Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0C002301.6ON34934916470.0
CAGL0B00352g1.6ON33731013920.0
NDAI0A001501.6ON31731013650.0
NCAS0B091001.6ON32731013640.0
SAKL0C00484g1.6ON33931113560.0
TPHA0E040001.6ON31631013460.0
Kpol_2002.91.6ON33831013450.0
KLLA0C00506g1.6ON33031013370.0
Kwal_33.130111.6ON33431213370.0
YCL059C (KRR1)1.6ON31631113350.0
Smik_3.151.6ON31631113320.0
Suva_3.1531.6ON31631113260.0
Ecym_10091.6ON33631013220.0
Skud_3.41.6ON31631113190.0
ZYRO0F18458g1.6ON31431013130.0
TDEL0C069601.6ON35031012971e-180
KLTH0F00506g1.6ON33231112821e-178
TBLA0A049401.6ON31631012741e-177
AFR744W1.6ON34331112731e-176
KAFR0D001501.6ON34430712511e-173
Kpol_543.135.482ON2681461005e-04
KLTH0G02574g5.482ON2711711005e-04
SAKL0G03740g5.482ON2661551005e-04
TDEL0A034605.482ON272155996e-04
ZYRO0D11440g5.482ON269177996e-04
Suva_8.1975.482ON274157996e-04
Ecym_45525.482ON271146997e-04
Kwal_47.188645.482ON271155989e-04
NCAS0A119605.482ON270177960.002
Skud_15.3105.482ON276157940.003
YOR145C (PNO1)5.482ON274157940.003
KLLA0C06446g5.482ON274146930.003
TPHA0J028205.482ON268155930.004
Smik_15.3265.482ON274157920.005
AFR390C5.482ON311146920.005
KAFR0E036005.482ON276155910.007
CAGL0K09460g5.482ON261155910.007
NDAI0A043105.482ON274155910.007
KNAG0C046105.482ON277168900.008
TBLA0D018905.482ON271172880.015
AAR002W1.420ON178161820.057
Smik_4.4128.361ON50668750.84
SAKL0D08822g1.420ON18361730.85
KAFR0B030308.309ON46749712.4
ZYRO0E04356g1.420ON18685692.8
KNAG0G023508.309ON49749685.0
KLTH0E14014g8.798ON48699686.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0C00230
         (349 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0C00230 Chr3 complement(36795..37844) [1050 bp, 349 aa] {ON}...   639   0.0  
CAGL0B00352g Chr2 complement(22171..23184) [1014 bp, 337 aa] {ON...   540   0.0  
NDAI0A00150 Chr1 complement(12040..12993) [954 bp, 317 aa] {ON} ...   530   0.0  
NCAS0B09100 Chr2 (1745144..1746127) [984 bp, 327 aa] {ON} Anc_1....   530   0.0  
SAKL0C00484g Chr3 complement(45059..46078) [1020 bp, 339 aa] {ON...   526   0.0  
TPHA0E04000 Chr5 (838446..839396) [951 bp, 316 aa] {ON} Anc_1.6 ...   523   0.0  
Kpol_2002.9 s2002 complement(17681..18697) [1017 bp, 338 aa] {ON...   522   0.0  
KLLA0C00506g Chr3 complement(38584..39576) [993 bp, 330 aa] {ON}...   519   0.0  
Kwal_33.13011 s33 complement(39946..40950) [1005 bp, 334 aa] {ON...   519   0.0  
YCL059C Chr3 complement(22429..23379) [951 bp, 316 aa] {ON}  KRR...   518   0.0  
Smik_3.15 Chr3 complement(23880..24830) [951 bp, 316 aa] {ON} YC...   517   0.0  
Suva_3.153 Chr3 complement(232200..233150) [951 bp, 316 aa] {ON}...   515   0.0  
Ecym_1009 Chr1 complement(16963..17973) [1011 bp, 336 aa] {ON} s...   513   0.0  
Skud_3.4 Chr3 complement(10422..11372) [951 bp, 316 aa] {ON} YCL...   512   0.0  
