGPGSVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPEDLLDS 597

Query: 600 LIATKHVNGALFALRQLHFGLFDMTVHTSKDVASLDLLKLWGDLRQEISLVENGGQYTKG 659
           LI+TKHVNGALFALRQLHFGLFDMTVHT+KD+ +LDLLKLW + R+EI LVENG  +TKG
Sbjct: 598 LISTKHVNGALFALRQLHFGLFDMTVHTTKDIENLDLLKLWNESREEICLVENGENFTKG 657

Query: 660 YDSFGHIMSDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSSVGMKYRDIVLANGGLYEI 719
           Y+SFGHI+SDSYSAGYYGYMWAEVFA DMY TKFAPNPLD SVG+KYRD++LA GGLYEI
Sbjct: 658 YNSFGHIISDSYSAGYYGYMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAKGGLYEI 717

Query: 720 DDNLKEFLGREPSKDAFLKELGL 742
           +DNL EFLGREPS   FLKELGL
Sbjct: 718 NDNLLEFLGREPSNKPFLKELGL 740

>KLLA0C00572g Chr3 (42069..44207) [2139 bp, 712 aa] {ON} similar to
           uniprot|P25375 Saccharomyces cerevisiae YCL057W PRD1
           Zinc metalloendopeptidase found in the cytoplasm and
           intermembrane space of mitochondria
          Length = 712

 Score =  932 bits (2409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/682 (64%), Positives = 550/682 (80%), Gaps = 11/682 (1%)

Query: 61  LVPPAGALPRWEFPSAKIGEEATRIIESTNKFYDELVEISNPSIDNLVKPYMNHENSIGL 120
           +VP A   P W + + ++ ++    I+S+N+  D L  ISNPS++N V PY++HEN+I  
Sbjct: 42  VVPQAA--PSWNYTTEELLKQTHEAIDSSNELLDSLESISNPSVENFVTPYLHHENTISP 99

Query: 121 MVNQLCFLQHVSSDKEIREASNKATELLQNFEIETSLRHDLFLQFDKIWKELKPRKEEFS 180
           + NQL FLQHVSSDKE+R+ S K TEL++NF IE+SLR  LF QFD +W +LK   ++  
Sbjct: 100 LFNQLTFLQHVSSDKELRDTSTKVTELIENFGIESSLRFKLFRQFDIVWNQLK---DDAQ 156

Query: 181 HDEEQFEIYKFVEKCHKDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLGEQKEFLL 240
             ++ FEIYKFVEKCHKDF+R+GLNL EE R+KVK+IK KI++NSL+FSKNLGEQ EF+ 
Sbjct: 157 FKKDHFEIYKFVEKCHKDFLRSGLNLPEEQRDKVKEIKKKISNNSLQFSKNLGEQNEFIT 216

Query: 241 FSKEQLDGVSDTVMEQFEQVKDETTNETNYKVTFKYPDIFPVLKMAKNAETRKTAFCGDQ 300
           F+KE+L GVS+ VM+QFE V ++    T YKVTFKYPDIFPVLK AKNAETRK AF GDQ
Sbjct: 217 FTKEELIGVSENVMKQFETVDEDGI--TKYKVTFKYPDIFPVLKSAKNAETRKRAFIGDQ 274

Query: 301 NKVPQNEELFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTVXXXXXXXXXXXXXXG 360
           NKVPQNE LF+ TL+LR++LA LL YD+YA+YNL+IKMAKK+  V              G
Sbjct: 275 NKVPQNEALFLETLQLRNDLAELLNYDSYADYNLDIKMAKKEEAVLTFLNDLKNKLKPLG 334

Query: 361 EKEIGILKSIKEAECKELGVPFDGRYYIWDHRYYDTKYLKDNFNVDHEAIAEYYPIDSTI 420
           EKE+  LK++KE ECKEL  P+D RYYIWD+RYYD +YLK NF +D E IAEY+P++STI
Sbjct: 335 EKELTKLKNLKEEECKELNTPYDRRYYIWDNRYYDNQYLKKNFQIDEEKIAEYFPLESTI 394

Query: 421 EGMLKIYETVFKLKFVEEKDTAKKNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLHPRDG 480
           +GML+IYETV KLKF+EE +    + W+ DVK+++VWKMD+   P FVGWIYFDLHPR+G
Sbjct: 395 KGMLQIYETVLKLKFIEEDNG---DTWHPDVKKLSVWKMDD-NFPSFVGWIYFDLHPREG 450

Query: 481 KYGHAANFGIASSYIREDGSRSYPVTALVCNFSKSSATKPSLLKHNEITTFFHELGHGIH 540
           KYGHAANFGI+SS+++ DGSRSYPVTALVCNFSK +  KP+LLKH+E+TTFFHELGHGIH
Sbjct: 451 KYGHAANFGISSSFLKSDGSRSYPVTALVCNFSKPTKDKPALLKHSELTTFFHELGHGIH 510

Query: 541 DLVGKNRAARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKHYKTGEQIPEKLLDSL 600
           DLVG N   RFNGP ATPWDFVEAPSQMLEF+TW+K  L+SLSKHY+T E+IP+ LLDSL
Sbjct: 511 DLVGGNDIGRFNGPSATPWDFVEAPSQMLEFWTWNKKELKSLSKHYQTEEKIPDSLLDSL 570

Query: 601 IATKHVNGALFALRQLHFGLFDMTVHTSKDVASLDLLKLWGDLRQEISLVENGGQYTKGY 660
           + TKH+NGALFALRQLHFGLFDM VHT+KD++ L++ +LW  LR+EI L++NG   TKG+
Sbjct: 571 VRTKHINGALFALRQLHFGLFDMKVHTTKDISKLNVTELWNSLREEICLIDNGDIQTKGF 630

Query: 661 DSFGHIMSDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSSVGMKYRDIVLANGGLYEID 720
           +SFGHIMSDSYSAGYYGYMWA+VFA+DMY TKF  +PL+S VG++YRDI+LA GGLYEI+
Sbjct: 631 NSFGHIMSDSYSAGYYGYMWADVFASDMYYTKFLEDPLNSDVGVQYRDIILARGGLYEIE 690

Query: 721 DNLKEFLGREPSKDAFLKELGL 742
           DNL EFLGR+P+  AFLKELGL
Sbjct: 691 DNLTEFLGRKPNNKAFLKELGL 712

>YCL057W Chr3 (24768..26906) [2139 bp, 712 aa] {ON}  PRD1Zinc
           metalloendopeptidase, found in the cytoplasm and
           intermembrane space of mitochondria; with Cym1p,
           involved in degradation of mitochondrial proteins and of
           presequence peptides cleaved from imported proteins
          Length = 712

 Score =  904 bits (2335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/678 (63%), Positives = 539/678 (79%), Gaps = 6/678 (0%)

Query: 67  ALPRWEFPSAKIGEEATRIIESTNKFYDELVEISNPSIDNLVKPYMNHENSIGLMVNQLC 126
           A P W F  + I  +   II ++N FYD + ++ +PS+ N V+P+M  EN +G ++NQL 
Sbjct: 39  APPNWSFTPSDISGKTNEIINNSNNFYDSMSKVESPSVSNFVEPFMKFENELGPIINQLT 98

Query: 127 FLQHVSSDKEIREASNKATELLQNFEIETSLRHDLFLQFDKIWKELKPRKEEFSHDEEQF 186
           FLQHVSSDKEIR+AS  ++  L    I+ SLRHD+FLQF ++W++++ +      D  + 
Sbjct: 99  FLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHDIFLQFARVWQDVQSKA-----DSVER 153

Query: 187 EIYKFVEKCHKDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLGEQKEFLLFSKEQL 246
           E +K+VEK +KD++ +GL L E +R K+K+IK KI+ NS+ FSKNLGEQKE++ F+KEQL
Sbjct: 154 ETFKYVEKSYKDYIHSGLELDEGNRLKIKEIKKKISVNSINFSKNLGEQKEYITFTKEQL 213

Query: 247 DGVSDTVMEQFEQVK-DETTNETNYKVTFKYPDIFPVLKMAKNAETRKTAFCGDQNKVPQ 305
           +GV D+++ QFE +K D+ +NET YKVTFKYPDIFPV+K+A +A+TRK AF  DQNKVP+
Sbjct: 214 EGVPDSILTQFETIKSDKDSNETLYKVTFKYPDIFPVMKLASSAQTRKQAFLADQNKVPE 273

Query: 306 NEELFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTVXXXXXXXXXXXXXXGEKEIG 365
           NE + + TLKLRDELA+LLGYDTYANYNL  KMA+  +TV              G KE+ 
Sbjct: 274 NEAILLDTLKLRDELASLLGYDTYANYNLYDKMAEDSTTVMNFLNDLKDKLIPLGRKELQ 333

Query: 366 ILKSIKEAECKELGVPFDGRYYIWDHRYYDTKYLKDNFNVDHEAIAEYYPIDSTIEGMLK 425
           +L+ +K  + K+L    D  YYIWDHRYYD KYL +NFNVD E I+EY+P+++TI GML+
Sbjct: 334 VLQDMKAEDVKKLNQGADPNYYIWDHRYYDNKYLLENFNVDLEKISEYFPLEATITGMLE 393

Query: 426 IYETVFKLKFVEEKDTAKKNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLHPRDGKYGHA 485
           IYET+F LKF+E KD+  K+VW++DVKQIAVW MD+ K+P FVGWIYFDLHPRDGKYGHA
Sbjct: 394 IYETLFNLKFIETKDSQNKSVWHDDVKQIAVWNMDDPKSPNFVGWIYFDLHPRDGKYGHA 453

Query: 486 ANFGIASSYIREDGSRSYPVTALVCNFSKSSATKPSLLKHNEITTFFHELGHGIHDLVGK 545
           ANFG++SS++ +D +RSYPVTALVCNFSKS+  KPSLLKHNEI TFFHELGHGIHDLVG+
Sbjct: 454 ANFGLSSSFMIDDTTRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQ 513

Query: 546 NRAARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKHYKTGEQIPEKLLDSLIATKH 605
           N+ +RFNGPG+ PWDFVEAPSQMLEF+TW+KN L +LS HYKTGE+IPE L++SLI TKH
Sbjct: 514 NKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELINLSSHYKTGEKIPESLINSLIKTKH 573

Query: 606 VNGALFALRQLHFGLFDMTVHTSKDVASLDLLKLWGDLRQEISLVENGGQYTKGYDSFGH 665
           VNGALF LRQLHFGLFDM VHT KD+ +L +   W  LRQ+ISL+ NGG  +KGYDSFGH
Sbjct: 574 VNGALFTLRQLHFGLFDMKVHTCKDLQNLSICDTWNQLRQDISLISNGGTLSKGYDSFGH 633

Query: 666 IMSDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSSVGMKYRDIVLANGGLYEIDDNLKE 725
           IMSDSYSAGYYGY+WAEVFATDMY TKFA +PL++  G++YRDIVLA GGLY+I+DNLKE
Sbjct: 634 IMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNAKNGIQYRDIVLARGGLYDINDNLKE 693

Query: 726 FLGREPSKDAFLKELGLQ 743
           FLGREPSKDAFLKELGLQ
Sbjct: 694 FLGREPSKDAFLKELGLQ 711

>CAGL0B00418g Chr2 (26584..28815) [2232 bp, 743 aa] {ON} similar to
           uniprot|P25375 Saccharomyces cerevisiae YCL057w PRD1
           proteinase yscD
          Length = 743

 Score =  903 bits (2333), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/688 (65%), Positives = 540/688 (78%), Gaps = 11/688 (1%)

Query: 59  PQLVPPAGALPRWEFPSAKIGEEATRIIESTNKFYDELVEISNPSIDNLVKPYMNHENSI 118
           P L PP    P WEF    I  +    I +T  FYD+LV I NP+I+NL+ PY+NHEN  
Sbjct: 64  PSLTPPQYP-PSWEFKPEDILSQTKEFIANTKLFYDDLVAIDNPTIENLIVPYINHENEN 122

Query: 119 GLMVNQLCFLQHVSSDKEIREASNKATELLQNFEIETSLRHDLFLQFDKIWKELKPRKEE 178
            L++NQL FLQHVS DK IR+AS +AT LLQ+FEIE+  R DLF QFD IW ++K +K+E
Sbjct: 123 ELLINQLTFLQHVSEDKTIRDASMEATMLLQDFEIESGSRVDLFKQFDLIWNQIKDKKDE 182

Query: 179 FSHDEEQFEIYKFVEKCHKDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLGEQKEF 238
           F    E FEI++FVEKCHKD+VRAGLNL  +   KVK+IK KIA N L+FSKNLGEQKE+
Sbjct: 183 F----EDFEIWRFVEKCHKDYVRAGLNLPADKLEKVKEIKKKIADNCLKFSKNLGEQKEY 238

Query: 239 LLFSKEQLDGVSDTVMEQFEQVKDETTNETNYKVTFKYPDIFPVLKMAKNAETRKTAFCG 298
           +LF+ E+L GV ++V+EQFE+V DE   +   KVT+KYPDIFPVLK A+N ETR  AF G
Sbjct: 239 ILFTAEELKGVPESVIEQFEKVNDEFGIQ-KLKVTYKYPDIFPVLKNAQNPETRMKAFMG 297

Query: 299 DQNKVPQNEELFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTVXXXXXXXXXXXXX 358
           DQNKVP+NE LF  TLKLR+ELA +LGYDTYANYNL+IKMAK   TV             
Sbjct: 298 DQNKVPENEHLFKDTLKLRNELALVLGYDTYANYNLDIKMAKNADTVLSFVNDLIVKLQD 357

Query: 359 XGEKEIGILKSIKEAECK-ELGVPFDGRYYIWDHRYYDTKYLKDNFNVDHEAIAEYYPID 417
             +KE+ ILK++K+ E + E  + +DG YYIWDHRYYD KYLK+NFNVD E IAEYYP++
Sbjct: 358 PAKKELDILKNLKKQEFENEFNMVYDGDYYIWDHRYYDNKYLKENFNVDEEKIAEYYPLE 417

Query: 418 STIEGMLKIYETVFKLKFVEEKDTAKKNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLHP 477
           STI+GMLKIYET+ KLKFVE K+  K   W++DVKQ+AVWK+D  + P FVGWI+FDLHP
Sbjct: 418 STIDGMLKIYETLLKLKFVEVKENKK--TWHDDVKQLAVWKLDTPENPEFVGWIFFDLHP 475

Query: 478 RDGKYGHAANFGIASSYIREDGSRSYPVTALVCNFSKSSATKPSLLKHNEITTFFHELGH 537
           RDGKYGHAANFG++SSYI  +G+RSYP+TALVCNFSKS+  KPSLLKH+EITTFFHELGH
Sbjct: 476 RDGKYGHAANFGLSSSYISANGTRSYPITALVCNFSKSTKDKPSLLKHSEITTFFHELGH 535

Query: 538 GIHDLVGKNRAARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKHYKTGEQIPEKLL 597
           GIHDLVG NR  RFNGPGA PWDFVEAPSQMLEF+TW+   L SLS++YK   +I  KLL
Sbjct: 536 GIHDLVGNNRIGRFNGPGAVPWDFVEAPSQMLEFWTWNTKELLSLSQNYKDNAKIDTKLL 595

Query: 598 DSLIATKHVNGALFALRQLHFGLFDMTVH--TSKDVASLDLLKLWGDLRQEISLVENGGQ 655
           +SLI TKHVNGALFALRQLHFGLFDM VH  +++++  LD+ KLW DLR++I L+ NG Q
Sbjct: 596 ESLIKTKHVNGALFALRQLHFGLFDMKVHMMSAEELDKLDIKKLWNDLREKICLISNGDQ 655

Query: 656 YTKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSSVGMKYRDIVLANGG 715
            T GY+SFGHIMS SYSAGYYGYMWAEVFATDMY TKF  +PL+  VG+KYRDIVLA GG
Sbjct: 656 PTTGYNSFGHIMSGSYSAGYYGYMWAEVFATDMYYTKFKADPLNPEVGVKYRDIVLARGG 715

Query: 716 LYEIDDNLKEFLGREPSKDAFLKELGLQ 743
           LYEIDDNL+EFLGR+P+KDAFL+ELGL 
Sbjct: 716 LYEIDDNLEEFLGRKPAKDAFLEELGLH 743

>Suva_3.156 Chr3 (234520..236658) [2139 bp, 712 aa] {ON} YCL057W
           (REAL)
          Length = 712

 Score =  898 bits (2320), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/676 (62%), Positives = 530/676 (78%), Gaps = 6/676 (0%)

