Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0C002401.7ON1261266463e-88
Kpol_2002.101.7ON1111191504e-13
YCL058W-A (ADF1)1.7ON1131091504e-13
Skud_3.51.7ON113951505e-13
Suva_3.1541.7ON1131031402e-11
KAFR0D001601.7ON1111111392e-11
TBLA0A049501.7ON113951281e-09
SAKL0C00506g1.7ON105941262e-09
NCAS0B090901.7ON1191131262e-09
Smik_3.161.7ON1131091243e-09
TPHA0E039901.7ON1161281211e-08
ZYRO0F18436g1.7ON112971183e-08
Kwal_YGOB_YCL058W-A1.7ON1051101095e-07
Kwal_33.13015singletonOFF1051101095e-07
CAGL0B00374g1.7ON1211031053e-06
KLTH0F00528g1.7ON10489955e-05
TDEL0C069501.7ON111111903e-04
NDAI0A001601.7ON12399750.044
NCAS0A090501.347ON40383700.40
KLTH0G16764g8.99ON71050680.73
YDR014W (RAD61)3.235ON64771671.2
AFR743CA1.7ON10195631.6
NCAS0H018805.395ON57365642.6
KLTH0C06908g7.382ON10723613.0
AFL186W2.354ON12470613.8
KLLA0C00528g1.7ON11644614.4
TBLA0I008807.445ON57867608.2
Ecym_46567.445ON54263608.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0C00240
         (126 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0C00240 Chr3 (38093..38473) [381 bp, 126 aa] {ON} Anc_1.7 YC...   253   3e-88
Kpol_2002.10 s2002 (19162..19497) [336 bp, 111 aa] {ON} (19162.....    62   4e-13
YCL058W-A Chr3 (23584..23925) [342 bp, 113 aa] {ON}  ADF1Transcr...    62   4e-13
Skud_3.5 Chr3 (11576..11917) [342 bp, 113 aa] {ON} YCL058W-A (REAL)    62   5e-13
Suva_3.154 Chr3 (233345..233686) [342 bp, 113 aa] {ON} YCL058W-A...    59   2e-11
KAFR0D00160 Chr4 (17823..18158) [336 bp, 111 aa] {ON} Anc_1.7 YC...    58   2e-11
TBLA0A04950 Chr1 (1219399..1219740) [342 bp, 113 aa] {ON} Anc_1....    54   1e-09
SAKL0C00506g Chr3 (46439..46756) [318 bp, 105 aa] {ON} weakly si...    53   2e-09
NCAS0B09090 Chr2 complement(1744560..1744919) [360 bp, 119 aa] {...    53   2e-09
Smik_3.16 Chr3 (25034..25375) [342 bp, 113 aa] {ON} YCL058W-A (R...    52   3e-09
TPHA0E03990 Chr5 complement(837690..838040) [351 bp, 116 aa] {ON...    51   1e-08
ZYRO0F18436g Chr6 complement(1522314..1522652) [339 bp, 112 aa] ...    50   3e-08
Kwal_YGOB_YCL058W-A s33 (41330..41647) [318 bp, 105 aa] {ON} ANN...    47   5e-07
Kwal_33.13015 s33 (41330..41647) [318 bp, 105 aa] {OFF} [contig ...    47   5e-07
CAGL0B00374g Chr2 (23693..24058) [366 bp, 121 aa] {ON} similar t...    45   3e-06
KLTH0F00528g Chr6 (41595..41909) [315 bp, 104 aa] {ON} conserved...    41   5e-05
TDEL0C06950 Chr3 complement(1262284..1262619) [336 bp, 111 aa] {...    39   3e-04
NDAI0A00160 Chr1 (13398..13769) [372 bp, 123 aa] {ON} Anc_1.7 YC...    33   0.044
NCAS0A09050 Chr1 complement(1791486..1792697) [1212 bp, 403 aa] ...    32   0.40 
KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]...    31   0.73 
YDR014W Chr4 (474046..475989) [1944 bp, 647 aa] {ON}  RAD61Subun...    30   1.2  
AFR743CA Chr6 complement(1801173..1801478) [306 bp, 101 aa] {ON}...    29   1.6  
NCAS0H01880 Chr8 complement(361743..363464) [1722 bp, 573 aa] {O...    29   2.6  
KLTH0C06908g Chr3 complement(599791..600080,600141..600174) [324...    28   3.0  
AFL186W Chr6 (92866..93240) [375 bp, 124 aa] {ON} Syntenic homol...    28   3.8  
KLLA0C00528g Chr3 (40060..40410) [351 bp, 116 aa] {ON} no simila...    28   4.4  
TBLA0I00880 Chr9 (164402..166138) [1737 bp, 578 aa] {ON} Anc_7.4...    28   8.2  
Ecym_4656 Chr4 complement(1282201..1283829) [1629 bp, 542 aa] {O...    28   8.8  