ZYRO0F18458g Chr6 (1522841..1523785) [945 bp, 314 aa] {ON} highl...   510   0.0  
TDEL0C06960 Chr3 (1262869..1263921) [1053 bp, 350 aa] {ON} Anc_1...   504   e-180
KLTH0F00506g Chr6 complement(40222..41220) [999 bp, 332 aa] {ON}...   498   e-178
TBLA0A04940 Chr1 complement(1218143..1219093) [951 bp, 316 aa] {...   495   e-177
AFR744W Chr6 (1801815..1802846) [1032 bp, 343 aa] {ON} Syntenic ...   494   e-176
KAFR0D00150 Chr4 complement(16573..17607) [1035 bp, 344 aa] {ON}...   486   e-173
Kpol_543.13 s543 complement(30976..31782) [807 bp, 268 aa] {ON} ...    43   5e-04
KLTH0G02574g Chr7 complement(201390..202205) [816 bp, 271 aa] {O...    43   5e-04
SAKL0G03740g Chr7 complement(309922..310722) [801 bp, 266 aa] {O...    43   5e-04
TDEL0A03460 Chr1 complement(617779..618597) [819 bp, 272 aa] {ON...    43   6e-04
ZYRO0D11440g Chr4 complement(964606..965415) [810 bp, 269 aa] {O...    43   6e-04
Suva_8.197 Chr8 complement(354586..355410) [825 bp, 274 aa] {ON}...    43   6e-04
Ecym_4552 Chr4 (1087732..1088547) [816 bp, 271 aa] {ON} similar ...    43   7e-04
Kwal_47.18864 s47 (1004428..1005243) [816 bp, 271 aa] {ON} YOR14...    42   9e-04
NCAS0A11960 Chr1 complement(2371549..2372361) [813 bp, 270 aa] {...    42   0.002
Skud_15.310 Chr15 complement(554002..554832) [831 bp, 276 aa] {O...    41   0.003
YOR145C Chr15 complement(605347..606171) [825 bp, 274 aa] {ON}  ...    41   0.003
KLLA0C06446g Chr3 complement(566371..567195) [825 bp, 274 aa] {O...    40   0.003
TPHA0J02820 Chr10 complement(627383..628189) [807 bp, 268 aa] {O...    40   0.004
Smik_15.326 Chr15 complement(561176..562000) [825 bp, 274 aa] {O...    40   0.005
AFR390C Chr6 complement(1138631..1139566) [936 bp, 311 aa] {ON} ...    40   0.005
KAFR0E03600 Chr5 (724338..725168) [831 bp, 276 aa] {ON} Anc_5.48...    40   0.007
CAGL0K09460g Chr11 complement(935326..936111) [786 bp, 261 aa] {...    40   0.007
NDAI0A04310 Chr1 (970952..971776) [825 bp, 274 aa] {ON} Anc_5.48...    40   0.007
KNAG0C04610 Chr3 (905301..906134) [834 bp, 277 aa] {ON} Anc_5.48...    39   0.008
TBLA0D01890 Chr4 (461527..462342) [816 bp, 271 aa] {ON} Anc_5.48...    39   0.015
AAR002W Chr1 (341790..342326) [537 bp, 178 aa] {ON} Syntenic hom...    36   0.057
Smik_4.412 Chr4 (748318..749838) [1521 bp, 506 aa] {ON} YDR168W ...    33   0.84 
SAKL0D08822g Chr4 complement(734328..734879) [552 bp, 183 aa] {O...    33   0.85 
KAFR0B03030 Chr2 (632585..633988) [1404 bp, 467 aa] {ON} Anc_8.3...    32   2.4  
ZYRO0E04356g Chr5 complement(332059..332619) [561 bp, 186 aa] {O...    31   2.8  
KNAG0G02350 Chr7 (542717..544210) [1494 bp, 497 aa] {ON} Anc_8.3...    31   5.0  
KLTH0E14014g Chr5 (1239444..1240904) [1461 bp, 486 aa] {ON} simi...    31   6.2  

