Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0C002501.8ON94943912e-50
NCAS0B090801.8ON93922576e-30
TPHA0E039801.8ON86852541e-29
NDAI0A001701.8ON96972515e-29
CAGL0B00396g1.8ON88712453e-28
TBLA0A049601.8ON96962463e-28
Kpol_2002.111.8ON86852444e-28
KLTH0F00550g1.8ON82742435e-28
KAFR0D001701.8ON90942438e-28
Kwal_33.130161.8ON82742411e-27
TDEL0C069401.8ON86842402e-27
SAKL0C00528g1.8ON110732422e-27
ZYRO0F18414g1.8ON87742383e-27
Ecym_10101.8ON82712366e-27
AFR743W1.8ON82802323e-26
YCL057C-A (MOS1)1.8ON97892316e-26
Suva_3.1551.8ON97932281e-25
Smik_3.171.8ON97932282e-25
Skud_3.61.8ON97702264e-25
KLLA0C00550g1.8ON82732081e-22
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0C00250
         (94 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0C00250 Chr3 complement(38677..38961) [285 bp, 94 aa] {ON} A...   155   2e-50
NCAS0B09080 Chr2 (1744147..1744428) [282 bp, 93 aa] {ON} Anc_1.8...   103   6e-30
TPHA0E03980 Chr5 (837161..837421) [261 bp, 86 aa] {ON} Anc_1.8 Y...   102   1e-29
NDAI0A00170 Chr1 complement(13975..14265) [291 bp, 96 aa] {ON} A...   101   5e-29
CAGL0B00396g Chr2 complement(24498..24764) [267 bp, 88 aa] {ON} ...    99   3e-28
TBLA0A04960 Chr1 complement(1220183..1220473) [291 bp, 96 aa] {O...    99   3e-28
Kpol_2002.11 s2002 complement(19864..20124) [261 bp, 86 aa] {ON}...    99   4e-28
KLTH0F00550g Chr6 complement(42092..42340) [249 bp, 82 aa] {ON} ...    98   5e-28
KAFR0D00170 Chr4 complement(18220..18492) [273 bp, 90 aa] {ON} A...    98   8e-28
Kwal_33.13016 s33 complement(41816..42064) [249 bp, 82 aa] {ON} ...    97   1e-27
TDEL0C06940 Chr3 (1261913..1262173) [261 bp, 86 aa] {ON} Anc_1.8...    97   2e-27
SAKL0C00528g Chr3 complement(47403..47735) [333 bp, 110 aa] {ON}...    98   2e-27
ZYRO0F18414g Chr6 (1521776..1522039) [264 bp, 87 aa] {ON} simila...    96   3e-27
Ecym_1010 Chr1 complement(19126..19374) [249 bp, 82 aa] {ON} sim...    96   6e-27
AFR743W Chr6 (1800868..1801116) [249 bp, 82 aa] {ON} Syntenic ho...    94   3e-26
YCL057C-A Chr3 complement(24032..24325) [294 bp, 97 aa] {ON}  MO...    94   6e-26
Suva_3.155 Chr3 complement(233792..234085) [294 bp, 97 aa] {ON} ...    92   1e-25
Smik_3.17 Chr3 complement(25487..25777) [291 bp, 97 aa] {ON} YCL...    92   2e-25
Skud_3.6 Chr3 complement(12034..12324) [291 bp, 97 aa] {ON} YCL0...    92   4e-25
KLLA0C00550g Chr3 complement(40901..41149) [249 bp, 82 aa] {ON} ...    85   1e-22

>KNAG0C00250 Chr3 complement(38677..38961) [285 bp, 94 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 94

 Score =  155 bits (391), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 79/94 (84%)

Query: 1  MSETTATDGATQNNNGQLATKIDRSLLNDKWDVVLSNMLXXXXXXXXXXXXXXXLLFRRR 60
          MSETTATDGATQNNNGQLATKIDRSLLNDKWDVVLSNML               LLFRRR
Sbjct: 1  MSETTATDGATQNNNGQLATKIDRSLLNDKWDVVLSNMLVKVGMGFGVGVVTSVLLFRRR 60

Query: 61 AFPVWLGIGFGVGRGYSEGDAIFRSTSGIRTVKV 94
          AFPVWLGIGFGVGRGYSEGDAIFRSTSGIRTVKV
Sbjct: 61 AFPVWLGIGFGVGRGYSEGDAIFRSTSGIRTVKV 94