Query: 69  PRWEFPSAKIGEEATRIIESTNKFYDELVEISNPSIDNLVKPYMNHENSIGLMVNQLCFL 128
           P W F    I      IIE +NKFYD + ++ +P++ N V+P+M  EN +G ++NQL FL
Sbjct: 41  PSWSFTPNDISGRTKEIIEKSNKFYDSMSQVESPAVTNFVEPFMKFENELGPIINQLTFL 100

Query: 129 QHVSSDKEIREASNKATELLQNFEIETSLRHDLFLQFDKIWKELKPRKEEFSHDEEQFEI 188
           QHVSSDKEIR+AS  ++  L    I+ SLRHD+FLQF ++W++ + +      D  + E 
Sbjct: 101 QHVSSDKEIRDASVDSSMKLDELNIDLSLRHDVFLQFARVWQDAQSQA-----DSIERET 155

Query: 189 YKFVEKCHKDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLGEQKEFLLFSKEQLDG 248
           ++++EK +KD++ +GL L E DR KVK+IK KI+ NS+ FSKNLGEQKEF+ F+KEQL+G
Sbjct: 156 FRYIEKSYKDYIHSGLELDEPDRLKVKEIKKKISVNSINFSKNLGEQKEFITFTKEQLEG 215

Query: 249 VSDTVMEQFEQVKD-ETTNETNYKVTFKYPDIFPVLKMAKNAETRKTAFCGDQNKVPQNE 307
           V D+++ QFE ++  + +NET YKVTFKYPDIFPV+K+A +++TRK AF  DQNKV +NE
Sbjct: 216 VPDSILAQFETIESGKDSNETLYKVTFKYPDIFPVMKLASSSQTRKQAFLADQNKVSENE 275

Query: 308 ELFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTVXXXXXXXXXXXXXXGEKEIGIL 367
            + + TLKLRDE+A+LLGYDTYANYNL  KMAK  +TV              GEKE+ IL
Sbjct: 276 AILLDTLKLRDEVASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKKKLIPLGEKELQIL 335

Query: 368 KSIKEAECKELGVPFDGRYYIWDHRYYDTKYLKDNFNVDHEAIAEYYPIDSTIEGMLKIY 427
           + +K  + K+     D  YYIWDHRYYD KYL +NFNVD E I+E++P+++TI GML+IY
Sbjct: 336 QDMKAKDVKKRNQDEDPNYYIWDHRYYDNKYLLENFNVDLEKISEFFPLETTITGMLQIY 395

Query: 428 ETVFKLKFVEEKDTAKKNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLHPRDGKYGHAAN 487
           ET+F LKF+E K+  +K+VW+EDVKQ+AVW MD+ K+P F+GWIYFDLHPRDGKYGHAAN
Sbjct: 396 ETLFNLKFIETKNPQEKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAAN 455

Query: 488 FGIASSYIREDGSRSYPVTALVCNFSKSSATKPSLLKHNEITTFFHELGHGIHDLVGKNR 547
           FG++SS++  D +RSYPVTALVCNFSKS+  KPSLLKHNEI TFFHELGHGIHDLVG+N+
Sbjct: 456 FGLSSSFMVNDTTRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNK 515

Query: 548 AARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKHYKTGEQIPEKLLDSLIATKHVN 607
            +RFNGPG+ PWDFVEAPSQMLEF+TW+KN L  LS HYKTGE+IPE L+DSLI TKHVN
Sbjct: 516 ESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELMHLSSHYKTGEKIPEPLIDSLIKTKHVN 575

Query: 608 GALFALRQLHFGLFDMTVHTSKDVASLDLLKLWGDLRQEISLVENGGQYTKGYDSFGHIM 667
           GALF LRQLHFGLFDM VH+ KD+ +L +   W  LRQ+ISL+ NGG  +KGY SFGHIM
Sbjct: 576 GALFTLRQLHFGLFDMKVHSCKDLQNLSICDTWNQLRQDISLMSNGGTLSKGYASFGHIM 635

Query: 668 SDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSSVGMKYRDIVLANGGLYEIDDNLKEFL 727
           SDSYSAGYYGY+WAEVFATDMY TKFA +PL++  G++YRDIVLA GGL +I+D+LKEFL
Sbjct: 636 SDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDIVLARGGLRDINDSLKEFL 695

Query: 728 GREPSKDAFLKELGLQ 743
           GREPSKDAFLKELGLQ
Sbjct: 696 GREPSKDAFLKELGLQ 711

>Skud_3.7 Chr3 (12763..14901) [2139 bp, 712 aa] {ON} YCL057W (REAL)
          Length = 712

 Score =  890 bits (2299), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/679 (62%), Positives = 532/679 (78%), Gaps = 6/679 (0%)

Query: 67  ALPRWEFPSAKIGEEATRIIESTNKFYDELVEISNPSIDNLVKPYMNHENSIGLMVNQLC 126
           A P W F    IG + T II+ +NKFY+ + ++ +PS+ N ++P+M  EN +G ++N+L 
Sbjct: 39  APPTWSFTPTDIGGKTTEIIDKSNKFYELMSQVESPSVTNFIEPFMKFENELGPIINRLT 98

Query: 127 FLQHVSSDKEIREASNKATELLQNFEIETSLRHDLFLQFDKIWKELKPRKEEFSHDEEQF 186
           FLQHVSSDKEIR+AS  ++  L    I+ SLRHD+FLQF ++W++ +P+ +         
Sbjct: 99  FLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHDIFLQFARVWQDAQPKADSLKK----- 153

Query: 187 EIYKFVEKCHKDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLGEQKEFLLFSKEQL 246
           E +K++EK +KDF+ +GL L E +R K+K+IK KI+ NS+ FSKNLGEQKE++ F+KEQL
Sbjct: 154 ETFKYIEKSYKDFIHSGLELDEANRLKIKEIKKKISMNSINFSKNLGEQKEYITFTKEQL 213

Query: 247 DGVSDTVMEQFEQVKDETTNE-TNYKVTFKYPDIFPVLKMAKNAETRKTAFCGDQNKVPQ 305
           +GV D+++ QFE  K E   E T YKVTFKYPDIFPV+K+A +A+TRK AF  DQNKVP+
Sbjct: 214 EGVPDSILAQFETTKSEKGGEDTLYKVTFKYPDIFPVMKLASSAQTRKQAFLADQNKVPE 273

Query: 306 NEELFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTVXXXXXXXXXXXXXXGEKEIG 365
           NE + + TLKLRDELA+LLGY+TYA+YNL  KMAK   TV              G+KE+ 
Sbjct: 274 NEAILLDTLKLRDELASLLGYNTYADYNLYDKMAKDSRTVMDFLNDLKGKLIPLGKKELQ 333

Query: 366 ILKSIKEAECKELGVPFDGRYYIWDHRYYDTKYLKDNFNVDHEAIAEYYPIDSTIEGMLK 425
           +L+ +K  + +      D  YYIWDHRYYD K+L +NFNVD E I+EY+P+++TI GML+
Sbjct: 334 VLQDMKVKDVERSKKDEDPNYYIWDHRYYDNKHLLENFNVDLEKISEYFPLETTITGMLQ 393

Query: 426 IYETVFKLKFVEEKDTAKKNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLHPRDGKYGHA 485
           IYET+F LKF+E K+   K+VW+EDVKQ+AVW MD+ K+P F+GWIYFDLHPRDGKYGHA
Sbjct: 394 IYETLFNLKFIETKEPQNKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHA 453

Query: 486 ANFGIASSYIREDGSRSYPVTALVCNFSKSSATKPSLLKHNEITTFFHELGHGIHDLVGK 545
           ANFG++SS++  D  RSYPVTALVCNFSKS+  KPSLLKHNEI TFFHELGHGIHDLVG+
Sbjct: 454 ANFGLSSSFMINDSKRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQ 513

Query: 546 NRAARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKHYKTGEQIPEKLLDSLIATKH 605
           N+ +RFNGPG+ PWDFVEAPSQMLEF+TW+KN L SLS HYKTGE+IPE L+DSLI TKH
Sbjct: 514 NKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELVSLSSHYKTGERIPESLIDSLIKTKH 573

Query: 606 VNGALFALRQLHFGLFDMTVHTSKDVASLDLLKLWGDLRQEISLVENGGQYTKGYDSFGH 665
           VNGALF LRQLHFGLFDM VHT KD+ +L +   W  LRQEISL+ NGG  +KGYDSFGH
Sbjct: 574 VNGALFTLRQLHFGLFDMKVHTCKDLENLSICHTWNQLRQEISLMPNGGTLSKGYDSFGH 633

Query: 666 IMSDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSSVGMKYRDIVLANGGLYEIDDNLKE 725
           IMSDSYSAGYYGY+WAEVFATDMY TKFA +PL++  G++YRDIVLA GGLY+I+DNLKE
Sbjct: 634 IMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGVQYRDIVLARGGLYDINDNLKE 693

Query: 726 FLGREPSKDAFLKELGLQA 744
           FLGREPSKDAFLKELGLQ+
Sbjct: 694 FLGREPSKDAFLKELGLQS 712

>Smik_3.18 Chr3 (26213..28351) [2139 bp, 712 aa] {ON} YCL057W (REAL)
          Length = 712

 Score =  882 bits (2278), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/678 (62%), Positives = 530/678 (78%), Gaps = 6/678 (0%)

Query: 67  ALPRWEFPSAKIGEEATRIIESTNKFYDELVEISNPSIDNLVKPYMNHENSIGLMVNQLC 126
           A P W F    I  +   II+ +N FY+ +  +  P++ N V+P+M  EN +G ++NQL 
Sbjct: 39  APPNWTFTPNDINGKTKEIIDKSNNFYESMSNVETPTVTNFVEPFMKFENELGPIINQLT 98

Query: 127 FLQHVSSDKEIREASNKATELLQNFEIETSLRHDLFLQFDKIWKELKPRKEEFSHDEEQF 186
           FLQHVSSDKEIR+AS  ++  L    I+ SLRHD++LQF ++W++ + +      D  + 
Sbjct: 99  FLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHDIYLQFARVWQDAQSKS-----DSIER 153

Query: 187 EIYKFVEKCHKDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLGEQKEFLLFSKEQL 246
           E +K++EK +KD++ +GL L E +R K+KDIK KI+ NS+ FSKNLGEQKE++ F+KEQL
Sbjct: 154 ETFKYIEKSYKDYIHSGLELDESNRLKIKDIKKKISVNSINFSKNLGEQKEYITFTKEQL 213

Query: 247 DGVSDTVMEQFEQVK-DETTNETNYKVTFKYPDIFPVLKMAKNAETRKTAFCGDQNKVPQ 305
           +GV D+V+ QFE +K D+  NET YKVTFKYPDIFPV+K+A +A+TRK AF  DQNKVP+
Sbjct: 214 EGVPDSVLAQFETIKSDKDRNETLYKVTFKYPDIFPVMKLASSAQTRKEAFLADQNKVPE 273

Query: 306 NEELFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTVXXXXXXXXXXXXXXGEKEIG 365
           NE + + TL+LRD+LA+LLGYDTYANYNL  KMAK  +TV              G+KE+ 
Sbjct: 274 NEAILLDTLELRDKLASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKDKLIPLGKKELE 333

Query: 366 ILKSIKEAECKELGVPFDGRYYIWDHRYYDTKYLKDNFNVDHEAIAEYYPIDSTIEGMLK 425
           +L+ +K  + K+L    D  YYIWDHRYYD KYL +NFNVD E I+EY+P+++TI GML+
Sbjct: 334 LLQEMKSKDVKKLNQDEDPNYYIWDHRYYDNKYLLENFNVDLEKISEYFPLETTITGMLQ 393

Query: 426 IYETVFKLKFVEEKDTAKKNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLHPRDGKYGHA 485
           IYET+F LKF+E KD   K+VW++DVKQ+AVW MD+ K+P FVGWIYFDLHPRDGKYGHA
Sbjct: 394 IYETLFNLKFIEIKDGQSKSVWHDDVKQLAVWNMDDPKSPKFVGWIYFDLHPRDGKYGHA 453

Query: 486 ANFGIASSYIREDGSRSYPVTALVCNFSKSSATKPSLLKHNEITTFFHELGHGIHDLVGK 545
           ANFG++SS++  D  RSYPVTALVCNFSKS+  KPSLLKHNEI TFFHELGHGIHDLVG+
Sbjct: 454 ANFGLSSSFMTNDSVRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQ 513

Query: 546 NRAARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKHYKTGEQIPEKLLDSLIATKH 605
           N+ +RFNGPG+ PWDFVEAPSQMLEF+TW+KN L  LS HY+TGE+IPE L+DSLI TKH
Sbjct: 514 NKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELIDLSSHYETGEKIPESLIDSLIKTKH 573

Query: 606 VNGALFALRQLHFGLFDMTVHTSKDVASLDLLKLWGDLRQEISLVENGGQYTKGYDSFGH 665
           VNGALF LRQLHFGLFDM VHT KD+ +L + + W  LRQ+ISL+ NGG  +KGYDSFGH
Sbjct: 574 VNGALFTLRQLHFGLFDMKVHTCKDLQNLSICETWNQLRQDISLISNGGTLSKGYDSFGH 633

Query: 666 IMSDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSSVGMKYRDIVLANGGLYEIDDNLKE 725
           IMSDSYSAGYYGY+WAEVFATDMY TKFA +PL++  G++YRDIVLA GGL +I D+LK+
Sbjct: 634 IMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDIVLARGGLNDIGDDLKK 693

Query: 726 FLGREPSKDAFLKELGLQ 743
           FLGREPSKDAFLKELGLQ
Sbjct: 694 FLGREPSKDAFLKELGLQ 711

>Ecym_1011 Chr1 (19924..22074) [2151 bp, 716 aa] {ON} similar to
           Ashbya gossypii AGR406C/ AGR405C
          Length = 716

 Score =  820 bits (2118), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/682 (57%), Positives = 513/682 (75%), Gaps = 8/682 (1%)

Query: 61  LVPPAGALPRWEFPSAKIGEEATRIIESTNKFYDELVEISNPSIDNLVKPYMNHENSIGL 120
           L+ P  A P W+F + +I   A + I+   KFYD +  +  P ++N V   ++HE+    
Sbjct: 43  LLSPKLA-PSWDFAADEIVSLAQKAIDEGTKFYDSVASLETPDLENFVVAVIDHEDETDG 101

Query: 121 MVNQLCFLQHVSSDKEIREASNKATELLQNFEIETSLRHDLFLQFDKIWKELKPRKEEFS 180
            ++QL FLQHVS+DKE+R+AS +AT+L+Q + IETS R+DL+ QF K+W++ K  +    
Sbjct: 102 YMSQLTFLQHVSADKEVRDASIEATKLIQEWGIETSSRYDLYSQFSKVWEQYKDDENLKK 161

Query: 181 HDEEQFEIYKFVEKCHKDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLGEQKEFLL 240
           +D E   +Y ++E  +KD++ AG+ L EE RNK+K+IK K+A+NSL FS NLGEQ +++ 
Sbjct: 162 NDPE---LYWYMENVNKDYIHAGMGLPEESRNKIKEIKKKLANNSLAFSNNLGEQNDYIA 218

Query: 241 FSKEQLDGVSDTVMEQFEQVKDETTNETNYKVTFKYPDIFPVLKMAKNAETRKTAFCGDQ 300
           F+K++L GVS+T + QFE+V ++   +  YK+TFKYPDI PVL  AKN ETRK A+ GDQ
Sbjct: 219 FTKDELVGVSETTLGQFEKVIEDGVEK--YKMTFKYPDIHPVLNTAKNPETRKRAYIGDQ 276

Query: 301 NKVPQNEELFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTVXXXXXXXXXXXXXXG 360
           NKVPQNE++ + TLKLR+ELA + G+ TYA+Y LE+KMAKKQ TV              G
Sbjct: 277 NKVPQNEQILIETLKLRNELAEIHGHPTYASYQLEMKMAKKQETVFNFLYDLKDKLLPGG 336

Query: 361 EKEIGILKSIKEAECKELGVPFDGRYYIWDHRYYDTKYLKDNFNVDHEAIAEYYPIDSTI 420
           +K++  LKS+KE E KELG+P++G +  WD+RYYD KYLK+NF+VD E +A+Y+P+  TI
Sbjct: 337 KKDLENLKSLKEQEYKELGLPYNGSFNSWDYRYYDDKYLKENFDVDEEELAKYFPLQHTI 396

Query: 421 EGMLKIYETVFKLKFVEEKDTAKKNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLHPRDG 480
           +GML IY+ +F LKFVEE     KNVW+EDVKQ AVW +D    P FVGWIYFDLHPR+G
Sbjct: 397 DGMLNIYQKLFNLKFVEETRECGKNVWHEDVKQFAVWDLDKC-NPEFVGWIYFDLHPREG 455