>KNAG0C00230 Chr3 complement(36795..37844) [1050 bp, 349 aa] {ON}
           Anc_1.6 YCL059C
          Length = 349

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/349 (89%), Positives = 314/349 (89%)

Query: 1   MVSTHNKDKPWDTDDIDKWHIEEFKPEDNASGQPFAEESSFMTLFPKYRETYLKSVWKDV 60
           MVSTHNKDKPWDTDDIDKWHIEEFKPEDNASGQPFAEESSFMTLFPKYRETYLKSVWKDV
Sbjct: 1   MVSTHNKDKPWDTDDIDKWHIEEFKPEDNASGQPFAEESSFMTLFPKYRETYLKSVWKDV 60

Query: 61  TKALDSHHIACTLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQED 120
           TKALDSHHIACTLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQED
Sbjct: 61  TKALDSHHIACTLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQED 120

Query: 121 TACDVIKIGNIVTNKERFVKRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           TACDVIKIGNIVTNKERFVKRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGL
Sbjct: 121 TACDVIKIGNIVTNKERFVKRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KELRRVVEDCMHNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KELRRVVEDCMHNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMF             
Sbjct: 181 KELRRVVEDCMHNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXXVYTPFPPAQLPRKVDLEIESGEYFLNKKEKQFKKLEERKEIQAEKQRVKDEERRK 300
                VYTPFPPAQLPRKVDLEIESGEYFLNKKEKQFKKLEERKEIQAEKQRVKDEERRK
Sbjct: 241 KKEKKVYTPFPPAQLPRKVDLEIESGEYFLNKKEKQFKKLEERKEIQAEKQRVKDEERRK 300

Query: 301 DYTAPKEKAYGXXXXXXXXXXXXXXXXXGEVEEAGNMSETKSSKKHKKA 349
           DYTAPKEKAYG                 GEVEEAGNMSETKSSKKHKKA
Sbjct: 301 DYTAPKEKAYGTTDKKEKKKKRSKDTEEGEVEEAGNMSETKSSKKHKKA 349

>CAGL0B00352g Chr2 complement(22171..23184) [1014 bp, 337 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059c KRR1
          Length = 337

 Score =  540 bits (1392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/310 (83%), Positives = 274/310 (88%)

Query: 1   MVSTHNKDKPWDTDDIDKWHIEEFKPEDNASGQPFAEESSFMTLFPKYRETYLKSVWKDV 60
           MVST+NKDKPWDT+DIDKW IEEFKPEDN SGQPFAEESSFMTLFPKYRE YLKS+W DV
Sbjct: 1   MVSTYNKDKPWDTEDIDKWKIEEFKPEDNKSGQPFAEESSFMTLFPKYREAYLKSIWNDV 60

Query: 61  TKALDSHHIACTLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQED 120
           T+ALD HHI CTLDLVEGSMTVKTTRKT+DPAIILKARDLIKLLARSVPFPQAVKILQ+D
Sbjct: 61  TRALDKHHIGCTLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 TACDVIKIGNIVTNKERFVKRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
            ACDVIKIGN V NK+RFVKRRQRLVGP+GNTLKALELLTKCYILVQGNTVSAMGPYKGL
Sbjct: 121 IACDVIKIGNTVANKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KELRRVVEDCMHNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVV DCM NVHPIYHIKELMIKRELAK+PELANEDWSRFLPMF             
Sbjct: 181 KEIRRVVLDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPSKV 240

Query: 241 XXXXXVYTPFPPAQLPRKVDLEIESGEYFLNKKEKQFKKLEERKEIQAEKQRVKDEERRK 300
                VYTPFPPAQLPRKVDL+IESGEYFL+KKEK+ KKL E++E QAEKQ +KDEERRK
Sbjct: 241 KAEKKVYTPFPPAQLPRKVDLQIESGEYFLSKKEKEIKKLHEQREKQAEKQILKDEERRK 300

Query: 301 DYTAPKEKAY 310
           DY APKE  Y
Sbjct: 301 DYIAPKEDEY 310

>NDAI0A00150 Chr1 complement(12040..12993) [954 bp, 317 aa] {ON}
           Anc_1.6 YCL059C
          Length = 317

 Score =  530 bits (1365), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/310 (81%), Positives = 273/310 (88%)

Query: 1   MVSTHNKDKPWDTDDIDKWHIEEFKPEDNASGQPFAEESSFMTLFPKYRETYLKSVWKDV 60
           MVSTHN+DKPWDT++I+KW IEEFKPEDNASG PFAEESSFMTLFPKYRETYLKSVW DV
Sbjct: 1   MVSTHNRDKPWDTEEINKWKIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60

Query: 61  TKALDSHHIACTLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQED 120
           T+AL++H++AC LDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKIL++D
Sbjct: 61  TRALNTHNLACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 TACDVIKIGNIVTNKERFVKRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
            ACDVIKIGN VTNKERFVKRRQRLVGP+GNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180

Query: 181 KELRRVVEDCMHNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVEDCM N+HPIYHIKELMIKRELAKKPELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKV 240

Query: 241 XXXXXVYTPFPPAQLPRKVDLEIESGEYFLNKKEKQFKKLEERKEIQAEKQRVKDEERRK 300
                +YTPFPPAQLPRKVDLEIESGEYFL+K+EK+ KKL ER+E QAEKQ  K+ ER K
Sbjct: 241 KKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLNERREQQAEKQVEKETERNK 300

Query: 301 DYTAPKEKAY 310
           DY AP E  Y
Sbjct: 301 DYVAPSEPTY 310

>NCAS0B09100 Chr2 (1745144..1746127) [984 bp, 327 aa] {ON} Anc_1.6
           YCL059C
          Length = 327