>KNAG0C00240 Chr3 (38093..38473) [381 bp, 126 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 126

 Score =  253 bits (646), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 126/126 (100%), Positives = 126/126 (100%)

Query: 1   MAGSKTVLGRKSKRNDTKRVQKHKKRGSPKTIPLSERKRNKLQVEKLNRPTNGMIEGNAV 60
           MAGSKTVLGRKSKRNDTKRVQKHKKRGSPKTIPLSERKRNKLQVEKLNRPTNGMIEGNAV
Sbjct: 1   MAGSKTVLGRKSKRNDTKRVQKHKKRGSPKTIPLSERKRNKLQVEKLNRPTNGMIEGNAV 60

Query: 61  DIRNEIDKHNQEVEGQNRTVHRSLDVEKLAQDKSKDRIIQEQVAKKQKETDQSMLAQIEM 120
           DIRNEIDKHNQEVEGQNRTVHRSLDVEKLAQDKSKDRIIQEQVAKKQKETDQSMLAQIEM
Sbjct: 61  DIRNEIDKHNQEVEGQNRTVHRSLDVEKLAQDKSKDRIIQEQVAKKQKETDQSMLAQIEM 120

Query: 121 ISGFSL 126
           ISGFSL
Sbjct: 121 ISGFSL 126

>Kpol_2002.10 s2002 (19162..19497) [336 bp, 111 aa] {ON}
           (19162..19497) [336 nt, 112 aa]
          Length = 111

 Score = 62.4 bits (150), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 44/119 (36%), Positives = 68/119 (57%), Gaps = 21/119 (17%)

Query: 8   LGRKSKRNDTKRVQKHKKRGSPKTIPLSERKRNKLQVEKLNRPTNGMIEGNAVDIRNEID 67
           +G+KSKR +               I  SE+KRNK+++EK+N+   G++  + + + NE  
Sbjct: 14  VGKKSKRKNV--------------ISQSEKKRNKIKMEKINKE--GILPSDILQLNNET- 56

Query: 68  KHNQEVEGQNRTVHRSLDVEKLAQDKSKDRIIQEQVAKKQKETDQSMLAQIEMISGFSL 126
             N + EG      R+L+ +KL QD  KDR    ++   +KETD SML QIE+++GFSL
Sbjct: 57  -RNGQSEGNK---ERALESQKLQQDNVKDRETIAKIEASKKETDDSMLKQIELMTGFSL 111

>YCL058W-A Chr3 (23584..23925) [342 bp, 113 aa] {ON}
           ADF1Transcriptional repressor encoded by the antisense
           strand of the FYV5 gene; negatively regulates
           transcription of FYV5 by binding to the promoter on the
           sense strand
          Length = 113

 Score = 62.4 bits (150), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 65/109 (59%), Gaps = 14/109 (12%)

Query: 18  KRVQKHKKRGSPKTIPLSERKRNKLQVEKLNRPTNGMIEGNAVDIRNEIDKHNQEVEGQN 77
           K+VQK +      +I  +ERKR KLQVEKLN+ +  MI      +R    +   +++ + 
Sbjct: 19  KKVQKKR------SISTAERKRTKLQVEKLNKSSETMI---PTLLREASTQEPAKLKAET 69