Query: 481 KYGHAANFGIASSYIREDGSRSYPVTALVCNFSKSSATKPSLLKHNEITTFFHELGHGIH 540
           KYGHAANFG+ S Y+ E+G+R YPVT LVCNFSK S+T+P+LLKH E+ TFFHELGHGIH
Sbjct: 456 KYGHAANFGLYSPYVTEEGTRHYPVTVLVCNFSKPSSTRPALLKHGEVVTFFHELGHGIH 515

Query: 541 DLVGKNRAARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKHYKTGEQIPEKLLDSL 600
            LVGK+R    NGP + PWDFVEAPSQMLEF+ W+K+ +  LSKHY+TGEQIP++L+DSL
Sbjct: 516 ALVGKSRIGHLNGPSSIPWDFVEAPSQMLEFWPWNKDQILKLSKHYETGEQIPDELVDSL 575

Query: 601 IATKHVNGALFALRQLHFGLFDMTVHTSKDVASLDLLKLWGDLRQEISLVENGGQYTKGY 660
           I TKHVN  L  LRQLHF LFDMTVHT K++  LD+  LW +LR+E++L+ NG   TKGY
Sbjct: 576 IKTKHVNAGLSNLRQLHFSLFDMTVHTDKELDKLDIKSLWNNLREEVTLISNGDVLTKGY 635

Query: 661 DSFGHIMSDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSSVGMKYRDIVLANGGLYEID 720
           DSF HIMS  YSAGYYGYMW+EVFA DMY T FAPNPLD+SVG +YRDI+LA GGL +I+
Sbjct: 636 DSFSHIMS-GYSAGYYGYMWSEVFAADMYHTMFAPNPLDTSVGTRYRDIILAKGGLRDIE 694

Query: 721 DNLKEFLGREPSKDAFLKELGL 742
           D+L+EFLGREP+  AFLKELGL
Sbjct: 695 DSLEEFLGREPNNKAFLKELGL 716

>AGR406C Chr7 complement(1472496..1474547) [2052 bp, 683 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); Tandem gene duplication in this genome
          Length = 683

 Score =  678 bits (1750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/684 (50%), Positives = 473/684 (69%), Gaps = 8/684 (1%)

Query: 61  LVPPAGALPRWEFPSAKIGEEATRIIESTNKFYDELVEISNPSIDNLVKPYMNHENSIGL 120
           LVPP  A P W F +  +   + ++I  T   Y  +++   P+IDN + P + HE    L
Sbjct: 7   LVPPQAA-PSWNFSAQDVISLSHQLINQTEAVYHNVLQEKPPTIDNYIMPLIYHEEETDL 65

Query: 121 MVNQLCFLQHVSSDKEIREASNKATELLQNFEIETSLRHDLFLQFDKIWKELKPRKEEFS 180
           + NQL FL++VS D EIREAS  AT +L ++ I  + ++DL+  FD++W + K   E+F 
Sbjct: 66  LWNQLVFLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQYK-DDEKFK 124

Query: 181 HDEEQFEIYKFVEKCHKDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLGEQKEFLL 240
             +E FE+Y+++EK    + R+G+ +  E+R ++ ++K KIA+  LEFS NLGE+ E++ 
Sbjct: 125 --KENFELYRYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGEEVEYIA 182

Query: 241 FSKEQLDGVSDTVMEQFEQVKDETTNETNYKVTFKYPDIFPVLKMAKNAETRKTAFCGDQ 300
           F+KE+L+GV DTV+ QFE++ +    +  +KVTFKYPDI PVL++A N ETR+ A   D+
Sbjct: 183 FTKEELEGVPDTVLNQFEKIIEGGVEK--FKVTFKYPDIGPVLRLASNPETRRRASMADE 240

Query: 301 NKVPQNEELFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTVXXXXXXXXXXXXXXG 360
           N+V  NE L   TL+LR ELA LLG+  +A YNL+ KMAK + TV              G
Sbjct: 241 NRVAANEPLLFETLELRRELADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPVG 300

Query: 361 EKEIGILKSIKEAECKELGVPFDGRYYIWDHRYYDTKYLKDNFNVDHEAIAEYYPIDSTI 420
           + ++ ILK  K  + K   + FDG +Y WD  YY  K L++ +NV+ + +A+Y+P++S I
Sbjct: 301 KNDLEILKKKKAEDYKSKNLTFDGEFYSWDTGYYTNKILRERYNVNPDDLAQYFPVESAI 360

Query: 421 EGMLKIYETVFKLKFVEEKDTAKKNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLHPRDG 480
           EGML IY T+F+LKFVE  D  +K+VW+EDVKQ AVW +D+   P F GW+YFDLHPRDG
Sbjct: 361 EGMLNIYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLHPRDG 420

Query: 481 KYGHAANFGIASSYIREDGSRSYPVTALVCNFSKSSATKPSLLKHNEITTFFHELGHGIH 540
           KYGHAANFG+ S+Y + DGS+SYPVT LV NFSK + T+P+LLK  E+TTFFHELGHGIH
Sbjct: 421 KYGHAANFGMVSAYRKRDGSKSYPVTILVTNFSKPTPTRPALLKLGELTTFFHELGHGIH 480

Query: 541 DLVGKNRAARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKHYKTGEQIPEKLLDSL 600
           DLVG N     NGPG+ PWDFVEAPSQMLE++T  ++ L  LSKHY+TGE+IP+ LLD+ 
Sbjct: 481 DLVGSNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTMLSKHYETGEKIPKSLLDAW 540

Query: 601 IATKHVNGALFALRQLHFGLFDMTVHTSKDVASLDLLKLWGDLRQEISLVENGGQYTKGY 660
            +   +N  L  L QL  GLFDM VHT +D    ++ KLW DL +EI L+      + GY
Sbjct: 541 FSVGGLNSGLANLGQLKLGLFDMYVHT-RDYKGAEVRKLWNDLTREIGLMNLKNYTSTGY 599

Query: 661 DSFGHIMSDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSSVGMKYRDIVLANGGLYEID 720
           DSFGHIM+  Y+AGYYGY+W++VFA DMY TKF PNP +++VG++YRD +LA GGLY++ 
Sbjct: 600 DSFGHIMA-GYAAGYYGYLWSQVFAADMYDTKFKPNPFNATVGVEYRDTILATGGLYDMT 658

Query: 721 DNLKEFLGREPSKDAFLKELGLQA 744
           DNL++FLGR+P+  AFL+ LGL+A
Sbjct: 659 DNLRKFLGRDPNNKAFLRGLGLKA 682

>AGR405C Chr7 complement(1469769..1471922) [2154 bp, 717 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); Tandem gene duplication in this genome
          Length = 717

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/685 (47%), Positives = 460/685 (67%), Gaps = 8/685 (1%)

Query: 61  LVPPAGALPRWEFPSAKIGEEATRIIESTNKFYDELVEISNP-SIDNLVKPYMNHENSIG 119
           LVPP    P W + + ++ + A  + + ++  Y+ +    +  ++DN + P + ++    
Sbjct: 12  LVPPQPP-PVWNYTATEVIDLAYGLAQKSDAVYESVFSQKDEFTLDNYIWPLLYNDQETD 70

Query: 120 LMVNQLCFLQHVSSDKEIREASNKATELLQNFEIETSLRHDLFLQFDKIWKELKPRKEEF 179
           L+ NQL FL++VS D ++REAS    ++L  +    S ++DL+  F+ IW + K   EEF
Sbjct: 71  LLWNQLIFLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIWTQYKD-DEEF 129

Query: 180 SHDEEQFEIYKFVEKCHKDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLGEQKEFL 239
                 +E+YK++EK    + R   NL+  +  ++  +  KI+ ++L+FS NLGE+ E++
Sbjct: 130 K--VTNYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINLGEETEYI 187

Query: 240 LFSKEQLDGVSDTVMEQFEQVKDETTNETNYKVTFKYPDIFPVLKMAKNAETRKTAFCGD 299
            F++E+L+GVS  V++QFE++ +    +   KVTFKYPDI PVL+ A N ETR+ A+  D
Sbjct: 188 TFTEEELEGVSPLVLDQFERIIEGGVKKL--KVTFKYPDIGPVLRTATNPETRRKAYVAD 245

Query: 300 QNKVPQNEELFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTVXXXXXXXXXXXXXX 359
           QN+V  NE+L   TL LR  +A L GY  YA YNL  KMAK + TV              
Sbjct: 246 QNRVAANEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPV 305

Query: 360 GEKEIGILKSIKEAECKELGVPFDGRYYIWDHRYYDTKYLKDNFNVDHEAIAEYYPIDST 419
           GEK+  ILKS K  + K   + FDG  Y WD+ YY+ K L++ + +D E +A+Y+PI+S 
Sbjct: 306 GEKDREILKSKKAEDYKSKNLTFDGEIYAWDNAYYNNKILQEKYQIDPEDMAQYFPIESV 365

Query: 420 IEGMLKIYETVFKLKFVEEKDTAKKNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLHPRD 479
           IEGML  Y+T+F+LKFVE  D ++KNVW+EDVKQ AVW +D+   P F GWIYFDL+PRD
Sbjct: 366 IEGMLDTYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYFDLYPRD 425

Query: 480 GKYGHAANFGIASSYIREDGSRSYPVTALVCNFSKSSATKPSLLKHNEITTFFHELGHGI 539
           GKY HAANFG+AS++ ++DGS+SYPVT LVCN +K + T+ ++L+  EITT FHELGHGI
Sbjct: 426 GKYSHAANFGMASAFRKKDGSQSYPVTVLVCNLTKPTPTRTAILRPGEITTLFHELGHGI 485

Query: 540 HDLVGKNRAARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKHYKTGEQIPEKLLDS 599
           H LV  N+ A  N  G+ PWDFVEAPSQMLE++T  ++ L  LSKHY+TGE+IP  LLD+
Sbjct: 486 HHLVANNKLAAHNSLGSVPWDFVEAPSQMLEYWTGRRDVLTMLSKHYETGEKIPPSLLDA 545

Query: 600 LIATKHVNGALFALRQLHFGLFDMTVHTSKDVASLDLLKLWGDLRQEISLVENGGQYTKG 659
              +  +   L+ L QL  GLFDM VHT ++   L++ KLW D+R+EISL+ +    + G
Sbjct: 546 WFNSSGLGSGLYYLGQLRLGLFDMYVHT-REYHGLEVRKLWNDMRREISLINSQNYTSTG 604

Query: 660 YDSFGHIMSDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSSVGMKYRDIVLANGGLYEI 719
           Y++FGHIM+ SYSAGYYGY+W++VFA DMY+TKF  NP +S+VG +YRD +LA GGLY++
Sbjct: 605 YNTFGHIMTGSYSAGYYGYLWSQVFAADMYQTKFKSNPFNSTVGRQYRDTILAPGGLYDM 664

Query: 720 DDNLKEFLGREPSKDAFLKELGLQA 744
           +DNL++FLGREP+  AFL+ LG  A
Sbjct: 665 NDNLRKFLGREPNNRAFLRGLGFNA 689

>ABR185W Chr2
           (758126..758380,758380..758709,758709..759029,
           759033..759122,759122..759499) [1374 bp, 457 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); 3-intron; artificial frameshift
          Length = 457

 Score =  384 bits (985), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 200/416 (48%), Positives = 266/416 (63%), Gaps = 11/416 (2%)

Query: 330 ANYNLEIKMAKKQSTVXXXXXXXXXXXXXXGEKEIGILKSIKEAECKELGVPFDGRYYIW 389
           A Y LE+K AK    V                     LK +KE ECKELG  +DG  Y  
Sbjct: 49  AAYVLEVKTAKNVDNVNSFLNDLREKLKPASADNWRPLKKLKEQECKELGNFYDGELYSQ 108

Query: 390 DHRYYDTKYLKDNFNVDHEAIAEYYPIDSTIEGMLKIYETVFKLKFVEEKDTAKKNVWNE 449
           D  YY+ K L+DNF+VD E  A+Y+P++ TI+ ML  Y T+F+  FVEE + A +NVW+E
Sbjct: 109 DLCYYEQKLLRDNFSVDEEETAQYFPLEHTIKFMLDTYNTLFRHNFVEETEPATRNVWHE 168

Query: 450 DVKQIAVWKMDNVKTPVFVGWIYFDLHPRDGKYGHAANFGIASSYIREDGSRSYPVTALV 509
           D KQ +VWKMD+   P F GW+YFDLHPRDGK+GH A F    + + E+GSR YPVT+LV
Sbjct: 169 DDKQYSVWKMDDWDAPQFTGWLYFDLHPRDGKFGHLACFDNVYTDMSEEGSRVYPVTSLV 228

Query: 510 CNFSKSSATKPSLLKHNEITTFFHELGHGIHDLVGKNRAARFNGPGATPWDFVEAPSQML 569
           CNFS  S  KP+LLKH E+  FFHELGHG H L+              P DF+EAPSQML
Sbjct: 229 CNFSNPSKEKPALLKHYEVQAFFHELGHGSHKLLCAPELC--CSSSWVPRDFIEAPSQML 286

Query: 570 EFYTWDKNALQSLSKHYKTGEQIPEKLLDSLIATKHVNGALFALRQLHFGLFDMTVHTSK 629
           E++ W K+ +  LSKH +TGE+IPE L+D ++ +K  N A+  L Q+   L DM VH  K
Sbjct: 287 EYWIWRKDVITDLSKH-ETGERIPESLVDCMVKSKRANAAIDNLIQV-LALLDMAVH--K 342

Query: 630 DVAS---LDLLKLWGDLRQEISLVENGGQYTKGYDSFGHIMSDSYSAGYYGYMWAEVFAT 686
            V S   LDL  LW +L +++ L++N  + T+ Y SF HI+ + Y+AGYYGY W++VFA 
Sbjct: 343 HVGSYETLDLNALWNNLCEDVILIKN-PEPTRAYCSFSHIV-EGYAAGYYGYQWSKVFAA 400

Query: 687 DMYRTKFAPNPLDSSVGMKYRDIVLANGGLYEIDDNLKEFLGREPSKDAFLKELGL 742
           DMY ++F    LD ++G  Y D ++A GGLYE++DNL EFL REP+ +A+L++ GL
Sbjct: 401 DMYFSRFEKAHLDPTLGKLYGDTIIARGGLYEMEDNLGEFLDREPNNEAYLRDQGL 456

>NDAI0E02010 Chr5 complement(404579..406915) [2337 bp, 778 aa] {ON}
           Anc_1.9 YCL057W
          Length = 778

 Score =  186 bits (471), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 145/564 (25%), Positives = 254/564 (45%), Gaps = 67/564 (11%)

Query: 197 KDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLGE-QKEFLLFSKEQLDGVSDTVME 255
           +DF+++G+ +    +++   +   I+    E+  N+ +  +  +   + +LD        
Sbjct: 209 QDFIKSGIYMDSGKKDQFITLSQDISVIGQEYINNINQLARNHIKVKRSELDNAG----- 263

Query: 256 QFEQVKDETTNETNYKVTFKYPDI-------FPVLKMAKNAETRKTAFCGDQNKVPQNEE 308
               ++ +   +    +T KY  I       F +LK   + E RK  +    +   Q  E
Sbjct: 264 ----IEFDVACQLGKDITGKYYKIPTYGHLPFLILKACTDPEIRKKIWVAMHDCSKQQIE 319

Query: 309 LFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTVXXXXXXXXXXXXXXGEKEIGILK 368
                +K+R  LA  +G + YA Y ++ KMAK    V                KE+  + 
Sbjct: 320 RLTNLVKIRAFLAHTMGRECYAAYAIDGKMAKNPKDVDEFLKSLMDFLKPKAAKELKFIS 379

Query: 369 SIKEAECKE-----------LGVPFDGRYYIWDHRYYDTKYLKDNFNVDHEAIAEYYPID 417
            +   E  E              P+D  YY   HR      L D++ +D      YYP+ 
Sbjct: 380 DLIHNEKGEKPSDDVDEILTAVRPWDREYYTAIHRNKQKHLLLDDYALD-----VYYPLG 434

Query: 418 STIEGMLKIYETVFKLKFVEEKDTAKKNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLHP 477
           + I+G+  I+E+++ ++F E     K   W+ DV+++ V      +    +G IY DL  
Sbjct: 435 NVIQGLSDIFESIYGIRF-EPAVAGKGETWSSDVRRLNVVS----EKEGLIGIIYCDLFR 489