>NCAS0B09080 Chr2 (1744147..1744428) [282 bp, 93 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 93

 Score =  103 bits (257), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 52/92 (56%), Positives = 60/92 (65%), Gaps = 7/92 (7%)

Query: 10 ATQNNNGQ-------LATKIDRSLLNDKWDVVLSNMLXXXXXXXXXXXXXXXLLFRRRAF 62
          +T NN  Q       +   IDRS+LNDKWDVVLSNML               + F+RR F
Sbjct: 2  STDNNPNQSTPTSTAVTPTIDRSILNDKWDVVLSNMLVKVGLGFSVGVVASVIFFKRRTF 61

Query: 63 PVWLGIGFGVGRGYSEGDAIFRSTSGIRTVKV 94
          PVWLGIGFGVGRGY+EGDAIFRS +G+RT KV
Sbjct: 62 PVWLGIGFGVGRGYAEGDAIFRSPAGLRTAKV 93

>TPHA0E03980 Chr5 (837161..837421) [261 bp, 86 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 86

 Score =  102 bits (254), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 49/85 (57%), Positives = 59/85 (69%)

Query: 10 ATQNNNGQLATKIDRSLLNDKWDVVLSNMLXXXXXXXXXXXXXXXLLFRRRAFPVWLGIG 69
          + Q NN  L     +S+LNDKWDVVLSNML               LLF+RRAFPVWLGIG
Sbjct: 2  SEQKNNNNLELTSPKSILNDKWDVVLSNMLVKTGLGFGVGVVTSILLFKRRAFPVWLGIG 61

Query: 70 FGVGRGYSEGDAIFRSTSGIRTVKV 94
          FGVGRGYS+GDAIFRS +G+R+ ++
Sbjct: 62 FGVGRGYSDGDAIFRSAAGLRSTRI 86

>NDAI0A00170 Chr1 complement(13975..14265) [291 bp, 96 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 96

 Score =  101 bits (251), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 53/97 (54%), Positives = 62/97 (63%), Gaps = 4/97 (4%)

Query: 1  MSET---TATDGATQNNNGQLATKIDRSLLNDKWDVVLSNMLXXXXXXXXXXXXXXXLLF 57
          MSE    T    A      QLAT ID+S+LNDKWD+VLSN L               + F
Sbjct: 1  MSEQVNKTEHQNAVAPPQQQLAT-IDKSILNDKWDIVLSNTLVKVGLGFGVGVVTSVIFF 59

Query: 58 RRRAFPVWLGIGFGVGRGYSEGDAIFRSTSGIRTVKV 94
          +RR FPVWLGIGFG GRGY+EGDAIFRS++GIR+V V
Sbjct: 60 KRRTFPVWLGIGFGAGRGYAEGDAIFRSSAGIRSVNV 96

>CAGL0B00396g Chr2 complement(24498..24764) [267 bp, 88 aa] {ON}
          highly similar to uniprot|Q96VH5 Saccharomyces
          cerevisiae YCL057ca
          Length = 88

 Score = 99.0 bits (245), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 46/71 (64%), Positives = 54/71 (76%)

Query: 24 RSLLNDKWDVVLSNMLXXXXXXXXXXXXXXXLLFRRRAFPVWLGIGFGVGRGYSEGDAIF 83
          RS+LNDKWDVVLSNM+               L F+RR+FPVWLG+GFG GRGYSEGDAIF
Sbjct: 18 RSILNDKWDVVLSNMIVKMGLGFGVGVVTSVLFFKRRSFPVWLGVGFGAGRGYSEGDAIF 77

Query: 84 RSTSGIRTVKV 94
          RST+G+R+VKV
Sbjct: 78 RSTAGLRSVKV 88

>TBLA0A04960 Chr1 complement(1220183..1220473) [291 bp, 96 aa]
          {ON} Anc_1.8 YCL057C-A
          Length = 96

 Score = 99.4 bits (246), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 63/96 (65%), Gaps = 2/96 (2%)

Query: 1  MSETTATDGATQNNNGQLATKI--DRSLLNDKWDVVLSNMLXXXXXXXXXXXXXXXLLFR 58
          MSE  A    T       +T +  +RS+LNDKWD+V+SNML               + F+
Sbjct: 1  MSEQIAQQTTTPTTTESASTAVTSNRSILNDKWDIVISNMLVKTTFGFGAGVLASVIFFK 60