Query: 78  RTVHRSLDVEKLAQDKSKDRIIQEQVAKKQKETDQSMLAQIEMISGFSL 126
                +L  E+L +D+ KD  ++EQ+  ++ +T+ SML QIEMISGFSL
Sbjct: 70  -----TLKAEELIKDQEKDSKVREQIRTEKSKTNDSMLKQIEMISGFSL 113

>Skud_3.5 Chr3 (11576..11917) [342 bp, 113 aa] {ON} YCL058W-A (REAL)
          Length = 113

 Score = 62.4 bits (150), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 56/95 (58%), Gaps = 8/95 (8%)

Query: 32  IPLSERKRNKLQVEKLNRPTNGMIEGNAVDIRNEIDKHNQEVEGQNRTVHRSLDVEKLAQ 91
           I  +ERKR KLQVEKLN+ +  MI          + +     E   +    +L  E+L +
Sbjct: 27  ISTAERKRTKLQVEKLNKSSEIMIP--------TLLRETATQEPTKKRAKSTLKAEELVK 78

Query: 92  DKSKDRIIQEQVAKKQKETDQSMLAQIEMISGFSL 126
           D++KD  ++EQ+  ++ +T+ SML QIEMISGFSL
Sbjct: 79  DQAKDCKVREQIQTEKSKTNDSMLEQIEMISGFSL 113

>Suva_3.154 Chr3 (233345..233686) [342 bp, 113 aa] {ON} YCL058W-A
           (REAL)
          Length = 113

 Score = 58.5 bits (140), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 61/103 (59%), Gaps = 8/103 (7%)

Query: 24  KKRGSPKTIPLSERKRNKLQVEKLNRPTNGMIEGNAVDIRNEIDKHNQEVEGQNRTVHRS 83
           KK+   + I  +E KR KLQVE+LN+ +  MI      +  E  K + +     +    +
Sbjct: 19  KKQQKKRPISTAEMKRTKLQVERLNKSSETMIP----TLLKEASKQDLD----KKKTRST 70

Query: 84  LDVEKLAQDKSKDRIIQEQVAKKQKETDQSMLAQIEMISGFSL 126
           L+ E+L +D+++D  ++E +  ++ +T+ SML QIEMISGFSL
Sbjct: 71  LEAEELVKDQARDSKVREHIETEKSKTNDSMLKQIEMISGFSL 113

>KAFR0D00160 Chr4 (17823..18158) [336 bp, 111 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 111

 Score = 58.2 bits (139), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/111 (38%), Positives = 67/111 (60%), Gaps = 16/111 (14%)

Query: 19  RVQKHKKRGSPKTIPLSERKRNKLQVEKLNRPTNGMIEGNAVDIRNEIDKHNQEVEGQNR 78
           R++K K R +   I  SERK+NKL VEK N+ T          I N + + N++++   R
Sbjct: 14  RIKKIKSRKN--VISQSERKKNKLIVEKFNQQT----------ITN-VQELNKDLKKDKR 60

Query: 79  TVHRS---LDVEKLAQDKSKDRIIQEQVAKKQKETDQSMLAQIEMISGFSL 126
            + ++   L+ +KL  D+++D  +++ +  K KET+ SML QIEMISGFSL
Sbjct: 61  RLSKTKNALETKKLLHDQARDHEVKQNIETKLKETEDSMLKQIEMISGFSL 111

>TBLA0A04950 Chr1 (1219399..1219740) [342 bp, 113 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 113

 Score = 53.9 bits (128), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/95 (36%), Positives = 58/95 (61%), Gaps = 10/95 (10%)