Query: 478 RDGKYGHAANFGIASS---YIRED------------GSR-SYPVTALVCNFSK---SSAT 518
           R GK  +AA+F I  S   Y  ED            G++   P+ +L+CNF+    +S  
Sbjct: 490 RQGKTNNAAHFTICCSRQIYPHEDDFSTIQLGTNVDGTKFQLPIISLLCNFNTRCLNSGE 549

Query: 519 KPSLLKHNEITTFFHELGHGIHDLVGKNRAARFNGPGATPWDFVEAPSQMLEFYTWDKNA 578
              LL  NEI T FHE+GH IH ++G+ R    +G   +  DFVE PS ++E +  D   
Sbjct: 550 TICLLALNEIETLFHEMGHAIHSMLGRTRLQNVSGTRCST-DFVELPSVLMEHFARDTRV 608

Query: 579 LQSLSKHYKTGEQIPEKLLDSLIATKHVNGALFALRQLHFGLFDMTVHTS---KDVASLD 635
           L+ +  HYKTG+++P  LL+  +             Q    + D  ++     +++ S+D
Sbjct: 609 LKRIGHHYKTGDRVPATLLNRYLEKARFLKDCETFSQAKMAMLDQRLYDKNIVQNIDSVD 668

Query: 636 LLKLWGDLRQEIS-LVENGGQYTKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYRTKFA 694
           ++K++ +L +E+  LV++   +      FGH+    Y A YY Y++    A+ +++  F 
Sbjct: 669 VVKIYHELEKELEVLVDDESNWCA---KFGHLF--GYGATYYCYLFDRAIASKVWKKLFE 723

Query: 695 PNPLDSSVGMKYRDIVLANGGLYE 718
            +P   S G K+++ VL  GGL E
Sbjct: 724 KDPYSRSGGEKFKNDVLKWGGLRE 747

>KNAG0A06200 Chr1 complement(937577..939946) [2370 bp, 789 aa] {ON}
           Anc_2.432 YKL134C
          Length = 789

 Score =  186 bits (471), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 144/555 (25%), Positives = 261/555 (47%), Gaps = 54/555 (9%)

Query: 197 KDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLG-EQKEFLLFSKEQLD--GVSDTV 253
           +DF ++G+ +S + R++  ++   I+    +F  N    + EF+  + E+LD  GVS  +
Sbjct: 221 EDFEKSGIYMSTDTRDRFIEMSQDISLVGQDFINNTNWLRSEFIEIASEELDNSGVSPIL 280

Query: 254 MEQFEQVKDETTNETNYKVTFKYPDIFPVLKMAKNAETRKTAFCGDQNKVPQNEELFVAT 313
           + Q       T   T+YKV       + +L+  KN   RK  +    +   +        
Sbjct: 281 LRQLTT----TVRGTHYKVPAYGTAPYIILRSCKNENARKAVWTALHSCPDKQINRLTHM 336

Query: 314 LKLRDELATLLGYDTYANYNLEIKMAKKQSTVXXXXXXXXXXXXXXGEKEIGILKSIK-- 371
           +K+R  L+ ++G   +A Y L+ KMAK    V                +E+ +L ++K  
Sbjct: 337 VKMRSVLSNIMGKVGFAVYQLQGKMAKSPENVLNFITRLMEHTKPMAAEELKLLANMKLN 396

Query: 372 ---------EAECKELGVPFDGRYYIWDHRYYDTKYLKDNFNVDHEAIAEYYPIDSTIEG 422
                    E E  E   P+D  YY+   +   T+  K+    +HE I  Y+ + S +EG
Sbjct: 397 DLGLPEANSEKEILETVRPWDRDYYV--AKSQQTRKAKNQL-TNHEPINAYFTLGSVLEG 453

Query: 423 MLKIYETVFKLKFVEEKDTAKKNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLHPRDGKY 482
           +  ++++++ +  +E   +     W+ +V+++ V   +N      +G +Y DL  R  K 
Sbjct: 454 LSNLFKSIYGIS-LEVVASIPGETWSSEVRRVNVKTENNN----IIGVVYCDLFERKAKT 508

Query: 483 GHAANFGIASSY----------IREDGSRS------YPVTALVCNFSKSSATKPSLLKHN 526
              A+F +  S           I + G  S       P+ +LVCNF+++S  +  LL+ +
Sbjct: 509 SSPAHFTVCCSRELYAEENDPSILQSGVNSRGEKFQLPIISLVCNFARTSDNELCLLQLS 568

Query: 527 EITTFFHELGHGIHDLVGKNRAARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKHY 586
           EI T FHE+GH +H ++G+ +    +G   T  DFVE PS ++E +  D   L+ + +HY
Sbjct: 569 EIETLFHEMGHAMHSMLGQTKLQNISGTRCTT-DFVELPSIIMEHFARDPRVLKGIGRHY 627

Query: 587 KTGEQIPEKLL-DSLIATKHV-NGALFALRQLHFGLFDMTVHTSK---DVASLDLLKLWG 641
            T E++PE LL + L +T+++ N   FA  Q    + D  ++ +     V  LD+++L+ 
Sbjct: 628 ITKEKVPEDLLAEELNSTRYLQNCETFA--QAKMAMLDQRLYDNNIIFHVRDLDVVELYH 685

Query: 642 DLRQEISLVENGGQYTKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSS 701
           DL + + ++ +    T     FGH+    Y A YY Y+     A  ++   F  +P   +
Sbjct: 686 DLERNLEVLVD--DQTNWCGKFGHLF--GYGATYYSYLLDRAIAAKIWDCLFVNDPFSRT 741

Query: 702 VGMKYRDIVLANGGL 716
            G  +++ VL  GGL
Sbjct: 742 GGENFKNAVLKWGGL 756

>KAFR0D02950 Chr4 complement(581305..583638) [2334 bp, 777 aa] {ON}
           Anc_2.432 YKL134C
          Length = 777

 Score =  181 bits (458), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 166/630 (26%), Positives = 286/630 (45%), Gaps = 59/630 (9%)

Query: 122 VNQLC-FLQHVSSDKEIREASNKATELLQNFEIETSLRHDLFLQFDKIWKELKPRKEEFS 180
           V  LC F++ V  DKE   A+ +  E  + FE   +L  D+ L  DK+   L   +    
Sbjct: 137 VIDLCEFIRSVHPDKEFLSAAQQCHE--EMFEFMNTLNTDVEL-CDKLKTLLHDNEILSK 193

Query: 181 HDEEQFEIYKFVEKCHKDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLGEQKEFLL 240
             EE+ ++ + +    +DF ++G+ ++   R +  ++  +I+    +F  N  + K   +
Sbjct: 194 LSEEEIKVGRIL---LEDFEKSGIYMNPRIREQFIELSQEISLIGQDFINNANQPKTNYI 250

Query: 241 ---FSKEQLDGVSDTVMEQFEQVKDETTNETNYKVTFKYPDIFPVLKMAKNAETRKTAFC 297
               SK +  G++  ++     +K +   E NYK+    P  + VLK  KN E R   + 
Sbjct: 251 KVNASKLESAGLNRLLLNS---LKKDAIRE-NYKIPTYGPTPYAVLKDCKNEEVRADIWT 306

Query: 298 GDQNKVPQNEELFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTVXXXXXXXXXXXX 357
              +   +        +KLR  LA L+G ++++ Y L+ K+AK    V            
Sbjct: 307 ALHSCSSEQILRLSHLVKLRAMLANLMGAESFSQYQLKGKLAKAPKDVKNFIETLIKYVR 366

Query: 358 XXGEKEIGILKSIKEAE-----CKEL-GVPFDGRYYIWDHRYYDTKYLKDNFNVDHE--- 408
              EKE+  +  +K  +     C E+ GV    R   WD  YY + Y K     +HE   
Sbjct: 367 PNTEKELKFIADLKREDQGKINCGEMDGVLSTVR--PWDRDYYSSIYFKGKEKTEHEFTE 424

Query: 409 AIAEYYPIDSTIEGMLKIYETVFKLKFVEEKDTAKKNVWNEDVKQIAVWKMDNVKTPVFV 468
            ++ Y+ +    EG+  +   ++ +K +E         W  DV++I V   +       +
Sbjct: 425 PLSSYFTLGGVFEGLSDLLTQIYGIK-LEPAIPVSGETWFNDVRKINVISEEEG----II 479

Query: 469 GWIYFDLHPRDGKYGHAANFGIASSY----------IREDGSR------SYPVTALVCNF 512
           G IYFDL  R GK  + A+F +  S           I + GS+        P+ +LVCNF
Sbjct: 480 GIIYFDLFERYGKTSNPAHFTVCCSREMYPEENADSIIQLGSKKDGTIFQLPIISLVCNF 539

Query: 513 SK---SSATKPSLLKHNEITTFFHELGHGIHDLVGKNRAARFNGPGATPWDFVEAPSQML 569
           S+    S     LL  +EI T FHE+GH IH ++G+      +G      DFVE PS ++
Sbjct: 540 SRRTFQSDKTICLLTLSEIETLFHEMGHAIHSMLGRTTLQNVSGTRCAT-DFVELPSILM 598

Query: 570 EFYTWDKNALQSLSKHYKTGEQIPEKLLDSLIATKHVNGALFALRQLHFGLFDMTVHTSK 629
           E +  D   L+ +S HY+TGE+I EK L   +       +     Q    + D  +H+ K
Sbjct: 599 EHFASDTRVLKKMSCHYETGEKIAEKKLQFHLKEGEFLRSCETFSQAKMAMLDQELHSDK 658

Query: 630 DVASLD---LLKLWGDLRQEIS-LVENGGQYTKGYDSFGHIMSDSYSAGYYGYMWAEVFA 685
            + +LD   +++++ +L + +  LV++   +      FGH+    Y A YY Y++    A
Sbjct: 659 IIHNLDNLNVVEIYQNLERRLQVLVDDRSNWC---GKFGHLF--GYGATYYSYLFDRAIA 713

Query: 686 TDMYRTKFAPNPLDSSVGMKYRDIVLANGG 715
             ++   FA +P + + G K+++ +L  GG
Sbjct: 714 RKVWNHLFANDPFNKTNGEKFKESLLKWGG 743

>Kpol_297.8 s297 complement(11648..14011) [2364 bp, 787 aa] {ON}
           complement(11648..14011) [2364 nt, 788 aa]
          Length = 787

 Score =  177 bits (448), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 181/673 (26%), Positives = 296/673 (43%), Gaps = 73/673 (10%)

Query: 86  IESTNKFYDELVEISNPSIDNLVKPYMNHENSIGLMVNQLC-FLQHVSSDKEIREASNKA 144
           +E + K  D+L     P    L    ++  +     V  LC F++    D +  EA+   
Sbjct: 111 LEKSQKIVDKLRSDRTPEGLRLYVQNLDLLSDTLCRVIDLCEFIRSSHPDYKFVEAAQDC 170

Query: 145 TELLQNFEIETSLRHDLFLQFDKIWKELKPRKEEFSH-DEEQFEIYKFVEKCHKDFVRAG 203
            E  + FE    L  D+ L F    K +   KE  S   EE+  + + +    +DF ++G
Sbjct: 171 YE--EMFEFMNMLNTDVNLCF--TLKHVLENKEIASKLSEEELRVGRIL---LEDFEKSG 223

Query: 204 LNLSEEDRNKVKDIKIKIASNSLEFSKNLGEQKEF-LLFSKEQLD--GVSDTVMEQFEQV 260
           + +  E R +   +   I+    EF  N    K+  ++ S  QLD  G+   ++ Q E+ 
Sbjct: 224 IYMKPEVREQFITLSQSISVIGQEFISNTDFVKDNNVVVSCNQLDSLGIDPELLSQIEK- 282

Query: 261 KDETTNETNYKV-TFKYPDIFPVLKMAKNAETRKTAFCGDQNKVPQNEELFVATLKLRDE 319
                   NYK+ T+ Y   F +LK   + E R+  +    N   +  +     +KLR  
Sbjct: 283 ---DIAGKNYKIPTYGYIP-FALLKSCPSEEIREKIWVAVHNCSNEQIKRLTDLVKLRAV 338

Query: 320 LATLLGYDTYANYNLEIKMAKKQSTVXXXXXXXXXXXXXXGEKEIGILKSIKEAECKELG 379
           L+ LLG  +YA Y LE KMAK    V                KE   L  I E   K+L 
Sbjct: 339 LSQLLGKKSYAEYQLEGKMAKNPKEVIEFIKTLMDFTKPMAAKE---LDGIAE---KKLT 392

Query: 380 VPFDGR----------YYIWDHRYYDTKYLKDNFNVD---HEAIAEYYPIDSTIEGMLKI 426
           +  +G              WD  YY     +     +    E + +Y+ + + ++G+  +
Sbjct: 393 IKSNGSNLSVCDILKTVRPWDRDYYSAIEREQTSAKNLYGSEEVLKYFTLGNVMQGLSNL 452

Query: 427 YETVFKLKFVEEKDTAK-KNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLHPRDGKYGHA 485
           ++ ++ +K   E D  K    W+ +V++I V   D       +G IY DL  R GK  +A
Sbjct: 453 FQKIYGIKL--ELDVPKIGETWSPEVRKINVISEDEG----LIGIIYCDLFERSGKTSNA 506

Query: 486 ANFGIASS-----YIRED----------GSR-SYPVTALVCNFSKSSATKP---SLLKHN 526
           A+F I  S     Y  ED          G+R   P+ +LVCNFSK+  ++      L   
Sbjct: 507 AHFTICCSRDISPYETEDSTTQIAIDSKGTRFQLPIISLVCNFSKTMISETDSVCFLHLP 566

Query: 527 EITTFFHELGHGIHDLVGKNRAARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKHY 586
           E+ T FHE+GH +H ++G+ +    +G      DFVE PS ++E++  D   L+++ KHY
Sbjct: 567 EVETLFHEMGHAMHSMLGRTKLQNISGTRCAT-DFVELPSILMEYFARDPRVLETIGKHY 625

Query: 587 KTGEQIPEKLLDSLIATKHVNGALFALRQLHFGLFDMTVH---TSKDVASLDLLKLWGDL 643
            T E +  ++L+  +             Q    + D T+H    S  +  LD++KL+ DL
Sbjct: 626 LTKETVKREMLEPHLQDLKYLQHCETYSQAKMAMLDQTLHGETISSHLDHLDVVKLYQDL 685

Query: 644 RQEIS-LVENGGQYTKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSSV 702
            +++  LV++   +      FGH+    YSA YY Y++    A+ ++   F  NP   + 
Sbjct: 686 ERQLGVLVDDKSNWC---GKFGHLF--GYSAVYYSYLFDRAIASKIWGALFERNPFSRAS 740

Query: 703 GMKYRDIVLANGG 715
           G KYR+ VL  GG
Sbjct: 741 GDKYRNSVLQWGG 753

>SAKL0E03938g Chr5 (317017..319320) [2304 bp, 767 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 767

 Score =  170 bits (431), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 165/670 (24%), Positives = 298/670 (44%), Gaps = 80/670 (11%)

Query: 94  DELVEISNPSIDNLVKPYMNHENSIGLMVNQLC-------FLQHVSSDKEIREASNKATE 146
           +ELVE      D   K Y N+  ++  + + LC       F++    D    +A+    E
Sbjct: 96  NELVETMRH--DRSPKGYANYIANLDRLSDILCRVIDLAEFIRASHPDPHFVQAAQDCHE 153

Query: 147 LLQNFEIETSLRHDL--------FLQFDKIWKELKPRKEEFSHDEEQFEIYKFVEKCHKD 198
             + FEI   L  D+         L    I  EL P         E+ ++ K + +   D
Sbjct: 154 --EMFEIMNVLNTDVALCDILKHVLTDPTILSELSP---------EEIKVGKILLE---D 199

Query: 199 FVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLG-EQKEFLLFSKEQLD--GVSDTVME 255
           F ++G++++ E R +   +  +I+    +F  N    +  ++    E+L+  G++  V+ 
Sbjct: 200 FEKSGIHMNPEVREQFIALSQQISVVGQDFINNTEYVRSNYIKVEVEELNKSGINKIVLN 259

Query: 256 QFEQVKDETTNETNYKV-TFKYPDIFPVLKMAKNAETRKTAFCGDQNKVPQNEELFVATL 314
           Q    KD      +YK+ TF Y   + +L+   +   R   +    +   +        +
Sbjct: 260 QLS--KD--IKGRHYKIPTFGYIP-YSILRSCPDDNIRMKVWSALHSCSEKQIARLDQLI 314

Query: 315 KLRDELATLLGYDTYANYNLEIKMAKKQSTVXXXXXXXXXXXXXXGEKEIGILKSIKEAE 374
           KLR  LA ++G  ++A+Y LE KMAK    V                +E+  +  +K A+
Sbjct: 315 KLRSVLANIMGKKSFAHYQLEGKMAKTPEYVRGFMQSLIDATKPKAAEELKFIADLK-AK 373