Query: 59 RRAFPVWLGIGFGVGRGYSEGDAIFRSTSGIRTVKV 94
          RRAFPVWLG+GFG+GRGYSEGDAIFRST+G+R+ +V
Sbjct: 61 RRAFPVWLGVGFGLGRGYSEGDAIFRSTAGLRSFQV 96

>Kpol_2002.11 s2002 complement(19864..20124) [261 bp, 86 aa] {ON}
          complement(19864..20124) [261 nt, 87 aa]
          Length = 86

 Score = 98.6 bits (244), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 57/85 (67%)

Query: 10 ATQNNNGQLATKIDRSLLNDKWDVVLSNMLXXXXXXXXXXXXXXXLLFRRRAFPVWLGIG 69
          + Q+   Q+ +   RS+LNDKWDVVLSN L               +LF+RRAFPVWLGIG
Sbjct: 2  SQQSQELQITSAPTRSILNDKWDVVLSNFLVKTSLGFGAGVLASVILFKRRAFPVWLGIG 61

Query: 70 FGVGRGYSEGDAIFRSTSGIRTVKV 94
          FG+GRGYSEGDAIFRS +G+R   V
Sbjct: 62 FGIGRGYSEGDAIFRSAAGLRKSTV 86

>KLTH0F00550g Chr6 complement(42092..42340) [249 bp, 82 aa] {ON}
          similar to uniprot|Q96VH5 Saccharomyces cerevisiae
          YCL057C-A
          Length = 82

 Score = 98.2 bits (243), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 45/74 (60%), Positives = 56/74 (75%)

Query: 20 TKIDRSLLNDKWDVVLSNMLXXXXXXXXXXXXXXXLLFRRRAFPVWLGIGFGVGRGYSEG 79
          +   RSLLNDKWDVVLSN++               LLF+RRAFPVW+G+GFG+GRGY+EG
Sbjct: 8  SPTSRSLLNDKWDVVLSNLVVKTGLGFGAGVVASVLLFKRRAFPVWIGVGFGLGRGYAEG 67

Query: 80 DAIFRSTSGIRTVK 93
          DAIFRS++G+RTVK
Sbjct: 68 DAIFRSSAGLRTVK 81

>KAFR0D00170 Chr4 complement(18220..18492) [273 bp, 90 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 90

 Score = 98.2 bits (243), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 60/94 (63%), Gaps = 4/94 (4%)

Query: 1  MSETTATDGATQNNNGQLATKIDRSLLNDKWDVVLSNMLXXXXXXXXXXXXXXXLLFRRR 60
          MSE        + +N      IDRS+LNDKWD+VLSNML               + F+RR
Sbjct: 1  MSEEDKVGKPAEYSN----NSIDRSILNDKWDLVLSNMLVKVGLGFGVGVVTSVIFFKRR 56

Query: 61 AFPVWLGIGFGVGRGYSEGDAIFRSTSGIRTVKV 94
          AFPVWLGIG+G GR YSEGDAIFRS +G+R+V++
Sbjct: 57 AFPVWLGIGYGFGRAYSEGDAIFRSNAGLRSVQI 90

>Kwal_33.13016 s33 complement(41816..42064) [249 bp, 82 aa] {ON}
          YCL057C-A - Hypothetical ORF, has similarity to
          proteins in S. pombe, C. elegans, D. melanogaster.
          [contig 123] FULL
          Length = 82

 Score = 97.4 bits (241), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 45/74 (60%), Positives = 55/74 (74%)

Query: 20 TKIDRSLLNDKWDVVLSNMLXXXXXXXXXXXXXXXLLFRRRAFPVWLGIGFGVGRGYSEG 79
            + RSLLNDKWDVVLSN++               LLF+RRA PVW+G+GFG+GRGYSEG
Sbjct: 8  APVSRSLLNDKWDVVLSNLVVKVGLGFGAGVVASVLLFKRRAAPVWIGVGFGLGRGYSEG 67

Query: 80 DAIFRSTSGIRTVK 93
          DAIFRS++G+RTVK
Sbjct: 68 DAIFRSSAGLRTVK 81

>TDEL0C06940 Chr3 (1261913..1262173) [261 bp, 86 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 86

 Score = 97.1 bits (240), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 58/84 (69%), Gaps = 1/84 (1%)

Query: 11 TQNNNGQLATKI-DRSLLNDKWDVVLSNMLXXXXXXXXXXXXXXXLLFRRRAFPVWLGIG 69
          ++ +  QL      RS+LNDKWDVVLSNML               L F+RRAFPVWLGIG
Sbjct: 2  SEKSQAQLQVAAPSRSILNDKWDVVLSNMLVKTGLGFGVGVVGSVLFFKRRAFPVWLGIG 61