Query: 32  IPLSERKRNKLQVEKLNRPTNGMIEGNAVDIRNEIDKHNQEVEGQNRTVHRSLDVEKLAQ 91
           I + ++KR KLQVEK+N+  + +      DI N   K  +  +  N     +L  ++L +
Sbjct: 29  ISVGDKKRAKLQVEKMNKQDSLL-----SDIINLNGKSKELAKNVN-----TLSSKQLKK 78

Query: 92  DKSKDRIIQEQVAKKQKETDQSMLAQIEMISGFSL 126
           D+ KDR++  ++  K+K+T+  ++AQIEMISGFSL
Sbjct: 79  DQEKDRLLNVEIKNKKKQTNDDLIAQIEMISGFSL 113

>SAKL0C00506g Chr3 (46439..46756) [318 bp, 105 aa] {ON} weakly
           similar to uniprot|Q2V2Q1 Saccharomyces cerevisiae
           YCL058W-A
          Length = 105

 Score = 53.1 bits (126), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 58/94 (61%), Gaps = 14/94 (14%)

Query: 35  SERKRNKLQVEKLNRPTNGMIEGNAVDIRNEIDKHNQEVEGQNRTVHR--SLDVEKLAQD 92
           S++KR ++QVE+LN+    + + N  +             G  +T  +  +L  + LAQD
Sbjct: 24  SQKKRTRIQVEQLNKQEFLLSDLNMTNA------------GSTKTKEKPKTLQAKALAQD 71

Query: 93  KSKDRIIQEQVAKKQKETDQSMLAQIEMISGFSL 126
           + KD+  ++++ K++K+T+ +MLAQ+EMISGFSL
Sbjct: 72  QKKDKETRDKLEKQRKDTNDNMLAQLEMISGFSL 105

>NCAS0B09090 Chr2 complement(1744560..1744919) [360 bp, 119 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 119

 Score = 53.1 bits (126), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 63/113 (55%), Gaps = 9/113 (7%)

Query: 14  RNDTKRVQKHKKRGSPKTIPLSERKRNKLQVEKLNRPTNGMIEGNAVDIRNEIDKHNQEV 73
           RN T + Q  K + S   I  S+RK+ K QVEKLN+  N ++  N +D++ +     + +
Sbjct: 16  RNKTGKNQVKKNKNS---ISFSDRKKAKHQVEKLNKKEN-LLPMNVLDLQKK-----KNL 66

Query: 74  EGQNRTVHRSLDVEKLAQDKSKDRIIQEQVAKKQKETDQSMLAQIEMISGFSL 126
             +   +   L    L QD+ KD+ I+ ++  +QK TD S+  QIEMISGF+ 
Sbjct: 67  SKKPEPLKSILHARSLLQDQKKDKEIRNKIRAEQKATDDSIEKQIEMISGFTF 119

>Smik_3.16 Chr3 (25034..25375) [342 bp, 113 aa] {ON} YCL058W-A
           (REAL)
          Length = 113

 Score = 52.4 bits (124), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 58/109 (53%), Gaps = 14/109 (12%)

Query: 18  KRVQKHKKRGSPKTIPLSERKRNKLQVEKLNRPTNGMIEGNAVDIRNEIDKHNQEVEGQN 77
           K+VQK +      +I  + +KR KLQVEKLN+ +  MI          + +     E   
Sbjct: 19  KKVQKRR------SISTAVKKRTKLQVEKLNKSSEMMIP--------TLLRETGAQEPAK 64

Query: 78  RTVHRSLDVEKLAQDKSKDRIIQEQVAKKQKETDQSMLAQIEMISGFSL 126
           R    +L    L +D+ KD  ++E +  ++ +T+ +ML QIEMISGFSL
Sbjct: 65  RKTESTLKAGDLIKDQEKDSKVREHIQMEKSKTNDNMLKQIEMISGFSL 113

>TPHA0E03990 Chr5 complement(837690..838040) [351 bp, 116 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 116

 Score = 51.2 bits (121), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/128 (36%), Positives = 72/128 (56%), Gaps = 14/128 (10%)