 Score =  530 bits (1364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/310 (81%), Positives = 273/310 (88%)

Query: 1   MVSTHNKDKPWDTDDIDKWHIEEFKPEDNASGQPFAEESSFMTLFPKYRETYLKSVWKDV 60
           MVSTHN+DKPWDT D+DKWHIEEFKPEDNASG PFAEESSFMTLFPKYRETYLKSVW DV
Sbjct: 1   MVSTHNRDKPWDTPDVDKWHIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60

Query: 61  TKALDSHHIACTLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQED 120
           T+AL+ H++ C LDLVEGSMTVKTTRKT+DPAIILKARDLIKLLARSVPFPQAVKILQ+D
Sbjct: 61  TRALNKHNLGCVLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 TACDVIKIGNIVTNKERFVKRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
            ACDVIKIGN VTNKERFVKRRQRLVGP+GNTLKALELLTKCYILVQGNTVS MGP++GL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFQGL 180

Query: 181 KELRRVVEDCMHNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVEDCM NVHPIYHIKELMIKRELAKKPELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKV 240

Query: 241 XXXXXVYTPFPPAQLPRKVDLEIESGEYFLNKKEKQFKKLEERKEIQAEKQRVKDEERRK 300
                +YTPFPPAQLPRKVDLEIESGEYFL+K+EK+ KKL ER+E QAEKQ  K+ ER K
Sbjct: 241 RKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLHERREQQAEKQAEKEVERNK 300

Query: 301 DYTAPKEKAY 310
           +Y AP+E+ Y
Sbjct: 301 NYIAPEEETY 310

>SAKL0C00484g Chr3 complement(45059..46078) [1020 bp, 339 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 339

 Score =  526 bits (1356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/311 (82%), Positives = 273/311 (87%), Gaps = 1/311 (0%)

Query: 1   MVSTHNKDKPWDTDDIDKWHIEEFKPEDNASGQPFAEESSFMTLFPKYRETYLKSVWKDV 60
           M STHNKDKPWDT +IDKW IEEFKPEDNASG PFAEESSFMTLFPKYRE YLKSVW DV
Sbjct: 1   MPSTHNKDKPWDTPEIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSVWNDV 60

Query: 61  TKALDSHHIACTLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQED 120
           T+ALD HHIACTLDLVEGSM+VKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKIL++D
Sbjct: 61  TRALDKHHIACTLDLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 TACDVIKIGNIVTNKERFVKRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
            ACDVIKIGN V+NKERFVKRRQRLVGP+GNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KELRRVVEDCMHNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXX-XXXXXXXX 239
           KE+RRVVEDCM NVHPIYHIKELMIKRELAK+PELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFKKRNVARKKPKKA 240

Query: 240 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLNKKEKQFKKLEERKEIQAEKQRVKDEERR 299
                 VYTPFPPAQLPRKVDLEIESGEYFL+KKEK+ KKL+ER++ QAEKQ  K+EER 
Sbjct: 241 KAKEKKVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEVKKLQERRQEQAEKQAQKEEERA 300

Query: 300 KDYTAPKEKAY 310
           KDY AP+E  Y
Sbjct: 301 KDYVAPEEAEY 311

>TPHA0E04000 Chr5 (838446..839396) [951 bp, 316 aa] {ON} Anc_1.6
           YCL059C
          Length = 316

 Score =  523 bits (1346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/310 (80%), Positives = 271/310 (87%)

Query: 1   MVSTHNKDKPWDTDDIDKWHIEEFKPEDNASGQPFAEESSFMTLFPKYRETYLKSVWKDV 60
           MVSTHNK+KPWDT+DIDKW +E+FKPEDNASG PF+EESSFMTLFPKYRE YLKSVWKDV
Sbjct: 1   MVSTHNKEKPWDTEDIDKWKLEDFKPEDNASGMPFSEESSFMTLFPKYREVYLKSVWKDV 60

Query: 61  TKALDSHHIACTLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQED 120
           TKALD HH+ACTL+LV+GSMTV TTRKTYDP IILKARDLIKLLARSVPFPQAVKIL +D
Sbjct: 61  TKALDKHHVACTLNLVDGSMTVSTTRKTYDPYIILKARDLIKLLARSVPFPQAVKILDDD 120

Query: 121 TACDVIKIGNIVTNKERFVKRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
            ACDVIKIGN VTNKERFVKRRQRLVGP+GNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180