Query: 375 CKELGVPFDGRYYI------WDHRYYDTKY-LKDNFNVDHEAIAEYYPIDSTIEGMLKIY 427
                 P +  + I      WD  +Y + + L+     ++E I+ Y+ +   I+G+  ++
Sbjct: 374 HVPGNKPAESMHEILEMVKPWDRDFYGSVHALQQRRPFNNEQISSYFSLGVVIQGLSNLF 433

Query: 428 ETVFKLKFVEEKDTAKKNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLHPRDGKYGHAAN 487
           + ++ + ++E         W+ +V++I V      +    +G +Y DL  R GK  + A+
Sbjct: 434 KQIYGI-YLEPVVPKTGETWSPEVRRINVVS----EKEGVIGVVYCDLFERQGKTANPAH 488

Query: 488 FGIASSYIREDGSR----------------SYPVTALVCNFSKSSATKP---SLLKHNEI 528
           F +  S    DG                    PV +LVCNFS ++ ++     LL+ +EI
Sbjct: 489 FTVCCSRQIYDGETDLSTIQVGQNSKGEQFQLPVISLVCNFSPTTISQEQSICLLQLSEI 548

Query: 529 TTFFHELGHGIHDLVGKNRAARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKHYKT 588
            T FHE+GH +H ++G+ +    +G      DFVE PS ++E +  D   LQ ++ HY T
Sbjct: 549 ETLFHEMGHAMHSMLGRTKLQNISGTRCAT-DFVELPSILMEHFARDHRVLQRMASHYST 607

Query: 589 GEQIPEKLLDSLIATKHVNGALFALRQLHFGLFDMTVH---TSKDVASLDLLKLWGDLRQ 645
           GE IPE+LL S  +         A  Q    + D  +H     K++  LD++KL+ +L +
Sbjct: 608 GESIPEQLLFSYQSEVKFLQHAEAFSQAKMAILDQELHGESIMKEMQYLDIVKLYHNLER 667

Query: 646 EISLVENGGQYTKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSSVGMK 705
           ++ ++ +      G   FGH+    Y A YY Y++    A+ +++  FA +P     G K
Sbjct: 668 QLEVLSDDKSNWCG--RFGHLF--GYGATYYSYLFDRAIASKIWQHLFANDPFCRRSGEK 723

Query: 706 YRDIVLANGG 715
           +++ VL  GG
Sbjct: 724 FKNSVLKWGG 733

>ZYRO0G20130g Chr7 (1666665..1669025) [2361 bp, 786 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 786

 Score =  166 bits (419), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 138/560 (24%), Positives = 256/560 (45%), Gaps = 63/560 (11%)

Query: 197 KDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLG-EQKEFLLFSKEQL--DGVSDTV 253
           +DF ++G+ ++ E R +   +  +I+    +F  N    +  ++    E +   G++  +
Sbjct: 215 EDFEKSGIYMNPEIREQFIALSQEISIVGQDFINNTDFVRTNYITVDCETIHNSGINQLI 274

Query: 254 MEQFEQVKDETTNETNYKVTFKYPDIFPVLKMAKNAETRK---TAF--CGDQNKVPQNEE 308
           + Q    KD      +YK+       + VL+   +   RK   TA   C D+  V  ++ 
Sbjct: 275 LSQLS--KD--IKGKHYKIPTHGYIAYSVLRACPDEIVRKKLWTAMHSCPDKQIVRLDQ- 329

Query: 309 LFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTVXXXXXXXXXXXXXXGEKEIGILK 368
                ++LR  LA L+G  +YA Y LE KMAK    V               ++E+G + 
Sbjct: 330 ----LVRLRAVLAFLMGKKSYAEYQLEGKMAKSPEEVTDFIDSLIKVTQPKAKQELGFIS 385

Query: 369 SIKEAECKELGVP------FDGRYYI--WDHRYYDTKY---LKDNFNVDHEAIAEYYPID 417
            +K    K + +P       D    +  WD  +Y T Y    +    +D + I+ Y+ + 
Sbjct: 386 DLKR---KHMDLPPSETSNLDTLDIVRPWDRDFYHTIYSIQQRRQSPIDDQQISMYFTLG 442

Query: 418 STIEGMLKIYETVFKLKFVEEKDTAKKNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLHP 477
           + ++G+  ++  ++ ++ +E     K   W+ +V+++ V   +       +G +Y DL  
Sbjct: 443 NVMQGLSDLFHQIYGIR-LEPVIAQKGETWSPEVRRLNVVSDEEG----VIGVVYCDLFE 497

Query: 478 RDGKYGHAANFGIASS---YIRE------------DGSR-SYPVTALVCNFSKSSAT--- 518
           RDGK  + ++F +  S   Y +E            DG++   P+ +LVCNF+ S  +   
Sbjct: 498 RDGKTSNPSHFTVCCSRQIYPKENDLSTIQIGTNKDGTKFQLPIISLVCNFASSVVSFGQ 557

Query: 519 KPSLLKHNEITTFFHELGHGIHDLVGKNRAARFNGPGATPWDFVEAPSQMLEFYTWDKNA 578
              LL  +EI T FHE+GH +H ++G+ R    +G      DFVE PS ++E +  D   
Sbjct: 558 SLCLLHISEIETLFHEMGHAMHSMLGRTRLQNLSGTRCAT-DFVELPSILMEHFARDTRV 616

Query: 579 LQSLSKHYKTGEQIPEKLLDSLIATKHVNGALFALRQLHFGLFDMTVHTSKDVA---SLD 635
           L+ + KH  TGE +PE LL + +             Q    + D  +H  + +    +LD
Sbjct: 617 LRQIGKHCNTGEPVPESLLTNYLQDLQYMQYCETFSQAKMAMLDQRLHGKEIITGMDTLD 676

Query: 636 LLKLWGDLRQEISLVENGGQYTKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYRTKFAP 695
           ++ L+ +L +E+ ++ +      G   FGH+    Y A YY Y++    A+ ++ + F  
Sbjct: 677 VVALYQNLERELRVLVDDQSTWCG--RFGHLF--GYGATYYSYLFDRAIASKVWESLFQE 732

Query: 696 NPLDSSVGMKYRDIVLANGG 715
           +P   + G ++++ VL  GG
Sbjct: 733 DPFSRAGGQRFKEYVLKWGG 752

>CAGL0D02112g Chr4 complement(216204..218489) [2286 bp, 761 aa] {ON}
           similar to uniprot|P35999 Saccharomyces cerevisiae
           YKL134c MIP1
          Length = 761

 Score =  165 bits (417), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 163/641 (25%), Positives = 275/641 (42%), Gaps = 81/641 (12%)

Query: 122 VNQLC-FLQHVSSDKEIREASNKATELLQNFEIETSLRHDLFLQFDKIWKELK-PRKEEF 179
           V  LC FL+    D+   EA+    E  + FE    L  D+ L  +K+ + L+ P   + 
Sbjct: 123 VIDLCEFLRSAHPDQSYVEAAQMCHE--EMFEFMNVLNTDVVL-CNKLKEVLEDPEILKV 179

Query: 180 SHDEEQFEIYKFVEKCHKDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLG-EQKEF 238
             +EE+    K  E    DF ++G+ +    R +  ++  +I+    EF  N     KEF
Sbjct: 180 LSEEER----KVGEILLDDFEKSGIYMKAGIREQFIELSQQISVIGQEFINNTDYVAKEF 235

Query: 239 LLFSKEQLD--GVSDTVMEQFEQVKDETTNETNYKVTFKYPDI-------FPVLKMAKNA 289
           +   ++++D  G+S  +           T   N  +T KY  I         +LK   + 
Sbjct: 236 IKVKRDEMDKSGISPLL-----------TARLNRDLTGKYYKIPTYGQIPLQILKSCPDE 284

Query: 290 ETRKTAFCGDQNKVPQNEELFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTVXXXX 349
           + RK  +    N      +     ++LR  L+ LLG  +Y++Y L+ KMA     V    
Sbjct: 285 DIRKEVWAALHNCPKAQIQRLNQLVRLRVILSNLLGKQSYSDYQLDNKMAGSPENVKGFI 344

Query: 350 XXXXXXXXXXGEKEIGILKSIKEAECKELGVPFDGRYYI----------WDHRYYDTKYL 399
                       +E+  +   K      L  P D R+            WD  Y+ +KY 
Sbjct: 345 KTLMNVTKPLAARELEFIARDK------LNAP-DSRHMSDNEILSIVKPWDKNYFSSKYD 397

Query: 400 KDN--FNVDHEAIAEYYPIDSTIEGMLKIYETVFKLKFVEEKDTAKKNVWNEDVKQIAVW 457
            DN    +  E +  Y+ + + I G+ ++++ ++ +  ++   T     W+ DV+++ V 
Sbjct: 398 SDNEMAMIRDEQLRYYFSLGNVINGLSELFKRIYGIT-LQPSRTENGETWSPDVRRLDVI 456

Query: 458 KMDNVKTPVFVGWIYFDLHPRDGKYGHAANFGIASS---YIRE------------DGSR- 501
                +    VG IY DL  R GK  + A+F +  S   Y  E            DG+  
Sbjct: 457 S----EEEGLVGVIYCDLFERVGKISNPAHFTVCCSRQVYPDENDFTTIQTGQNSDGTVF 512

Query: 502 SYPVTALVCNFSKSS---ATKPSLLKHNEITTFFHELGHGIHDLVGKNRAARFNGPGATP 558
             PV +LVCNFS  +     +   L  NEI T FHE+GH +H ++G+ R    +G     
Sbjct: 513 QLPVISLVCNFSTVALPNGNRTCFLHMNEIETLFHEMGHAMHSMLGRTRLQNISGTRCAT 572

Query: 559 WDFVEAPSQMLEFYTWDKNALQSLSKHYKTGEQIPEKLLDSLIATKHVNGALFALRQLHF 618
            DFVE PS ++E +  D   L+++  HY+T E  PE LL+  +             Q   
Sbjct: 573 -DFVELPSILMEHFARDIRVLRTIGSHYETSEPAPEALLNDYLDKTQFLQHCETYSQAKM 631

Query: 619 GLFDMTVHTS---KDVASLDLLKLWGDLRQEISLVENGGQYTKGYDSFGHIMSDSYSAGY 675
            + D  +H S    D+  +D  K++  L   + ++ +      G   FGH+    Y A Y
Sbjct: 632 AMLDQKLHGSFSLSDIERIDSAKIYQKLETRLQVLADDESNWCG--RFGHLF--GYGATY 687

Query: 676 YGYMWAEVFATDMYRTKFAPNPLDSSVGMKYRDIVLANGGL 716
           Y Y++    A+ ++ + F  +P + + G K+++ VL  GGL
Sbjct: 688 YSYLFDRAIASKVWDSLFKDDPFNRTGGEKFKERVLKWGGL 728

>Kwal_26.7616 s26 (444266..446578) [2313 bp, 770 aa] {ON} YKL134C
           (OCT1) - 1:1 [contig 55] FULL
          Length = 770

 Score =  164 bits (415), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 134/552 (24%), Positives = 253/552 (45%), Gaps = 51/552 (9%)

Query: 197 KDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLG-EQKEFLLFSKEQLD--GVSDTV 253
           +DF ++G+++  +   +  +I  +I+    EF  N    + +++    ++LD  GVS  +
Sbjct: 203 EDFEKSGIDMEPKVGEQFINISQQISIVGQEFINNTDFPRSDYVKIPCKELDSSGVSTLL 262

Query: 254 MEQFEQVKDETTNETNYKVTFKYPDIFPVLKMAKNAETRKTAFCGDQNKVPQNEELFVAT 313
           + Q  +   +  N+ NYKV       F +L+   N   R   +    +   +        
Sbjct: 263 LNQLSR---DLKNQ-NYKVPAYGYAAFSILRSCPNENVRMKIWTAMHSCPEKQISRLKQL 318

Query: 314 LKLRDELATLLGYDTYANYNLEIKMAKKQSTVXXXXXXXXXXXXXXGEKEIGILKSIKEA 373
           + LR  LA+++G  +YA Y L  KMAK    V                +E+ +L  +K  
Sbjct: 319 VMLRGLLASIMGKKSYAEYQLSGKMAKSPVYVRGFVQSLVDVTKPLAAEELRVLAKLKSG 378

Query: 374 ECKELGVPF-----DGRYYI--WDHRYYDT--KYLKDNFNVDHEAIAEYYPIDSTIEGML 424
               LGV       D   ++  WD  +Y T     +    +++E I+ Y+ + + ++G+ 
Sbjct: 379 H---LGVNVPQSDADVLRFVRPWDRDFYSTLNALQQQRKTLENEHISSYFSLGTVMQGLS 435

Query: 425 KIYETVFKLKFVEEKDTAKKN-VWNEDVKQIAVWKMDNVKTPVFVGWIYFDLHPRDGKYG 483
           +++E ++ ++   E   AK    W+ +V++I V      +    +G +Y DL  R GK  
Sbjct: 436 RLFEDIYGIRL--EPVVAKAGETWSPEVRRINVVS----EKEGIIGVVYCDLFERQGKTS 489

Query: 484 HAANFGIASSYIREDGSR----------------SYPVTALVCNFSKSSATKP--SLLKH 525
           + A+F +  S     G                    PV +LVC+F+++SA++    LL+ 
Sbjct: 490 NPAHFTVCCSRTIYPGETDLSTIQVGQLPSGEKFQLPVISLVCSFAQNSASRQGVCLLQL 549

Query: 526 NEITTFFHELGHGIHDLVGKNRAARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKH 585
           +++ T FHE+GH +H ++G+      +G      DFVE PS ++E +  D   L  + +H
Sbjct: 550 SDVDTLFHEMGHAMHSMLGRTSLQNISGTRCAT-DFVELPSILMEHFARDSRVLSRIGRH 608

Query: 586 YKTGEQIPEKLLDSLIATKHVNGALFALRQLHFGLFDMTVHTSKDV--ASLDLLKLWGDL 643
           Y T + IP +LL       +         Q    + D  +H+SK +    LD++KL+  +
Sbjct: 609 YATDQPIPTELLKLNQTEMNYLQHTETFSQAKMAMLDQELHSSKALTDGKLDVVKLYHGV 668

Query: 644 RQEISLVENGGQYTKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSSVG 703
            +++ ++ +      G   FGH++   Y A YY Y++    A+ +++  FA +P +   G
Sbjct: 669 EKDMEVLADDQSNWCG--RFGHLL--GYGASYYSYLFDRAIASKIWQHLFAEDPFNRENG 724

Query: 704 MKYRDIVLANGG 715
            K+++ VL  GG
Sbjct: 725 EKFKESVLKWGG 736

>TPHA0G02390 Chr7 complement(486025..488412) [2388 bp, 795 aa] {ON}
           Anc_2.432 YKL134C
          Length = 795

 Score =  164 bits (414), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 164/636 (25%), Positives = 281/636 (44%), Gaps = 73/636 (11%)

Query: 122 VNQLC-FLQHVSSDKEIREASNKATELLQNFEIETSLRHDL--------FLQFDKIWKEL 172
           V  LC F++    D E  + S +  EL+  FE   +L  D+         L+ +KI  +L
Sbjct: 154 VIDLCEFIRSAHPDDEYLKVSQECYELM--FEFMNTLNTDVQLCYTLKHILEDEKICSKL 211

Query: 173 KPRKEEFSHDEEQFEIYKFVEKCHKDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNL 232
                    DEE    YK  +   +DF ++G+ +    R K  ++  +I+    EF  N 
Sbjct: 212 T--------DEE----YKVGKILLEDFEKSGIYMEPNTREKFIELSQEISLVGQEFISNT 259

Query: 233 G-EQKEFLLFSKEQLDGVSDTVMEQFEQVKDETTNETNYKVTFKYPDIFPVLKMAKNAET 291
               K  +L  +E L+ +S+  +    Q+K + T + +YK+    P  + +L    N   
Sbjct: 260 DYVTKNNILIDRESLN-LSELELPFTYQLKTDITGK-HYKIPTTGPIPYSILTNCSNETI 317

Query: 292 RKTAFCGDQNKVPQNEELFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTVXXXXXX 351
           RK  +    +   +  E     + LR +LA LL   ++A Y L+ KMAK    V      
Sbjct: 318 RKKIWTELHSCSQEQIERLKKMVTLRYKLAKLLKKKSFAEYQLQGKMAKNPEEVKKFIST 377