Query: 1   MAGSKTVLGRKSKRNDTKRVQKHKK-RGSPKTIPLSERKRNKLQVEKLNRPTNGMIEGNA 59
           MA  K+   +KS RN+ K V+  K  +G    +    RK  K +VEKLN+    +I  + 
Sbjct: 1   MAKGKSNNIKKSFRNNGKNVKDRKNIKGK---LSSQVRKSTKHKVEKLNKLE--VISSDD 55

Query: 60  VDIRNEIDKHNQEVEGQNRTVHRS-LDVEKLAQDKSKDRIIQEQVAKKQKETDQSMLAQI 118
           ++  N ++       G+ R    S L+ + LA+D  KDR + E++  K+KET+ S+L QI
Sbjct: 56  INALNALN-------GKKREKQTSVLEAKTLAKDNLKDRQLIEKIESKKKETNASLLQQI 108

Query: 119 EMISGFSL 126
           EM+SGFSL
Sbjct: 109 EMMSGFSL 116

>ZYRO0F18436g Chr6 complement(1522314..1522652) [339 bp, 112 aa]
           {ON} similar to uniprot|Q2V2Q1 Saccharomyces cerevisiae
           YCL058W-A
          Length = 112

 Score = 50.1 bits (118), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 54/97 (55%), Gaps = 9/97 (9%)

Query: 30  KTIPLSERKRNKLQVEKLNRPTNGMIEGNAVDIRNEIDKHNQEVEGQNRTVHRSLDVEKL 89
           K+I  S++KR K +VEKL+    G++         EI K N+    +      SL    L
Sbjct: 25  KSISHSDKKRTKSKVEKLD--AKGLLPS-------EIFKLNRSASSKTSNGSSSLLARNL 75

Query: 90  AQDKSKDRIIQEQVAKKQKETDQSMLAQIEMISGFSL 126
            QD+  D+  +++   K+KETD ++L QIEMISGFSL
Sbjct: 76  EQDRKMDQDTRDKANAKKKETDNNILQQIEMISGFSL 112

>Kwal_YGOB_YCL058W-A s33 (41330..41647) [318 bp, 105 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 105

 Score = 46.6 bits (109), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 61/110 (55%), Gaps = 11/110 (10%)

Query: 17  TKRVQKHKKRGSPKTIPLSERKRNKLQVEKLNRPTNGMIEGNAVDIRNEIDKHNQEVEGQ 76
           +K++   K RGS   I   ++ R KL+VE+ N+    + E N    R +  + +  +E  
Sbjct: 7   SKKLPTSKPRGSKNVIKKHQKIRTKLKVEQANKEVFLISELNK---REDTKRQSSPLE-- 61

Query: 77  NRTVHRSLDVEKLAQDKSKDRIIQEQVAKKQKETDQSMLAQIEMISGFSL 126
                 SL   +L +D  KD+  Q+Q+  ++K TD+++L Q+E+ISGFSL
Sbjct: 62  ------SLKPSRLVKDIKKDQNAQKQLESQRKATDENVLRQLELISGFSL 105

>Kwal_33.13015 s33 (41330..41647) [318 bp, 105 aa] {OFF} [contig
           123] FULL
          Length = 105

 Score = 46.6 bits (109), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 61/110 (55%), Gaps = 11/110 (10%)

Query: 17  TKRVQKHKKRGSPKTIPLSERKRNKLQVEKLNRPTNGMIEGNAVDIRNEIDKHNQEVEGQ 76
           +K++   K RGS   I   ++ R KL+VE+ N+    + E N    R +  + +  +E  
Sbjct: 7   SKKLPTSKPRGSKNVIKKHQKIRTKLKVEQANKEVFLISELNK---REDTKRQSSPLE-- 61

Query: 77  NRTVHRSLDVEKLAQDKSKDRIIQEQVAKKQKETDQSMLAQIEMISGFSL 126
                 SL   +L +D  KD+  Q+Q+  ++K TD+++L Q+E+ISGFSL
Sbjct: 62  ------SLKPSRLVKDIKKDQNAQKQLESQRKATDENVLRQLELISGFSL 105