Query: 70 FGVGRGYSEGDAIFRSTSGIRTVK 93
          FG+GRGY+EGDAIFRS +G+R+VK
Sbjct: 62 FGLGRGYAEGDAIFRSAAGLRSVK 85

>SAKL0C00528g Chr3 complement(47403..47735) [333 bp, 110 aa] {ON}
           similar to uniprot|Q96VH5 Saccharomyces cerevisiae
           YCL057C-A
          Length = 110

 Score = 97.8 bits (242), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 57/73 (78%)

Query: 20  TKIDRSLLNDKWDVVLSNMLXXXXXXXXXXXXXXXLLFRRRAFPVWLGIGFGVGRGYSEG 79
           +K ++S+LNDKWDVVLSN++               LLF+RRAFPVWLG+GFG+GRGY+EG
Sbjct: 36  SKPNKSILNDKWDVVLSNVVVKTGLGFGAGIVASVLLFKRRAFPVWLGVGFGLGRGYAEG 95

Query: 80  DAIFRSTSGIRTV 92
           DAIFRS++G+RTV
Sbjct: 96  DAIFRSSAGLRTV 108

>ZYRO0F18414g Chr6 (1521776..1522039) [264 bp, 87 aa] {ON} similar
          to uniprot|Q96VH5 Saccharomyces cerevisiae YCL057C-A
          Length = 87

 Score = 96.3 bits (238), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 45/74 (60%), Positives = 55/74 (74%)

Query: 20 TKIDRSLLNDKWDVVLSNMLXXXXXXXXXXXXXXXLLFRRRAFPVWLGIGFGVGRGYSEG 79
          T  ++S+LNDKWDVVLSN+L               L+F+RRAFPVWLGIGFG+GRGY+EG
Sbjct: 13 TAPNKSILNDKWDVVLSNLLVKSGLGFGVGVVASVLIFKRRAFPVWLGIGFGLGRGYAEG 72

Query: 80 DAIFRSTSGIRTVK 93
          DAIFRS +G+RT K
Sbjct: 73 DAIFRSAAGLRTSK 86

>Ecym_1010 Chr1 complement(19126..19374) [249 bp, 82 aa] {ON}
          similar to Ashbya gossypii AFR743W
          Length = 82

 Score = 95.5 bits (236), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 44/71 (61%), Positives = 53/71 (74%)

Query: 23 DRSLLNDKWDVVLSNMLXXXXXXXXXXXXXXXLLFRRRAFPVWLGIGFGVGRGYSEGDAI 82
           RS+LNDKWDVVLSN++               L F+RRAFPVWLGIGFG+GRGY+EGDAI
Sbjct: 11 SRSILNDKWDVVLSNLVVKAGLGFSVGVLASVLFFKRRAFPVWLGIGFGLGRGYAEGDAI 70

Query: 83 FRSTSGIRTVK 93
          FRS +G+RT+K
Sbjct: 71 FRSHAGLRTMK 81

>AFR743W Chr6 (1800868..1801116) [249 bp, 82 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YCL057C-A
          Length = 82

 Score = 94.0 bits (232), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 57/80 (71%), Gaps = 1/80 (1%)

Query: 15 NGQL-ATKIDRSLLNDKWDVVLSNMLXXXXXXXXXXXXXXXLLFRRRAFPVWLGIGFGVG 73
          +GQL  +   RS+LNDKWDVVLSN++               L F+RRAFPVWLG+GFG+G
Sbjct: 2  SGQLEVSAPSRSILNDKWDVVLSNLVVKTGLGFGAGVFASVLFFKRRAFPVWLGVGFGLG 61

Query: 74 RGYSEGDAIFRSTSGIRTVK 93
          RGY+EGDAIFRS +G+R V+
Sbjct: 62 RGYAEGDAIFRSHAGLRAVR 81

>YCL057C-A Chr3 complement(24032..24325) [294 bp, 97 aa] {ON}
          MOS1Mitochondrial protein essential for proper inner
          membrane organization; conserved component of the
          mitochondrial inner membrane organizing system (MICOS,
          MINOS, or MitOS), a scaffold-like structure on the
          intermembrane space side of the inner membrane which
          has a role in the maintenance of crista junctions and
          inner membrane architecture; ortholog of human MINOS1
          Length = 97