Query: 181 KELRRVVEDCMHNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVED M NVHPIYHIKELMIKRELAKKPELANEDWSRFLPMF             
Sbjct: 181 KEIRRVVEDAMRNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKSKKP 240

Query: 241 XXXXXVYTPFPPAQLPRKVDLEIESGEYFLNKKEKQFKKLEERKEIQAEKQRVKDEERRK 300
                VYTPFPP+QLPRKVDLEIESGEYFL+KKEK+ K+L ER++ QAEKQ  KD ER K
Sbjct: 241 KREKKVYTPFPPSQLPRKVDLEIESGEYFLSKKEKEVKRLHERRDQQAEKQAEKDIERSK 300

Query: 301 DYTAPKEKAY 310
           +Y APKE+ Y
Sbjct: 301 NYIAPKEEKY 310

>Kpol_2002.9 s2002 complement(17681..18697) [1017 bp, 338 aa] {ON}
           complement(17681..18697) [1017 nt, 339 aa]
          Length = 338

 Score =  522 bits (1345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/310 (80%), Positives = 271/310 (87%)

Query: 1   MVSTHNKDKPWDTDDIDKWHIEEFKPEDNASGQPFAEESSFMTLFPKYRETYLKSVWKDV 60
           MVSTHNKDKPWDT+DIDKW +EEFKPEDNASG PFAEESSFMTLFPKYRE YLKSVW DV
Sbjct: 1   MVSTHNKDKPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREIYLKSVWNDV 60

Query: 61  TKALDSHHIACTLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQED 120
           TKALD  HIACTLDLVEGSMTVKTTRKT+DP  ILKARDLIKLLARSVPFPQA+KIL++D
Sbjct: 61  TKALDKRHIACTLDLVEGSMTVKTTRKTFDPYAILKARDLIKLLARSVPFPQAIKILEDD 120

Query: 121 TACDVIKIGNIVTNKERFVKRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
            ACDVIKIGN VTNKERFVKRRQRLVGP+GNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSCMGPFKGL 180

Query: 181 KELRRVVEDCMHNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVEDCM NVHPIYHIKELMIKRELAK+PELA+EDWSRFLPMF             
Sbjct: 181 KEIRRVVEDCMKNVHPIYHIKELMIKRELAKRPELADEDWSRFLPMFKKRNVARKKAAKP 240

Query: 241 XXXXXVYTPFPPAQLPRKVDLEIESGEYFLNKKEKQFKKLEERKEIQAEKQRVKDEERRK 300
                VYTPFPPAQ PRKVDLEIESGEYFL+KKEK+ K+L+ER+E Q++KQ  K++ER K
Sbjct: 241 KKEKKVYTPFPPAQQPRKVDLEIESGEYFLSKKEKEVKRLQERREEQSQKQIEKEKERSK 300

Query: 301 DYTAPKEKAY 310
           DY AP E+ Y
Sbjct: 301 DYVAPMEEEY 310

>KLLA0C00506g Chr3 complement(38584..39576) [993 bp, 330 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 330

 Score =  519 bits (1337), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/310 (80%), Positives = 270/310 (87%), Gaps = 1/310 (0%)

Query: 1   MVSTHNKDKPWDTDDIDKWHIEEFKPEDNASGQPFAEESSFMTLFPKYRETYLKSVWKDV 60
           MVSTHNKDKPWDTD++DKW+IEEFKPEDN SG PFAEESSFMTLFPKYRE YLKSVWKDV
Sbjct: 1   MVSTHNKDKPWDTDEVDKWNIEEFKPEDNKSGLPFAEESSFMTLFPKYREAYLKSVWKDV 60

Query: 61  TKALDSHHIACTLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQED 120
           T++LD+HHIAC L+LVEGSMTVKTTRKTYDPA+ILKARDLIKLLARSVPFPQAVKIL++D
Sbjct: 61  TRSLDAHHIACELNLVEGSMTVKTTRKTYDPAVILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 TACDVIKIGNIVTNKERFVKRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
            ACDVIKIGN V+NKERFVKRRQRLVGP+GNTLKALELLTKCYILVQGNTVS MGPYKGL
Sbjct: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180

Query: 181 KELRRVVEDCMHNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVEDCM NVHPIYHIKELMIKRELAKKPELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELAEEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXXVYTPFPPAQLPRKVDLEIESGEYFLNKKEKQFKKLEERKEIQAEKQRVKDEERRK 300
                 YTPFPPAQLPRKVDLEIESGEYFL+K+EK+ KKL ER+E QA K   K+ ER K
Sbjct: 241 KEKKI-YTPFPPAQLPRKVDLEIESGEYFLSKREKEVKKLHERREQQAAKHAEKESERAK 299