Query: 352 XXXXXXXXGEKEIGILKSIKEAECKELGVPF--DGRYYI-----WDHRYYD--TKYLKDN 402
                     KE   L S+ E +  +LG+ F  D  + +     WD  YY    +Y    
Sbjct: 378 LLDFTKPLAIKE---LTSLAEVKAADLGLAFKNDSNFIVNLIRPWDRNYYSKINRYENKQ 434

Query: 403 FNVDHEAIAEYYPIDSTIEGMLKIYETVFKLKFVEEKDTAKKNVWNEDVKQIAVWKMDNV 462
              D   +  Y+ + + I G+  ++  ++ ++F E      +  W  +V+++ V      
Sbjct: 435 TMEDLNELPYYFSLGNVIAGLSNLFHNIYGIRF-ELAVPKLEETWLPEVRKLNVIS---- 489

Query: 463 KTPVFVGWIYFDLHPRDGKYGHAANFGIASSYIREDGSR-----------------SYPV 505
           ++   +G +Y DL  R  K  +AA+F I  S  RE G                     P+
Sbjct: 490 ESEGLIGIVYCDLFERPSKKTNAAHFTICCS--REIGKGEDISTMQVGMNSKGNMFQLPI 547

Query: 506 TALVCNFSKS---SATKPSLLKHNEITTFFHELGHGIHDLVGKNRAARFNGPGATPWDFV 562
            +L+CNFSKS       P  L+ +EI T FHE+GH +H ++G+ R    +G      DFV
Sbjct: 548 ISLICNFSKSHLFEENGPCFLQLHEIETLFHEMGHAMHSVLGRTRLQNTSGTRCAT-DFV 606

Query: 563 EAPSQMLEFYTWDKNALQSLSKHYKTGEQIPEKLLDSLIATKHVNGALFALRQLHFGLFD 622
           E PS ++E +  D   ++S+S HY + E    +LL + + +      L    Q    + D
Sbjct: 607 ELPSILMEHFAKDVRVMESISSHYISQEPASPELLQTWLHSTDNLQNLELYTQAKMSMLD 666

Query: 623 MTVHTSK---DVASLDLLKLWGDLRQEISLVENGGQYTKGYDSFGHIMSDSYSAGYYGYM 679
             +H+++   D   ++++K + DL +++ L  +      G   FGH+    Y A YY Y+
Sbjct: 667 QILHSNEIFEDQKDINVVKSYNDLEKKLELFSDDQSNWCG--KFGHLFG--YGASYYSYL 722

Query: 680 WAEVFATDMYRTKFAPNPLDSSVGMKYRDIVLANGG 715
           +    A+ ++ + F  NP   + G+K++D VL  GG
Sbjct: 723 FDRAIASKVWESLFKQNPFSRTSGLKFKDSVLRWGG 758

>Skud_11.93 Chr11 complement(175243..177561) [2319 bp, 772 aa] {ON}
           YKL134C (REAL)
          Length = 772

 Score =  163 bits (413), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 135/481 (28%), Positives = 223/481 (46%), Gaps = 48/481 (9%)

Query: 269 NYKV-TFKYPDIFPVLKMAKNAETRKTAFCGDQNKVPQNEELFVATLKLRDELATLLGYD 327
           NYK+ TF Y   + +LK  +  E RK  +    +   +  +     +KLR  LA L+  +
Sbjct: 274 NYKIPTFGYA-AYALLKSCEKEEVRKKLWTALHSCSDKQIKRLSHLIKLRAILANLMNKE 332

Query: 328 TYANYNLEIKMAKKQSTVXXXXXXXXXXXXXXGEKEIGILKSIKEAECKELGVPFDGR-- 385
           +YA Y LE KMAK    V                 E   LK I E + K+L  P   +  
Sbjct: 333 SYAEYQLEGKMAKNPKDVQDFILTLMNGTIDKTANE---LKFIAELKTKDLKKPLATKTD 389

Query: 386 -----YYIWDHRYYDTKYLKDNFNVDHEA--IAEYYPIDSTIEGMLKIYETVFKLKFVEE 438
                   WD  YY  KYL+ N +    A  I+ Y+ + + IEG+  +++ ++ ++ +E 
Sbjct: 390 DILRLVRPWDRDYYTGKYLQLNPSDAPNAKEISYYFTLGNVIEGLSDLFQHIYGIR-LEP 448

Query: 439 KDTAKKNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLHPRDGKYGHAANFGIASS----- 493
           +   +   W+ DV+++ V   +       +G IY DL  R+GK  + A+F +  S     
Sbjct: 449 EIADEGETWSPDVRRLNVISEEEG----IIGIIYCDLFERNGKTSNPAHFTVCCSRQIYP 504

Query: 494 --------YIREDGSRSY---PVTALVCNFSKSS-ATKPSL--LKHNEITTFFHELGHGI 539
                    + E+   SY   PV +LVCNF+    A+K +L  L+ +E+ T FHE+GH +
Sbjct: 505 NETDFSTIQVGENPDGSYFQLPVISLVCNFAPIPIASKKTLCFLQLSEVETLFHEMGHAM 564

Query: 540 HDLVGKNRAARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKHYKTGEQIPEKLLDS 599
           H ++G+      +G      DFVE PS ++E +  D   L  +SKHY+TGE I   +L S
Sbjct: 565 HSMLGRTHMQNISGTRCAT-DFVELPSILMEHFAKDIRILTKISKHYETGETIQAGMLQS 623

Query: 600 LIATKHVNGALFALRQLHFGLFDMTVHTSK---DVASLDLLKLWGDLRQEIS-LVENGGQ 655
            + T +         Q    + D + H  +   D+ + D++K +  L + +  LV++   
Sbjct: 624 FMRTTNFLQNCETYSQAKMAMLDQSFHDEEIISDIDNFDIVKNYQALERRLKVLVDDQSN 683

Query: 656 YTKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSSVGMKYRDIVLANGG 715
           +      FGH+    Y A YY Y++    A+ ++   F  +P     G K++  +L  GG
Sbjct: 684 WC---GRFGHLF--GYGATYYSYLFDRTIASKIWYALFEDDPYSRKNGDKFKKHLLKWGG 738

Query: 716 L 716
           L
Sbjct: 739 L 739

>NCAS0A04280 Chr1 complement(864327..866648) [2322 bp, 773 aa] {ON}
           Anc_2.432
          Length = 773

 Score =  162 bits (409), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 121/435 (27%), Positives = 206/435 (47%), Gaps = 46/435 (10%)

Query: 314 LKLRDELATLLGYDTYANYNLEIKMAKKQSTVXXXXXXXXXXXXXXGEKEIGILKSIKEA 373
           +KLR  LA LL   ++A Y LE KMAK    V                +E   LK + + 
Sbjct: 320 VKLRAILAHLLNKCSFAKYQLEGKMAKTPQNVRDFIKTLMDYMRPKAAQE---LKFMADL 376

Query: 374 ECKELGVPF-DGRYYI------WDHRYYDTKY--LKDNFNVDHEAIAEYYPIDSTIEGML 424
           +CKEL +P  D    I      WD  YY T +   KD    ++  I  Y+ + + ++G+ 
Sbjct: 377 KCKELNIPTSDSTTAILDLISPWDREYYTTIHSKAKDVNLYENHPINMYFTMGNIMKGLS 436

Query: 425 KIYETVFKLKFVEEKDTAKKNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLHPRDGKYGH 484
            I++ ++ ++ +E     +   W+ +V+++ V      +T   +G +Y DL  R GK  +
Sbjct: 437 HIFQRIYGIR-LEAVVPEEGETWSPEVRRLNVIS----ETEGLIGVVYCDLFERAGKTSN 491

Query: 485 AANFGIASSY---------------IREDGSR-SYPVTALVCNFSKSSATKP---SLLKH 525
            A+F +  S                   DG+    PV +LVCNFS +  +      LL+ 
Sbjct: 492 PAHFTVCCSRQIYPDENDLSTIQIGTNPDGTAFQLPVISLVCNFSSTLTSNDKMICLLQL 551

Query: 526 NEITTFFHELGHGIHDLVGKNRAARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKH 585
           NEI T FHE+GH +H ++G++R    +G      DFVE PS ++E +  DK  L  +  H
Sbjct: 552 NEIETLFHEMGHAMHSMLGRSRLQNVSGTRCAT-DFVELPSILMEHFARDKRVLHEIGFH 610

Query: 586 YKTGEQIPEKLLDSLIATKHVNGALFALRQLHFGLFDMTVHTS---KDVASLDLLKLWGD 642
           Y+T E++ E ++++ +             Q    + D  +++    KD+  +D++K++  
Sbjct: 611 YETNERVSEYVIEAHLKKMKFLQDCETFSQGKMAMLDQELYSENIIKDLDHVDVVKIYQT 670

Query: 643 LRQEIS-LVENGGQYTKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSS 701
           L +++  LV+N   +      FGH+    Y A YY Y++    A+ ++   FA +P    
Sbjct: 671 LEEDLKVLVDNKSNWC---GKFGHLF--GYGASYYSYLFDRAIASKVWDQLFAKDPFSRE 725

Query: 702 VGMKYRDIVLANGGL 716
            G K+++ VL  GGL
Sbjct: 726 GGEKFKNCVLKWGGL 740

>TBLA0I00710 Chr9 (128272..130593) [2322 bp, 773 aa] {ON} Anc_2.432
           YKL134C
          Length = 773

 Score =  161 bits (408), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 136/551 (24%), Positives = 241/551 (43%), Gaps = 50/551 (9%)

Query: 197 KDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLG-EQKEFLLFSKEQLDGVSDTVME 255
           +DF ++G+ +S E R++   +   I+    +F  N    +K+++    ++ D   D    
Sbjct: 207 EDFEKSGIQMSPEIRDRFISLSQDISLAGQDFLNNTSYTEKDYIKIKCDEFDKACDYPAL 266

Query: 256 QFEQVKDETTNETNYKVTFKYPDIFPVLKMAKNAETRKTAFCGDQNKVPQNEELFVATLK 315
           +++  KD +          K P  +  L   K+ E RK  +    +   +  E     +K
Sbjct: 267 KYKLSKDLSGKYYKIPTYGKIP--YTALLKCKDEELRKKLWVAFHSCSNKQIERLTKIIK 324

Query: 316 LRDELATLLGYDTYANYNLEIKMAKKQSTVXXXXXXXXXXXXXXGEKEIGILKSIKEAEC 375
            R ELA LL   +Y+ Y LE KMAK    V                KE   L+ I   +C
Sbjct: 325 HRIELAKLLSKSSYSEYTLEGKMAKGPKEVNNFLNALLKSILPEVTKE---LEPISNKKC 381

Query: 376 KELGVPFD-------GRYYIWDHRYYDTKYLKDNFNVDHEAIAEYYPIDSTIEGMLKIYE 428
              G   +            WD  YY+              I EY+ + + I G+  ++ 
Sbjct: 382 LSEGFSLETSEQSILNNIKPWDRDYYNPIQATSE-GAYQMLIMEYFTLGNIIHGLSNLFN 440

Query: 429 TVFKLKFVEEKDTAKKNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLHPRDGKYGHAANF 488
           +++ ++F E         W++DV+++ V   D       +G IY DL  R+GK    +++
Sbjct: 441 SIYGIRF-EPGKIEDGETWSKDVRKLNVISEDEG----LIGVIYCDLFEREGKSESPSHY 495

Query: 489 GIASSYIREDGSRSY-------------------PVTALVCNFSKSSAT---KPSLLKHN 526
            I  S  RE  S  +                   P+ +LVCNF  ++A    +   L+H+
Sbjct: 496 TICCS--REIYSEEHDLSTIQTGVNNKTGKNFQLPIVSLVCNFQVTNAKESRRICFLQHH 553

Query: 527 EITTFFHELGHGIHDLVGKNRAARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKHY 586
           EI T FHE+GH +H ++G+ R    +G      DFVE PS ++EF+  +   L  +S+HY
Sbjct: 554 EIETLFHEMGHAMHSMLGRTRFQTISGTRCVS-DFVEIPSILMEFFANNPKVLIDISRHY 612

Query: 587 KTGEQIPEKLLDSLIATKHVNGALFALRQLHFGLFDMTVHT--SKDVASLDLLKLWGDLR 644
            +GE I  ++L+  +       A     Q    L D  +H   +  + ++D+++++ +L 
Sbjct: 613 DSGESIDIEVLNKYLENTKQFKACETYSQGKMALLDQRLHAENANSLDNIDVVEIYHNLE 672

Query: 645 QEISLVENGGQYTKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSSVGM 704
           +E+S++ +      G   FGH+    Y A YY Y++    AT ++ + F  +P     G 
Sbjct: 673 KELSVLPDTESNWCG--RFGHLY--GYGALYYCYLFDRAIATKIWESLFQNDPFSRKGGN 728

Query: 705 KYRDIVLANGG 715
            +++ +L  GG
Sbjct: 729 IFKEQLLKWGG 739

>KLTH0D04730g Chr4 (432572..434890) [2319 bp, 772 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 772

 Score =  160 bits (405), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 138/573 (24%), Positives = 263/573 (45%), Gaps = 67/573 (11%)

Query: 183 EEQFEIYKFVEKCHKDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLG-EQKEFLLF 241
           EE+ ++ K +    +DF ++G++++ E   +  ++  +I+    EF  N    + E++  
Sbjct: 193 EEELKVGKIL---LEDFEKSGIDMAPEVGEQFINLSQQISIVGQEFISNTDFPKSEYVKV 249

Query: 242 SKEQLD--GVSDTVMEQFEQVKDETTNETNYKV-TFKYPDIFPVLKMAKNAETRKTAFCG 298
           S  +L+  G+S  ++    +     T   NYKV T+ Y   F +L+   +   R   +  
Sbjct: 250 SCNELETSGISPLLLNHLSR----DTKGQNYKVPTYGYI-AFSILRSCPSENIRMKVWTA 304

Query: 299 DQNKVPQNEELFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTVXXXXXXXXXXXXX 358
             +   +        +KLR  LA ++G ++Y++Y LE KMAK    V             
Sbjct: 305 VHSCPEKQITRLKHLVKLRGLLAQIMGKNSYSDYQLEGKMAKSPVYVRGFVESLAEAIKP 364

Query: 359 XGEKEIGILKSIKEAECKELGVPFDGRYYI-----WDHRYYDT--KYLKDNFNVDHEAIA 411
              +E+  L ++K +   +L +P      +     WD  +Y T     +    +++E I 
Sbjct: 365 LAMRELRALANLKSSHL-DLPIPKTDEEVLKFVRPWDRDFYSTLISLQQQRKTLENEQIN 423

Query: 412 EYYPIDSTIEGMLKIYETVFKLKFVEEKDTAK-KNVWNEDVKQIAVWKMDNVKTPVFVGW 470
            Y+ + + ++G+  + E ++ ++   E   AK    W+ +V++I V           +G 
Sbjct: 424 SYFSLGTVMQGLSSLLEDIYGIRL--EPAVAKVGETWSPEVRRINVVS----DQEGVIGV 477

Query: 471 IYFDLHPRDGKYGHAANFGIASS---YIREDGSRS--------------YPVTALVCNFS 513
           +Y DL  R GK  + A+F +  S   Y  E    +               PV +LVC+FS
Sbjct: 478 VYCDLFERQGKTSNPAHFTVCCSRQIYPEETDLSTIQVGQQPSSGQIFQLPVISLVCSFS 537

Query: 514 KSSATKP--SLLKHNEITTFFHELGHGIHDLVGKNRAARFNGPGATPWDFVEAPSQMLEF 571
           ++S +K    LL+ +E+ T FHE+GH IH ++G+      +G      DFVE PS ++E 
Sbjct: 538 QNSGSKKDVCLLQLSEVDTLFHEMGHAIHSMLGRTSLQNISGTRCAT-DFVELPSILMEH 596

Query: 572 YTWDKNALQSLSKHYKTGEQIPEKLLDSLIATKHVNGALF-------ALRQLHFGLFDMT 624
           +  D   L  + KHY T E +P++LL       H+N              Q    + D  
Sbjct: 597 FAHDSRVLSRIGKHYITNEPVPDELL-------HLNQNELKYLQNTETFSQAKMAMLDQE 649

Query: 625 VHTSKDV--ASLDLLKLWGDLRQEISLVENGGQYTKGYDSFGHIMSDSYSAGYYGYMWAE 682
           +H+ + +    +D+++++ ++ +++ ++ +      G   FGH++   Y A YY Y++  
Sbjct: 650 MHSPRMLTDGPVDVVEIYHEVEKQMGVLTDDKSNWCG--RFGHLL--GYGASYYSYLFDR 705

Query: 683 VFATDMYRTKFAPNPLDSSVGMKYRDIVLANGG 715
             A+ +++  FA +P     G K+++ VL  GG
Sbjct: 706 AIASKVWQHLFANDPFSRKSGEKFKNSVLRWGG 738