 Score = 93.6 bits (231), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 47/89 (52%), Positives = 57/89 (64%), Gaps = 4/89 (4%)

Query: 6  ATDGATQNNNGQLATKIDRSLLNDKWDVVLSNMLXXXXXXXXXXXXXXXLLFRRRAFPVW 65
          +T     N NG   + I    L+ KWD+VLSNML               L F+RRAFPVW
Sbjct: 13 STPSKDSNKNGSSVSTI----LDTKWDIVLSNMLVKTAMGFGVGVFTSVLFFKRRAFPVW 68

Query: 66 LGIGFGVGRGYSEGDAIFRSTSGIRTVKV 94
          LGIGFGVGRGY+EGDAIFRS++G+R+ KV
Sbjct: 69 LGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97

>Suva_3.155 Chr3 complement(233792..234085) [294 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score = 92.4 bits (228), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 57/93 (61%), Gaps = 4/93 (4%)

Query: 2  SETTATDGATQNNNGQLATKIDRSLLNDKWDVVLSNMLXXXXXXXXXXXXXXXLLFRRRA 61
          +   +T     N NG   + +    L+ KWD+VLSNML               L F+RRA
Sbjct: 9  APAKSTPSTNSNENGSAVSTV----LDAKWDIVLSNMLVKTAMGFGIGVFTSVLFFKRRA 64

Query: 62 FPVWLGIGFGVGRGYSEGDAIFRSTSGIRTVKV 94
          FP WLGIGFGVGRGY+EGDAIFRS++G+R+ KV
Sbjct: 65 FPAWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97

>Smik_3.17 Chr3 complement(25487..25777) [291 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score = 92.4 bits (228), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 62/93 (66%), Gaps = 6/93 (6%)

Query: 2  SETTATDGATQNNNGQLATKIDRSLLNDKWDVVLSNMLXXXXXXXXXXXXXXXLLFRRRA 61
          ++ T +  +++N +G        ++L+ KWD+VLSNML               L F+RRA
Sbjct: 11 AKVTPSKDSSKNGSGV------STVLDTKWDIVLSNMLVKTAMGFGVGVFTSVLFFKRRA 64

Query: 62 FPVWLGIGFGVGRGYSEGDAIFRSTSGIRTVKV 94
          FPVWLGIGFGVGRGY+EGDAIFRS++G+R+ KV
Sbjct: 65 FPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97

>Skud_3.6 Chr3 complement(12034..12324) [291 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score = 91.7 bits (226), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 41/70 (58%), Positives = 52/70 (74%)

Query: 25 SLLNDKWDVVLSNMLXXXXXXXXXXXXXXXLLFRRRAFPVWLGIGFGVGRGYSEGDAIFR 84
          ++L+ KWD+V+SNML               L F+RRAFPVWLGIGFGVGRGY+EGDAIFR
Sbjct: 28 TILDAKWDIVMSNMLVKTAMGFGVGVFTSVLFFKRRAFPVWLGIGFGVGRGYAEGDAIFR 87

Query: 85 STSGIRTVKV 94
          S++G+R+ KV
Sbjct: 88 SSAGLRSSKV 97

>KLLA0C00550g Chr3 complement(40901..41149) [249 bp, 82 aa] {ON}
          similar to uniprot|Q96VH5 Saccharomyces cerevisiae
          YCL057C-A
          Length = 82

 Score = 84.7 bits (208), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 51/73 (69%)

Query: 20 TKIDRSLLNDKWDVVLSNMLXXXXXXXXXXXXXXXLLFRRRAFPVWLGIGFGVGRGYSEG 79
          TK   S+L+ +WDVVLSN++               L F+RRAFPVW+G+GFG+GRGY+EG
Sbjct: 8  TKAVPSILDKRWDVVLSNVVAKTALGAGVGIVASVLFFKRRAFPVWVGVGFGLGRGYAEG 67

Query: 80 DAIFRSTSGIRTV 92
          DAIFR+ +G+R V
Sbjct: 68 DAIFRTNAGLRKV 80

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,813,363
Number of extensions: 187930
Number of successful extensions: 478
Number of sequences better than 10.0: 20
Number of HSP's gapped: 478
Number of HSP's successfully gapped: 20
Length of query: 94
Length of database: 53,481,399
Length adjustment: 65
Effective length of query: 29
Effective length of database: 46,028,109
Effective search space: 1334815161
Effective search space used: 1334815161
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)