Query: 301 DYTAPKEKAY 310
           D+ APKE  Y
Sbjct: 300 DFIAPKETDY 309

>Kwal_33.13011 s33 complement(39946..40950) [1005 bp, 334 aa] {ON}
           YCL059C (KRR1) - involved in cell division and spore
           germination [contig 123] FULL
          Length = 334

 Score =  519 bits (1337), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/312 (80%), Positives = 270/312 (86%), Gaps = 1/312 (0%)

Query: 1   MVSTHNKDKPWDTDDIDKWHIEEFKPEDNASGQPFAEESSFMTLFPKYRETYLKSVWKDV 60
           M STHNKDKPWDT DIDKW IEEFKPEDN SG PF+EESSFMTLFPKYRE YLKSVWKDV
Sbjct: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNTSGLPFSEESSFMTLFPKYREVYLKSVWKDV 60

Query: 61  TKALDSHHIACTLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQED 120
           T+AL+ H I+C LDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQ+D
Sbjct: 61  TRALEKHSISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 TACDVIKIGNIVTNKERFVKRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
            ACDVIKIGN V+NKERFVKRRQRLVGP+GNTLKALELL+KCYILVQGNTVSAMGP+KGL
Sbjct: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLSKCYILVQGNTVSAMGPFKGL 180

Query: 181 KELRRVVEDCMHNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXX-XXX 239
           KE+RRVVEDCM NVHPIYHIKELMIKRELAK+P+LA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240

Query: 240 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLNKKEKQFKKLEERKEIQAEKQRVKDEERR 299
                 VYTPFPP Q PRKVDL+IESGEYFL+KKEK+ KKL+ERK+ QAEKQ  KD+ER 
Sbjct: 241 KSKEAKVYTPFPPVQQPRKVDLQIESGEYFLSKKEKEAKKLDERKKEQAEKQIEKDKERA 300

Query: 300 KDYTAPKEKAYG 311
           KDY AP EK YG
Sbjct: 301 KDYVAPSEKEYG 312

>YCL059C Chr3 complement(22429..23379) [951 bp, 316 aa] {ON}
           KRR1Essential nucleolar protein required for the
           synthesis of 18S rRNA and for the assembly of 40S
           ribosomal subunit
          Length = 316

 Score =  518 bits (1335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/311 (81%), Positives = 275/311 (88%), Gaps = 1/311 (0%)

Query: 1   MVSTHNKDKPWDTDDIDKWHIEEFKPEDNASGQPFAEESSFMTLFPKYRETYLKSVWKDV 60
           MVSTHN+DKPWDTDDIDKW IEEFK EDNASGQPFAEESSFMTLFPKYRE+YLK++W DV
Sbjct: 1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRESYLKTIWNDV 60

Query: 61  TKALDSHHIACTLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQED 120
           T+ALD H+IAC LDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQ+D
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 TACDVIKIGNIVTNKERFVKRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
            ACDVIKIGN VTNKERFVKRRQRLVGP+GNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KELRRVVEDCMHNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXX-XXX 239
           KE+RRVVEDCM N+HPIYHIKELMIKRELAK+PELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLNKKEKQFKKLEERKEIQAEKQRVKDEERR 299
                 VYTPFPPAQLPRKVDLEIESGEYFL+K+EKQ KKL E+KE Q E++  + EER 
Sbjct: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA 300

Query: 300 KDYTAPKEKAY 310
           KD+ AP+E+AY
Sbjct: 301 KDFIAPEEEAY 311

>Smik_3.15 Chr3 complement(23880..24830) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  517 bits (1332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/311 (81%), Positives = 274/311 (88%), Gaps = 1/311 (0%)

Query: 1   MVSTHNKDKPWDTDDIDKWHIEEFKPEDNASGQPFAEESSFMTLFPKYRETYLKSVWKDV 60
           MVSTHN+DKPWDTDDIDKW IEEFK EDNASGQPFAEESSFMTLFPKYRE+YLK++W DV
Sbjct: 1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRESYLKTIWNDV 60

Query: 61  TKALDSHHIACTLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQED 120
           T+ALD H+IAC LDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQ+D
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 TACDVIKIGNIVTNKERFVKRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
            ACDVIKIGN VTNKERFVKRRQRLVGP+GNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KELRRVVEDCMHNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXX-XXX 239
           KE+RRVVEDCM NVHPIYHIKELMIKRELAK+PELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLNKKEKQFKKLEERKEIQAEKQRVKDEERR 299
                 VYTPFPPAQLPRKVDLEIESGEYFL+K+EKQ KKL E+KE Q E++  + EER 
Sbjct: 241 RNIEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLSEQKEKQMEREIERQEERA 300

Query: 300 KDYTAPKEKAY 310
           KD+ AP+E+ Y
Sbjct: 301 KDFIAPEEETY 311

>Suva_3.153 Chr3 complement(232200..233150) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  515 bits (1326), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/311 (81%), Positives = 274/311 (88%), Gaps = 1/311 (0%)

Query: 1   MVSTHNKDKPWDTDDIDKWHIEEFKPEDNASGQPFAEESSFMTLFPKYRETYLKSVWKDV 60
           MVSTHN+DKPWDTDD+DKW IEEFK EDNASGQPFAEESSFMTLFPKYRE YLK++W DV
Sbjct: 1   MVSTHNRDKPWDTDDVDKWTIEEFKEEDNASGQPFAEESSFMTLFPKYRENYLKTIWNDV 60

Query: 61  TKALDSHHIACTLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQED 120
           T+ALD H+I+C LDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQ+D
Sbjct: 61  TRALDKHNISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 TACDVIKIGNIVTNKERFVKRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
            ACDVIKIGN VTNKERFVKRRQRLVGP+GNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KELRRVVEDCMHNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXX-XXX 239
           KE+RRVVEDCM NVHPIYHIKELMIKRELAK+PELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLNKKEKQFKKLEERKEIQAEKQRVKDEERR 299
                 VYTPFPPAQLPRKVDLEIESGEYFL+K+EKQ KKL E+KE Q E++  + EER 
Sbjct: 241 RNIEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREVERQEERA 300

Query: 300 KDYTAPKEKAY 310
           K++ AP+E+AY
Sbjct: 301 KNFVAPQEEAY 311

>Ecym_1009 Chr1 complement(16963..17973) [1011 bp, 336 aa] {ON}
           similar to Ashbya gossypii AFR744W
          Length = 336

 Score =  513 bits (1322), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/310 (80%), Positives = 267/310 (86%), Gaps = 1/310 (0%)

Query: 1   MVSTHNKDKPWDTDDIDKWHIEEFKPEDNASGQPFAEESSFMTLFPKYRETYLKSVWKDV 60
           MVSTHNKDKPWDT DIDKW IEEFKPEDNASG PFAEESSFMTLFPKYRE YLKS W DV
Sbjct: 1   MVSTHNKDKPWDTPDIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSTWNDV 60

Query: 61  TKALDSHHIACTLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQED 120
           T+ALD HH+AC L+LVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKIL++D
Sbjct: 61  TRALDKHHLACELNLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 TACDVIKIGNIVTNKERFVKRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
            ACDVIKIGN  +NK+RFVKRRQRLVGP+GNTLKALELLTKCYILVQGNTVSAMGPYKGL
Sbjct: 121 VACDVIKIGNFSSNKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KELRRVVEDCMHNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVEDCM NVHPIYHIKELMIKRELAKKPELA++DWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELADQDWSRFLPMF-KKRNIARKKPKK 239

Query: 241 XXXXXVYTPFPPAQLPRKVDLEIESGEYFLNKKEKQFKKLEERKEIQAEKQRVKDEERRK 300
                VYTPFPPAQLPRKVDLEIE+GEYFL+K EK+ KKLEE +  Q EKQ  K +ER +
Sbjct: 240 IKEKKVYTPFPPAQLPRKVDLEIETGEYFLSKNEKKMKKLEEHRNRQTEKQLEKAKERAE 299

Query: 301 DYTAPKEKAY 310
           DY AP EK Y
Sbjct: 300 DYIAPDEKEY 309

>Skud_3.4 Chr3 complement(10422..11372) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  512 bits (1319), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/311 (80%), Positives = 274/311 (88%), Gaps = 1/311 (0%)

Query: 1   MVSTHNKDKPWDTDDIDKWHIEEFKPEDNASGQPFAEESSFMTLFPKYRETYLKSVWKDV 60
           MVSTHN++KPWDTDDIDKW IEEFK EDN SGQPFAEESSFMTLFPKYRE YLK++W DV
Sbjct: 1   MVSTHNREKPWDTDDIDKWKIEEFKEEDNGSGQPFAEESSFMTLFPKYREGYLKTIWNDV 60