>CAGL0B00374g Chr2 (23693..24058) [366 bp, 121 aa] {ON} similar to
           CA0039|IPF3998 Candida albicans and KLLA0C00528g
           Kluyveromyces lactis
          Length = 121

 Score = 45.1 bits (105), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 60/103 (58%), Gaps = 7/103 (6%)

Query: 24  KKRGSPKTIPLSERKRNKLQVEKLNRPTNGMIEGNAVDIRNEIDKHNQEVEGQNRTVHRS 83
           KK G  K I  SERK++K+   +LN+      + +  +++   + ++ ++  + +    +
Sbjct: 26  KKTGVNK-ISASERKKSKILTARLNK------DADVAELKIIQELNDNKIAEEPKKRQTA 78

Query: 84  LDVEKLAQDKSKDRIIQEQVAKKQKETDQSMLAQIEMISGFSL 126
           LD+  L +D+ +D+ ++E + K   ET+  ML Q+E++SGFSL
Sbjct: 79  LDMNCLVKDQKRDKKVREHIEKINSETNSDMLKQLELMSGFSL 121

>KLTH0F00528g Chr6 (41595..41909) [315 bp, 104 aa] {ON} conserved
           hypothetical protein
          Length = 104

 Score = 41.2 bits (95), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 53/89 (59%), Gaps = 13/89 (14%)

Query: 39  RNKLQVEKLNRPTNGMIEGNAVDIRNEIDKHNQEVEGQNRT-VHRSLDVEKLAQDKSKDR 97
           R KL+VE+ N+ +  + E N  +       HN +     RT    SL V  L +D+ KD+
Sbjct: 28  RTKLKVEQANKESFLISELNERE-------HNTK-----RTPALESLKVSDLIEDREKDK 75

Query: 98  IIQEQVAKKQKETDQSMLAQIEMISGFSL 126
            +Q+++ ++++ TD +++ Q+E+ISGFSL
Sbjct: 76  SMQKKMEEQKQSTDNNIIEQLELISGFSL 104

>TDEL0C06950 Chr3 complement(1262284..1262619) [336 bp, 111 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 111

 Score = 39.3 bits (90), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 59/111 (53%), Gaps = 13/111 (11%)

Query: 18  KRVQKHKKRGSPKTIPLSERKRNKLQVEKLNRPTNGMIEGNAVDIRNEIDKHNQE--VEG 75
           K VQK++K    K I   + K+ K +VE LNR T  +         +EI K N    V+G
Sbjct: 12  KGVQKNQK-NCKKAISRRDVKKTKFRVENLNRDTASL---------SEIIKLNASTAVKG 61

Query: 76  QNRTVHRSLDVEKLAQDKSKDRIIQEQVAKKQKETDQSMLAQIEMISGFSL 126
             R  + +L+   L +D  KD+ I+E+   +++E   ++  QIE ISGFSL
Sbjct: 62  SARKAN-TLENRTLQKDWQKDQKIREKSKAEKEEMANNLEKQIEDISGFSL 111

>NDAI0A00160 Chr1 (13398..13769) [372 bp, 123 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 123

 Score = 33.5 bits (75), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 48/99 (48%), Gaps = 9/99 (9%)

Query: 31  TIPLSERKRNKLQVEKLNRPTN---GMIEGNAVDIRNEIDKHNQEVEGQNRTVHRSLDVE 87
            I  S+RK+NK++V   N+ ++    + E N+  +     K +   +G       SL   
Sbjct: 31  VIKQSDRKKNKIKVAMFNKESSLHMNVSELNSQSMSPIKQKQDSLRKGS------SLSAH 84

Query: 88  KLAQDKSKDRIIQEQVAKKQKETDQSMLAQIEMISGFSL 126
            L  D+ KD     ++  ++K+ +  ML QIEMISGF  
Sbjct: 85  DLLNDQKKDIEANNRIQTEKKQVNDDMLRQIEMISGFKF 123