>Suva_11.91 Chr11 complement(175327..177654) [2328 bp, 775 aa] {ON}
           YKL134C (REAL)
          Length = 775

 Score =  158 bits (400), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 169/633 (26%), Positives = 282/633 (44%), Gaps = 64/633 (10%)

Query: 122 VNQLC-FLQHVSSDKEIREASNKATELLQNFEIETSLRHDLFLQFDKIWKELKPRKEEFS 180
           V  LC F++    D    +A+    E  Q FE    L  D+ L  + +   L   K    
Sbjct: 136 VIDLCEFIRSTHPDDAFVKAAQDCHE--QMFEFMNVLNTDVSL-CNMLKTVLNSPKISSK 192

Query: 181 HDEEQFEIYKFVEKCHKDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLG-EQKEFL 239
             EE+ ++ K +     DF ++G+ ++ + R K   +  +I+    EF  +        +
Sbjct: 193 LSEEELKVGKIL---LDDFEKSGIYMNPDVREKFIQLSQEISLVGQEFINHTDYPGSNSV 249

Query: 240 LFSKEQLDG--VSDTVMEQFEQ-VKDETTNETNYKV-TFKYPDIFPVLKMAKNAETRKTA 295
             S  +LD   VS  +++Q  + VK +     NYKV TF Y   + +LK  +  + RK  
Sbjct: 250 KISCRELDNSNVSAFLLKQLNKDVKGQ-----NYKVPTFGYA-AYALLKSCEKEQVRKKI 303

Query: 296 FCGDQNKVPQNEELFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTVXXXXXXXXXX 355
           +    +   +  +     +KLR  LA L+   +YA Y LE KMAK    V          
Sbjct: 304 WTALHSCSDKQIKRLNHLIKLRANLADLMHKGSYAEYQLEGKMAKNPKDVQDFILTLMND 363

Query: 356 XXXXGEKEIGILKSIKEAECKELGVPFDGR-------YYIWDHRYYDTKYLKDNFNVDHE 408
                  E   LK I E + K+L  P   +          WD  YY  KYL+ N +    
Sbjct: 364 TIDKTATE---LKFIAELKAKDLKKPLATKTDEILKLVRPWDRDYYTGKYLQLNPSNAPS 420

Query: 409 A--IAEYYPIDSTIEGMLKIYETVFKLKFVEEKDTAKKNVWNEDVKQIAVWKMDNVKTPV 466
           A  I+ Y+ + + I+G+  +++ ++ +K +E     +   W+ DV+++ V   +      
Sbjct: 421 AKEISSYFTLGNVIQGLSDLFQHIYGIK-LEPAIADEGETWSPDVRRLNVISEEEG---- 475

Query: 467 FVGWIYFDLHPRDGKYGHAANFGIASS---YIRE------------DGSR-SYPVTALVC 510
            +G IY DL  R GK  + A+F +  S   Y  E            DGS    PV +LVC
Sbjct: 476 IIGIIYCDLFERSGKTSNPAHFTVCCSRQIYPNETDFSTIQLGENADGSFFQLPVISLVC 535

Query: 511 NFSKSS-ATKPSL--LKHNEITTFFHELGHGIHDLVGKNRAARFNGPGATPWDFVEAPSQ 567
           NF+    A+K SL  L+ +E+ T FHE+GH +H ++G+      +G      DFVE PS 
Sbjct: 536 NFAPIPIASKKSLCFLQLSEVETLFHEMGHAMHSMLGRTHMQNISGTRCAT-DFVELPSI 594

Query: 568 MLEFYTWDKNALQSLSKHYKTGEQIPEKLLDSLIATKHVNGALFALRQLHFGLFDMTVHT 627
           ++E +  D   L  + KHY+TGE +   +L S + T +         Q    + D + H 
Sbjct: 595 LMEHFAKDIRILTRIGKHYETGETVEPDMLQSFMRTTNFLQNCETYSQAKMAMLDQSFHD 654

Query: 628 SKDVASL---DLLKLWGDLRQEIS-LVENGGQYTKGYDSFGHIMSDSYSAGYYGYMWAEV 683
            + ++++   D++K +  L + +  LV++   +      FGH+    Y A YY Y++   
Sbjct: 655 EEVISNIDNYDVVKNYQALERRLKVLVDDQSNWC---GRFGHLF--GYGATYYSYLFDRT 709

Query: 684 FATDMYRTKFAPNPLDSSVGMKYRDIVLANGGL 716
            A+ ++   F  +P     G K++  +L  GGL
Sbjct: 710 IASKIWYALFEDDPYSRKNGDKFKKHLLKWGGL 742

>YKL134C Chr11 complement(189124..191442) [2319 bp, 772 aa] {ON}
           OCT1Mitochondrial intermediate peptidase, cleaves
           destabilizing N-terminal residues of a subset of
           proteins upon import, after their cleavage by
           mitochondrial processing peptidase (Mas1p-Mas2p); may
           contribute to mitochondrial iron homeostasis
          Length = 772

 Score =  158 bits (399), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 134/481 (27%), Positives = 218/481 (45%), Gaps = 48/481 (9%)

Query: 269 NYKV-TFKYPDIFPVLKMAKNAETRKTAFCGDQNKVPQNEELFVATLKLRDELATLLGYD 327
           NYKV TF Y   + +LK  +N   RK  +    +   +  +     +KLR  LA L+   
Sbjct: 274 NYKVPTFGYA-AYALLKSCENEMVRKKLWTALHSCSDKQVKRLSHLIKLRAILANLMHKT 332

Query: 328 TYANYNLEIKMAKKQSTVXXXXXXXXXXXXXXGEKEIGILKSIKEAECKELGVPFDGR-- 385
           +YA Y LE KMAK    V               EK    LK I E + K+L  P      
Sbjct: 333 SYAEYQLEGKMAKNPKDVQDFILTLMNNTI---EKTANELKFIAELKAKDLKKPLTTNTD 389

Query: 386 -----YYIWDHRYYDTKYLKDNFNVDHEA--IAEYYPIDSTIEGMLKIYETVFKLKFVEE 438
                   WD  YY  KY + N +    A  I+ Y+ + + I+G+  +++ ++ ++ +E 
Sbjct: 390 EILKLVRPWDRDYYTGKYFQLNPSNSPNAKEISYYFTLGNVIQGLSDLFQQIYGIR-LEP 448

Query: 439 KDTAKKNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLHPRDGKYGHAANFGIASS----- 493
             T +   W+ DV+++ V   +       +G IY DL  R+GK  + A+F +  S     
Sbjct: 449 AITDEGETWSPDVRRLNVISEEEG----IIGIIYCDLFERNGKTSNPAHFTVCCSRQIYP 504

Query: 494 --------YIREDGSRSY---PVTALVCNFSKS-SATKPSL--LKHNEITTFFHELGHGI 539
                    + E+   +Y   PV +LVCNFS    A+K SL  L+ +E+ T FHE+GH +
Sbjct: 505 SETDFSTIQVGENPDGTYFQLPVISLVCNFSPILIASKKSLCFLQLSEVETLFHEMGHAM 564

Query: 540 HDLVGKNRAARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKHYKTGEQIPEKLLDS 599
           H ++G+      +G      DFVE PS ++E +  D   L  + KHY TGE I   +L  
Sbjct: 565 HSMLGRTHMQNISGTRCAT-DFVELPSILMEHFAKDIRILTKIGKHYGTGETIQADMLQR 623

Query: 600 LIATKHVNGALFALRQLHFGLFDMTVHTSK---DVASLDLLKLWGDLRQEIS-LVENGGQ 655
            + + +         Q    + D + H  K   D+ + D+++ +  L + +  LV++   
Sbjct: 624 FMKSTNFLQNCETYSQAKMAMLDQSFHDEKIISDIDNFDVVENYQALERRLKVLVDDQSN 683

Query: 656 YTKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSSVGMKYRDIVLANGG 715
           +      FGH+    Y A YY Y++    A+ ++   F  +P     G K++  +L  GG
Sbjct: 684 WC---GRFGHLF--GYGATYYSYLFDRTIASKIWYALFEDDPYSRKNGDKFKKHLLKWGG 738

Query: 716 L 716
           L
Sbjct: 739 L 739

>Smik_11.102 Chr11 complement(175013..177331) [2319 bp, 772 aa] {ON}
           YKL134C (REAL)
          Length = 772

 Score =  156 bits (394), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 134/481 (27%), Positives = 221/481 (45%), Gaps = 48/481 (9%)

Query: 269 NYKV-TFKYPDIFPVLKMAKNAETRKTAFCGDQNKVPQNEELFVATLKLRDELATLLGYD 327
           NYKV TF Y   F +LK  +    RK  +    +   +  +     +KLR  LA L+   
Sbjct: 274 NYKVPTFGYA-AFALLKSCEIEVVRKKIWTALHSCSDKQIKRLDRLIKLRAVLANLMHKG 332

Query: 328 TYANYNLEIKMAKKQSTVXXXXXXXXXXXXXXGEKEIGILKSIKEAECKELGVPFDGR-- 385
           +YA Y LE KMAK    V                 E   LK I + + K+L  P      
Sbjct: 333 SYAEYQLEGKMAKNPKDVQDFILTLMNNTIDKTANE---LKFIADLKAKDLKKPLTTNTD 389

Query: 386 -----YYIWDHRYYDTKYLKDN-FNV-DHEAIAEYYPIDSTIEGMLKIYETVFKLKFVEE 438
                   WD  YY  KY++ N  NV   + I+ Y+ + + I+G+  +++ ++ ++ +E 
Sbjct: 390 EILKLVRPWDRDYYTGKYIQLNPSNVPSAKEISYYFTLGNVIQGLSDLFQQIYGIR-LEP 448

Query: 439 KDTAKKNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLHPRDGKYGHAANFGIASS----- 493
               +   W+ DV+++ V   +       +G IY DL  R+GK  + A+F +  S     
Sbjct: 449 AIADEGETWSPDVRRLNVISEEEG----IIGIIYCDLFERNGKTSNPAHFTVCCSRQIYP 504

Query: 494 --------YIREDGSRSY---PVTALVCNFSKSS-ATKPSL--LKHNEITTFFHELGHGI 539
                    + E+ + SY   PV +LVCNFS    A+K SL  L+ +E+ T FHE+GH +
Sbjct: 505 HETDFSTIQVGENPNGSYFQLPVISLVCNFSPVPIASKKSLCFLQLSEVETLFHEMGHAM 564

Query: 540 HDLVGKNRAARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKHYKTGEQIPEKLLDS 599
           H ++G+      +G      DFVE PS ++E +  D   L  + KHY+TGE I + +L  
Sbjct: 565 HSMLGRTHMQNISGTRCAT-DFVELPSILMEHFAKDIRVLTRIGKHYETGETIQKGMLQC 623

Query: 600 LIATKHVNGALFALRQLHFGLFDMTVHTSK---DVASLDLLKLWGDLRQEIS-LVENGGQ 655
            + T +         Q    + D + H  K   D+ + +++  +  L + +  LV++   
Sbjct: 624 FMKTTNFLQNCETYSQAKMAMLDQSFHDEKIMSDIDNFNVVDNYQALERHLKVLVDDQSN 683

Query: 656 YTKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSSVGMKYRDIVLANGG 715
           +      FGH+    Y A YY Y++    A+ ++ T F  +P   + G K++  +L  GG
Sbjct: 684 WC---GRFGHLF--GYGATYYSYLFDRTIASKIWYTLFDDDPYSRNNGDKFKKHLLKWGG 738

Query: 716 L 716
           L
Sbjct: 739 L 739

>TDEL0A02080 Chr1 complement(373425..375788) [2364 bp, 787 aa] {ON}
           Anc_2.432 YKL134C
          Length = 787

 Score =  155 bits (392), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 142/561 (25%), Positives = 257/561 (45%), Gaps = 65/561 (11%)

Query: 197 KDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLG-EQKEFLLFSKEQLD--GVSDTV 253
           +DF ++G+ ++ E R++   +  +I+    EF  N    +  ++    E++D  G++  +
Sbjct: 216 EDFEKSGIYMNPEVRDQFIALSQEISLVGQEFINNTDYVRSNYIKIKCEEVDNSGINKLL 275

Query: 254 MEQFEQVKDETTNETNYKVTFKYPDIFPVLKMAKNAETRKTAF-----CGDQ--NKVPQN 306
           + Q    KD       YK+       + +L+   + E R   +     C D+  N++ Q 
Sbjct: 276 ISQLP--KD--VRGKYYKIPTHGYIAYSILRSCPDEEIRMNLWTAMHRCSDKQINRLDQ- 330

Query: 307 EELFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTVXXXXXXXXXXXXXXGEKEIGI 366
                  L+LR  LA L+G +++A Y LE KMA+    V                +E+  
Sbjct: 331 ------LLRLRAILAKLMGKESFAQYQLEGKMAQTPQQVRDFIGTLVNYMRPKTIEELKF 384

Query: 367 LKSIKEAECKELGVPFDGRYYI------WDHRYYDTKY-LKDNFN-VDHEAIAEYYPIDS 418
           +  +K  + K    P      I      WD  YY + Y L+   + +D E I+ Y+ + +
Sbjct: 385 IYELKSKQEKREIQPSPSEQDIASMVRPWDREYYTSMYSLQQRRDAIDDEQISSYFTLGN 444

Query: 419 TIEGMLKIYETVFKLKFVEEKDTAKKNVWNEDVKQI-AVWKMDNVKTPVFVGWIYFDLHP 477
            I+G+  ++E+++ ++ +E         ++ +V+++  V + + V     +G +Y DL  
Sbjct: 445 VIQGLSDLFESIYGIR-LEPVVPKTGETFSPEVRRLNVVCEQEGV-----IGVVYCDLFE 498

Query: 478 RDGKYGHAANFGIASS---YIRED-------GSRS------YPVTALVCNFSKSSATKP- 520
           R GK  + ++F +  S   Y +E        G  S       PV ALVCNFS S+ ++  
Sbjct: 499 RAGKTSNPSHFTVCCSRQIYPKETEFSTIQTGFNSEGLMFQLPVIALVCNFSSSTDSEGK 558

Query: 521 --SLLKHNEITTFFHELGHGIHDLVGKNRAARFNGPGATPWDFVEAPSQMLEFYTWDKNA 578
              LL+ NE+ T FHE+GH +H ++G+ R    +G      DFVE PS ++E +  D   
Sbjct: 559 SICLLQLNEVETLFHEMGHAMHSMLGRTRLQNISGTRCAT-DFVELPSILMEHFARDVRV 617

Query: 579 LQSLSKHYKTGEQIPEKLLDSLIATKHVNGALFALRQLHFGLFDMTVHTS---KDVASLD 635
           L+ + KH++TG  I EKLL + +             Q    + D  +H     KD    D
Sbjct: 618 LERIGKHHRTGAPISEKLLLNYLEETKFMQHCETFSQAKMAMLDQDLHGEKVIKDFDHFD 677

Query: 636 LLKLWGDLRQEIS-LVENGGQYTKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYRTKFA 694
           +   +  L +++  LV++   +      FGH+    Y A YY Y++    A+ ++ + F+
Sbjct: 678 VTAAYQQLERDMKVLVDDKSNWC---GKFGHLF--GYGATYYSYLFDRAIASKVWDSLFS 732

Query: 695 PNPLDSSVGMKYRDIVLANGG 715
            +P     G K+++ VL  GG
Sbjct: 733 SDPYSRVNGEKFKECVLKWGG 753

>AFR198W Chr6 (797448..799778) [2331 bp, 776 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL134C (OCT1)
          Length = 776

 Score =  153 bits (387), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 162/640 (25%), Positives = 268/640 (41%), Gaps = 67/640 (10%)

Query: 112 MNHENSIGLMVNQLC-FLQHVSSDKEIREASNKATELLQNFEIETSLRHDLFLQFDKIWK 170
           ++  + I   V  LC FL+    D++   A+ +  E  Q FEI   L  D+ L      K
Sbjct: 134 LDQLSDILCRVIDLCEFLRAAHPDEQFVAAAQECHE--QMFEIMNILNTDVVL-----CK 186

Query: 171 ELKP--RKEEFSHDEEQFEIYKFVEKCHKDFVRAGLNLSEEDRNKVKDIKIKIASNSLEF 228
            LK     E  S      EI +      +DF +AG   S E R +   +   I+    +F
Sbjct: 187 RLKQVLSDENISSKLSSEEI-RVGHILLEDFEKAGAYASPEVRKQFIQLSQNISIIGQDF 245