>NCAS0A09050 Chr1 complement(1791486..1792697) [1212 bp, 403 aa]
           {ON} Anc_1.347 YJL046W
          Length = 403

 Score = 31.6 bits (70), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 36/83 (43%), Gaps = 8/83 (9%)

Query: 22  KHKKRGSPKTIPLSERKRNKLQVEKLNRPTNGMIEGN--------AVDIRNEIDKHNQEV 73
           ++ +R     IP S+RK N  + + LN   + M   N           +++EID+ N E+
Sbjct: 19  RYLRRLHENAIPNSKRKENDGEFQDLNEMYSDMFTPNQGTQHQNDGPSVKSEIDELNAEL 78

Query: 74  EGQNRTVHRSLDVEKLAQDKSKD 96
              N      L  EKL Q   KD
Sbjct: 79  SSMNNFNFEKLSCEKLQQITLKD 101

>KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]
           {ON} similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 710

 Score = 30.8 bits (68), Expect = 0.73,   Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 19  RVQKHKKRGSPKTIPLSERKRNKLQVEKLNRPTNGM--IEGNAVDIRNEI 66
           R+ + +K GS KT P S + RN+ Q + +    NGM  I+ +A  I  EI
Sbjct: 569 RLYRLEKYGSVKTHPASPKPRNRNQTKHMIFDMNGMTEIDSSASQILQEI 618

>YDR014W Chr4 (474046..475989) [1944 bp, 647 aa] {ON}  RAD61Subunit
           of a complex (Scc3p, Pds5p, Rad61p) that inhibits sister
           chromatid cohesion; inhibited by Eco1p-acetylated
           cohesin subunits Smc3p and Mcd1p; related to the human
           Wapl protein that controls the association of cohesin
           with chromatin
          Length = 647

 Score = 30.4 bits (67), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 7/71 (9%)

Query: 12  SKRNDTKRVQKHKKRGSPKTIPLSERKRNKLQVEKLNRPTNGMIEGNAVDIRNEIDKHNQ 71
           S  N++ R  K KK G  +TI +++ K N++  E++++  N +   NA       D  N 
Sbjct: 194 SIENNSIRTSKDKKYGKFRTILINKNKENEIMGEEVDQKANTLSLNNA-------DNSNA 246

Query: 72  EVEGQNRTVHR 82
           E EG   T H 
Sbjct: 247 EKEGLTSTNHY 257

>AFR743CA Chr6 complement(1801173..1801478) [306 bp, 101 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL058W-A
          Length = 101

 Score = 28.9 bits (63), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 45/95 (47%), Gaps = 15/95 (15%)

Query: 32  IPLSERKRNKLQVEKLNRPTNGMIEGNAVDIRNEIDKHNQEVEGQNRTVHRSLDVEKLAQ 91
           I  +++KR KLQVEKL             D R  +           +T    L    LAQ
Sbjct: 22  ISKADKKRAKLQVEKL-------------DKRGVLLAELTAAAPAAKT--GVLQAASLAQ 66

Query: 92  DKSKDRIIQEQVAKKQKETDQSMLAQIEMISGFSL 126
           D+  D   Q+Q A+++   D+ ++ Q+E I+GFSL
Sbjct: 67  DQRSDAQAQQQRAQERSNVDKKVVQQLEAIAGFSL 101

>NCAS0H01880 Chr8 complement(361743..363464) [1722 bp, 573 aa] {ON} 
          Length = 573

 Score = 29.3 bits (64), Expect = 2.6,   Method: Composition-based stats.
 Identities = 16/65 (24%), Positives = 33/65 (50%)

Query: 59  AVDIRNEIDKHNQEVEGQNRTVHRSLDVEKLAQDKSKDRIIQEQVAKKQKETDQSMLAQI 118
           +V + N++   +  V G+  T+   ++ EKLA + S   I Q +    Q+    SM+  +
Sbjct: 278 SVAMSNKVSVDDPAVLGELETLQAGVEAEKLAGNASWGEIFQTKTKVLQRLIMGSMIQSL 337