Query: 229 SKNLGE-QKEFLLFSKEQLD--GVSDTVMEQFEQVKDETTNETNYKVTFKYPDIFPVLKM 285
             N       ++    + L+  G S  V+ Q    KD   N  NYK+       + +L  
Sbjct: 246 INNTESLSSSYIKIPCKDLESSGTSHLVLRQL--TKDTMGN--NYKIPTSGYAPYTLLNA 301

Query: 286 AKNAETRKTAFCGDQNKVPQNEELFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTV 345
             +   R+  +    +   +  +   + L+LR +LA ++G   Y +Y LE KMAK    V
Sbjct: 302 CPSEAIRRQVWTAMFSCSEKQVKRLKSLLQLRRKLANIMGATDYVSYQLEGKMAKSPENV 361

Query: 346 XXXXXXXXXXXXXXGEKEIGILKSIK-------EAECKELGVPFDGRYYIWDHRYYDT-- 396
                            E+  L  +K       E    +L  P       WD  YY +  
Sbjct: 362 KNFLNTLVDHTKPLAAGELEELAKLKRNVENLSETNTLKLMRP-------WDRDYYSSLS 414

Query: 397 -KYLKDNFNVD-HEAIAEYYPIDSTIEGMLKIYETVFKLKFVEEKDTAKKNVWNEDVKQI 454
             + + N  VD   +I  Y+ +   ++G+  ++  ++ +        A +  W  DV+++
Sbjct: 415 PNFTRPNHRVDGFTSINTYFSLGVVMQGISDLFRDIYGISLKPVVAQAGE-TWAPDVRKL 473

Query: 455 AVWKMDNVKTPVFVGWIYFDLHPRDGKYGHAANFGIASS---YIRE------------DG 499
            V      +T   +G IY DL  R GK    ++F +  S   Y  E            DG
Sbjct: 474 QVIS----ETEGIIGLIYCDLLERPGKTTSPSHFTVCCSRQIYPEENDFSTIQVGENPDG 529

Query: 500 SR-SYPVTALVCNFSKSSATKP---SLLKHNEITTFFHELGHGIHDLVGKNRAARFNGPG 555
           SR   PV +L+CNF  +   K     LL+ +++ T FHE+GH +H ++G+ +    +G  
Sbjct: 530 SRFQMPVISLICNFRATRHGKNKSLCLLELSDVETLFHEMGHALHSMLGRTQLQNLSGTR 589

Query: 556 ATPWDFVEAPSQMLEFYTWDKNALQSLSKHYKTGEQIPEKLLDSLIATKHVNGALFALRQ 615
               DFVE PS ++E +  D+  L  +S +Y TGE IPE+LL +     +         Q
Sbjct: 590 CVT-DFVELPSILMEHFAKDRRVLLRISSNYATGEPIPEELLSAFQEQNNFLKNTETFSQ 648

Query: 616 LHFGLFDMTVHTSKDVASLDLLKLWGDLRQEISLVENGGQYTKGYDSFGHIMSDSYSAGY 675
           +   + D  +H+  D    D++ ++  L +E+ ++ +    T     FGH+    Y A Y
Sbjct: 649 IKMSMLDQRLHSITDQD--DIIAVYHGLEREMEVLVD--DQTNWCGRFGHLF--GYGASY 702

Query: 676 YGYMWAEVFATDMYRTKFAPNPLDSSVGMKYRDIVLANGG 715
           Y Y+     A  ++   F  +P   S G K+++ VL  GG
Sbjct: 703 YSYLMDRAIAAKIWDHLFKKDPFSRSSGEKFKEGVLKWGG 742

>Ecym_6099 Chr6 complement(186647..188968) [2322 bp, 773 aa] {ON}
           similar to Ashbya gossypii AFR198W
          Length = 773

 Score =  153 bits (386), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 140/550 (25%), Positives = 251/550 (45%), Gaps = 52/550 (9%)

Query: 197 KDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKN---LGEQKEFLLFSKEQLD--GVSD 251
           +DF ++G+ ++ + R +  ++   I+    EF  N   +G    F+    + L+  GVS 
Sbjct: 211 EDFEKSGIYMNPKVRERFIELSQVISIVGQEFITNTEYVG--TSFVEIETDVLEASGVSQ 268

Query: 252 TVMEQFEQVKDETTNETNYKV-TFKYPDIFPVLKMAKNAETRKTAFCGDQNKVPQNEELF 310
            V++Q    KD +     YK+ T+ Y   + +++   +   RK  +    +   +  +  
Sbjct: 269 MVLQQLS--KDLSGK--FYKIPTYGYLP-YSIIRTCPSEYIRKKVWTAMYSCPEKQIKRL 323

Query: 311 VATLKLRDELATLLGYDTYANYNLEIKMAKKQSTVXXXXXXXXXXXXXXGEKEIGILKSI 370
              ++LR +LA ++G   YA Y LE KMAK    V                +E+  L  +
Sbjct: 324 KKLVRLRQQLAHIMGKPDYATYQLEGKMAKSPKNVKNFMNTLIEYTKPLAMEELKPLADM 383

Query: 371 K-EAECKELGVPFDGRYYIWDHRYYDTKYL----KDNFNVDHEAIAEYYPIDSTIEGMLK 425
           K +  CK+           WD  Y+ +  L    +    +  +++  Y+ +   I+G+  
Sbjct: 384 KHDNHCKDASEILSS-VRPWDRDYFGSMSLLAQPRSVKTMSFQSLNCYFSLGVVIQGLSD 442

Query: 426 IYETVFKLKFVEEKDTAKKN-VWNEDVKQIAVWKMDNVKTPVFVGWIYFDLHPRDGKYGH 484
           ++++++ ++   E   AK    W+ +V++I V    N      +G IY DL  R GK  +
Sbjct: 443 LFQSIYGIRL--EPVVAKTGETWDPEVRKIQVISEANG----VIGVIYCDLFERQGKTPN 496

Query: 485 AANFGIASS---YIRE------------DGSR-SYPVTALVCNFSKSSATKPS--LLKHN 526
            A+F +  S   Y  E            D S+   PV +LVCNFS + A   S  LL+ +
Sbjct: 497 PAHFTVCCSRQIYPNETDYSTIQVGSHPDKSKFQMPVISLVCNFSHTQADDDSICLLQLS 556

Query: 527 EITTFFHELGHGIHDLVGKNRAARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKHY 586
           E+ T FHE+GH +H ++G+ +    +G      DFVE PS ++E +  D   L  +S HY
Sbjct: 557 EVETLFHEMGHAMHSMLGRTQLQNISGTRCAT-DFVELPSILMEHFAKDLRVLSRISSHY 615

Query: 587 KTGEQIPEKLLDSLIATKHVNGALFALRQLHFGLFDMTVHTSKDVASLDLLKLWGDLRQE 646
            TGE++P+++L +               Q+   + D  +H+  D  S D++ ++  L +E
Sbjct: 616 ATGERVPKEMLVNYQQENRFLEHTETFSQIKMAMLDQRLHSLTD-NSEDIVTVYHGLEKE 674

Query: 647 IS-LVENGGQYTKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSSVGMK 705
           +  LV++   +      FGH+    Y A YY Y+     A  ++   F  +P   + G K
Sbjct: 675 LQVLVDDRSNWC---GRFGHLF--GYGASYYSYLMDRAIAAKVWNHLFQHDPFSRAGGEK 729

Query: 706 YRDIVLANGG 715
           +++ VL  GG
Sbjct: 730 FKNSVLKWGG 739

>KLLA0B12397g Chr2 complement(1084129..1086468) [2340 bp, 779 aa]
           {ON} similar to uniprot|P35999 Saccharomyces cerevisiae
           YKL134C OCT1 Mitochondrial intermediate peptidase
           cleaves N-terminal residues of a subset of proteins upon
           import after their cleavage by mitochondrial processing
           peptidase (Mas1p-Mas2p) may contribute to mitochondrial
           iron homeostasis
          Length = 779

 Score =  144 bits (364), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 151/631 (23%), Positives = 273/631 (43%), Gaps = 59/631 (9%)

Query: 122 VNQLC-FLQHVSSDKEIREASNKATELLQNFEIETSLRHDLFLQFDKIWKELKPRKEEFS 180
           V  LC F++    DK+  + + +  E +  FEI   L  D+ L  D + + L+   +   
Sbjct: 136 VIDLCEFIRATHPDKKFVQTAQQCHEKM--FEIMNILNTDVRL-CDLLTQCLR-ESDVLG 191

Query: 181 HDEEQFEIYKFVEKCHKDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLG-EQKEFL 239
            D E+    K + +   DF ++G+ +  E R K   +  +I+    +F  N    +  ++
Sbjct: 192 LDSEEIRTGKILLE---DFEKSGIYMKPEIREKFIQLSQEISVIGQDFINNTEYVRSNYI 248

Query: 240 LFSKEQLDGVSDTVMEQFEQVKDETTNETNYKV-TFKYPDIFPVLKMAKNAETRKTAFCG 298
             S E +D   + ++    Q+K + T E  YKV T+ Y     +L+   +   R   +  
Sbjct: 249 KISCELMDAHVNKMV--CSQMKKDITGEY-YKVPTYGYIP-HTLLRTCSDEVIRMKIWTE 304

Query: 299 DQNKVPQNEELFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTVXXXXXXXXXXXXX 358
             +      E     + LR ELA LLG   +A Y L  KMAK    V             
Sbjct: 305 MHSCSDAQIERLTKLISLRVELAKLLGSQNFAQYQLHGKMAKTPENVSGFLESLVHSTRI 364

Query: 359 XGEKEIGILKSIKEAECKELGVPFDGRYYI-----WDHRYYDTKYL---KDNFNVDH-EA 409
               E+  L  +K +E      P      +     WD  YY +      + + ++D+ E+
Sbjct: 365 KAASELKPLAVLK-SELTGTQTPHTSEEVLELMKPWDRDYYGSIQALAQRRSSSLDNGES 423

Query: 410 IAEYYPIDSTIEGMLKIYETVFKLKFVEEKDTAKKNVWNEDVKQIAVWKMDNVKTPVFVG 469
           I+  + +   ++G+  ++E ++ +K V       +  W+ DV++I V      +    +G
Sbjct: 424 ISSSFSLGVVMQGLSDLFEKIYGIKLVPATPKTGE-TWSPDVRRIDVVD----EHDGLIG 478

Query: 470 WIYFDLHPRDGKYGHAANFGIASS---YIREDGSRS-------------YPVTALVCNF- 512
            +Y DL  R+GK  + A+F +  S   Y+ E  + +              PV +LVC+F 
Sbjct: 479 VMYCDLFEREGKTPNPAHFTVCCSRNMYLNEADTSTIQVGVNSNGQKFQLPVISLVCDFR 538

Query: 513 ------SKSSATKPSLLKHNEITTFFHELGHGIHDLVGKNRAARFNGPGATPWDFVEAPS 566
                       +  LL+ NEI T FHE+GH +H ++G+ +    +G      DFVE PS
Sbjct: 539 WVEVNMGDGKHQQMCLLQLNEIETLFHEMGHAMHSMLGRTQLQNVSGTRCAT-DFVELPS 597

Query: 567 QMLEFYTWDKNALQSLSKHYKTGEQIPEKLLDSLIATKHVNGALFALRQLHFGLFDMTVH 626
            ++E +  D   L S+S HYKTG+ +  ++L +               Q+     D  +H
Sbjct: 598 ILMEHFARDTRVLSSISSHYKTGKSLDVEVLKNHQLENQFLQNCETFSQIKMSFLDQELH 657

Query: 627 TSKDV--ASLDLLKLWGDLRQEISLVENGGQYTKGYDSFGHIMSDSYSAGYYGYMWAEVF 684
                   S+D++ ++  L + ++++ +      G   FGH+    Y A YY Y++    
Sbjct: 658 NLDHTTDGSIDVIAIYHRLERRLAVLPDDQSNWCG--KFGHLF--GYGASYYSYLFDRAI 713

Query: 685 ATDMYRTKFAPNPLDSSVGMKYRDIVLANGG 715
           A+ ++   F  +P + + G K+++ +L  GG
Sbjct: 714 ASKIWDHLFEQDPFNRTNGTKFKEGLLQWGG 744

>ZYRO0F13002g Chr6 complement(1061279..1062673) [1395 bp, 464 aa]
           {ON} similar to uniprot|P38169 Saccharomyces cerevisiae
           YBL098W BNA4 Kynurenine 3-mono oxygenase required for
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway
          Length = 464

 Score = 38.5 bits (88), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 53/112 (47%), Gaps = 11/112 (9%)

Query: 167 KIWKELKPRKEEFSHD---EEQFEIYKFVEKCHKDFVRAGLN---LSEEDRNKVKDIKIK 220
           ++ +++ P K    HD   E++ +IY    +C     RA LN   L E DR  + D+K  
Sbjct: 72  RVLRDVIPMKGRMIHDLQGEQESQIYGLFGECINSIDRAVLNNFLLDELDRCNI-DVKFG 130

Query: 221 IASNSLEFSKNLGEQKEFLLFSKEQLDGVSDTVMEQFEQVKDETTNETNYKV 272
                 +F    G+Q++  +FS+   DGV +T+   F    D   + T Y++
Sbjct: 131 YKLVKAKF----GDQRQTCIFSQMGQDGVIETIECDFIVGCDGAFSSTRYQM 178

>TDEL0C01060 Chr3 (179005..180072) [1068 bp, 355 aa] {ON} Anc_8.77
           YPL011C
          Length = 355

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 24/50 (48%)

Query: 102 PSIDNLVKPYMNHENSIGLMVNQLCFLQHVSSDKEIREASNKATELLQNF 151
           PSI  L    +   N I L  NQ+       SD E  EAS KATELLQ  
Sbjct: 205 PSISGLKHSVLERPNDINLSNNQVLPNSWEPSDDEDNEASRKATELLQRL 254

>KNAG0F03500 Chr6 (661869..663992) [2124 bp, 707 aa] {ON} Anc_7.463
           YJR092W
          Length = 707

 Score = 32.7 bits (73), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 12/46 (26%), Positives = 30/46 (65%)

Query: 118 IGLMVNQLCFLQHVSSDKEIREASNKATELLQNFEIETSLRHDLFL 163
           +GL+  + CF++  S+++ I + S++A  +++ +  + S+ HD +L
Sbjct: 547 VGLLTVEACFIERTSNEECIPDHSDRAHRIVEKYMKQCSVTHDGYL 592

>KNAG0B06730 Chr2 (1330382..1332172) [1791 bp, 596 aa] {ON}
           Anc_4.355 YJR131W
          Length = 596

 Score = 31.6 bits (70), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 3/60 (5%)

Query: 101 NPSIDNLVKPYMNHENSIGLMVNQLCFLQHVSSDKEIREASNKATELLQNFEIETSLRHD 160
           +P+ D  +KP   H       V  + FL H++ DK+ RE      E+L++FE  T +  D
Sbjct: 463 SPTGDFYIKPLDAHNLQRPETVESIMFLYHLTGDKKYREW---GAEILESFEKNTCIHCD 519

>TDEL0G04370 Chr7 complement(789063..791345) [2283 bp, 760 aa] {ON}
           Anc_6.32 YOL006C
          Length = 760

 Score = 31.6 bits (70), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 68/149 (45%), Gaps = 21/149 (14%)

Query: 116 NSIGLMVNQLCFLQHVSSDKEIREASNKATELLQNFEIETSLRHDLFLQFDKIWKELKPR 175
           N+    V  LC  Q  S  K   ++  KA++ ++  E +        LQ DK  K++K R
Sbjct: 538 NAANRTVAILCNHQR-SVTKTHAQSVQKASDKIRELEWQKIRLKKAILQLDK--KQMKER 594

Query: 176 KEEFSH-----DEEQFEIYKF-----VEKCHKDFVRAGLNLSEEDRNKVKDIKIKIASNS 225
            + F        E++  I+K      VEKCHK F R      + D+ K +++++   S+ 
Sbjct: 595 PKFFEEVEDITKEDEMAIHKRIIEREVEKCHKKFAR------DNDKRKFENMELLKESDL 648

Query: 226 LEFSKNLGEQKEFLLFSKEQLDGVSDTVM 254
            E+   + EQ+  L F +E   GV +  M
Sbjct: 649 KEWLDKVEEQR--LNFEQELKTGVVELKM 675

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 80,266,646
Number of extensions: 3672792
Number of successful extensions: 12285
Number of sequences better than 10.0: 135
Number of HSP's gapped: 12584
Number of HSP's successfully gapped: 140
Length of query: 744
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 627
Effective length of database: 40,065,477
Effective search space: 25121054079
Effective search space used: 25121054079
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 70 (31.6 bits)