Query: 119 EMISG 123
           + ++G
Sbjct: 338 QQLTG 342

>KLTH0C06908g Chr3 complement(599791..600080,600141..600174) [324
           bp, 107 aa] {ON} highly similar to uniprot|Q3E7A4
           Saccharomyces cerevisiae YBL059ca
          Length = 107

 Score = 28.1 bits (61), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 17/23 (73%)

Query: 87  EKLAQDKSKDRIIQEQVAKKQKE 109
           E+  +D    RIIQEQVAKKQKE
Sbjct: 79  EEYGEDAILKRIIQEQVAKKQKE 101

>AFL186W Chr6 (92866..93240) [375 bp, 124 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR159C (ATG16)
          Length = 124

 Score = 28.1 bits (61), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 30/70 (42%), Gaps = 20/70 (28%)

Query: 62  IRNEIDKHNQEVEGQNRTVH-RSLDVEKL-------------AQDK------SKDRIIQE 101
           +R E+  H QE+      VH RS D EKL              QDK        D++IQ 
Sbjct: 48  LREELHAHEQEIHKLKDIVHLRSKDAEKLNDEIISLNIENSLLQDKLTALQAEYDKLIQR 107

Query: 102 QVAKKQKETD 111
            +AK Q E D
Sbjct: 108 WLAKAQSEAD 117

>KLLA0C00528g Chr3 (40060..40410) [351 bp, 116 aa] {ON} no
           similarity
          Length = 116

 Score = 28.1 bits (61), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 31/44 (70%)

Query: 83  SLDVEKLAQDKSKDRIIQEQVAKKQKETDQSMLAQIEMISGFSL 126
           SL+ +K+ +   +D+ + ++  K++K T++ +  Q+E+ISGFSL
Sbjct: 73  SLEGQKVREHYKEDKEVVKKHDKEKKATEKKIEDQLELISGFSL 116

>TBLA0I00880 Chr9 (164402..166138) [1737 bp, 578 aa] {ON} Anc_7.445
           YPR033C
          Length = 578

 Score = 27.7 bits (60), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 3/67 (4%)

Query: 2   AGSKTVLGRKSKRNDTKRVQKHKKRGSPKTIPLS--ERKRNKLQVEKLNRPTNGMIEGNA 59
           AG +T    KSK N  K+    +K G P  + L   E    KL+V++L  P     +G  
Sbjct: 488 AGIETEYVYKSKANPRKQFDSAEKSGCPLAVILGKEEYLEGKLRVKRLG-PEFADDDGEV 546

Query: 60  VDIRNEI 66
           +D+++ I
Sbjct: 547 IDVKDLI 553

>Ecym_4656 Chr4 complement(1282201..1283829) [1629 bp, 542 aa] {ON}
           similar to Ashbya gossypii ACR187W
          Length = 542

 Score = 27.7 bits (60), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 31/63 (49%), Gaps = 3/63 (4%)

Query: 2   AGSKTVLGRKSKRNDTKRVQKHKKRGSPKTIPLS--ERKRNKLQVEKLNRPTNGMIEGNA 59
           AG +T    KSK N  ++ +  +K G P  + L   E    KL+V+KL  P     EG  
Sbjct: 452 AGIETEYVYKSKVNPRRQFEAAEKSGCPLAVILGKEEYLEGKLRVKKLG-PKFADDEGEL 510

Query: 60  VDI 62
           VD+
Sbjct: 511 VDV 513

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.126    0.327 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 12,868,872
Number of extensions: 534068
Number of successful extensions: 3197
Number of sequences better than 10.0: 241
Number of HSP's gapped: 3174
Number of HSP's successfully gapped: 248
Length of query: 126
Length of database: 53,481,399
Length adjustment: 95
Effective length of query: 31
Effective length of database: 42,588,129
Effective search space: 1320231999
Effective search space used: 1320231999
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 59 (27.3 bits)