Query: 61  TKALDSHHIACTLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQED 120
           T+ALD H+IAC LDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQ+D
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 TACDVIKIGNIVTNKERFVKRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
            ACDVIKIGN VTNKERFVKRRQRLVGP+GNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KELRRVVEDCMHNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXX-XXX 239
           KE+RRVVEDCM N+HPIYHIKELMIKRELAK+PELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLNKKEKQFKKLEERKEIQAEKQRVKDEERR 299
                 VYTPFPPAQLPRKVDLEIESGEYFL+K++KQ KKL E+KE Q E++  + EER 
Sbjct: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKRDKQVKKLNEQKEKQMERELERQEERA 300

Query: 300 KDYTAPKEKAY 310
           KD+TAP+E++Y
Sbjct: 301 KDFTAPEEESY 311

>ZYRO0F18458g Chr6 (1522841..1523785) [945 bp, 314 aa] {ON} highly
           similar to uniprot|P25586 Saccharomyces cerevisiae
           YCL059C KRR1 Essential nucleolar protein required for
           the synthesis of 18S rRNA and for the assembly of 40S
           ribosomal subunit
          Length = 314

 Score =  510 bits (1313), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/310 (79%), Positives = 267/310 (86%)

Query: 1   MVSTHNKDKPWDTDDIDKWHIEEFKPEDNASGQPFAEESSFMTLFPKYRETYLKSVWKDV 60
           MVSTHNKDKPWDT +IDKWH +EFK EDNASG PFAEESSFMTLFPKYRE YLKS+W DV
Sbjct: 1   MVSTHNKDKPWDTGEIDKWHQDEFKEEDNASGLPFAEESSFMTLFPKYREAYLKSIWNDV 60

Query: 61  TKALDSHHIACTLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQED 120
           TKAL+ +H+AC LDLVEGSMTVKTTRKT DPAIILKARDLIKLLARSVPFPQAVKIL+++
Sbjct: 61  TKALNKYHVACVLDLVEGSMTVKTTRKTCDPAIILKARDLIKLLARSVPFPQAVKILEDN 120

Query: 121 TACDVIKIGNIVTNKERFVKRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           TACDVIKIGN V NKERF KRRQRLVGP+GNTLKALELLTKCYILVQGNTV+AMG YKGL
Sbjct: 121 TACDVIKIGNTVANKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGL 180

Query: 181 KELRRVVEDCMHNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVED M N+HPIYHIKELMIKRELAK+PELANEDWSRFLP F             
Sbjct: 181 KEVRRVVEDTMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPNFKKRNVARKKPMKI 240

Query: 241 XXXXXVYTPFPPAQLPRKVDLEIESGEYFLNKKEKQFKKLEERKEIQAEKQRVKDEERRK 300
                VYTPFPPAQ PRKVDLEIESGEYFLNK+EK+ KKLEER+E QAEKQ  + +ERRK
Sbjct: 241 RKEKKVYTPFPPAQTPRKVDLEIESGEYFLNKREKEAKKLEERREKQAEKQEERQKERRK 300

Query: 301 DYTAPKEKAY 310
           D+  PKE+ Y
Sbjct: 301 DFLPPKEEDY 310

>TDEL0C06960 Chr3 (1262869..1263921) [1053 bp, 350 aa] {ON} Anc_1.6
           YCL059C
          Length = 350

 Score =  504 bits (1297), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 247/310 (79%), Positives = 268/310 (86%)

Query: 1   MVSTHNKDKPWDTDDIDKWHIEEFKPEDNASGQPFAEESSFMTLFPKYRETYLKSVWKDV 60
           MVSTHN+DKPWDT+DIDKW +EEFKPEDNASG PFAEESSFMTLFPKYRE YLKS+W DV
Sbjct: 1   MVSTHNRDKPWDTEDIDKWQVEEFKPEDNASGLPFAEESSFMTLFPKYREPYLKSIWNDV 60

Query: 61  TKALDSHHIACTLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQED 120
           T+AL++HHIAC LDL+EGSMTVKTTRKT+DPAIIL+ARDLIKLLARSVPF QAVKIL+ED
Sbjct: 61  TRALNAHHIACVLDLMEGSMTVKTTRKTFDPAIILRARDLIKLLARSVPFAQAVKILEED 120

Query: 121 TACDVIKIGNIVTNKERFVKRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
            ACDVIKIGN+V NKERFVKRRQRLVGP+GNTLKALELLTKCYILVQGNTVS MGPYKGL
Sbjct: 121 VACDVIKIGNVVANKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180

Query: 181 KELRRVVEDCMHNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVED M NVHPIY IKELMIKRELAK+PELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDTMRNVHPIYQIKELMIKRELAKRPELAEEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXXVYTPFPPAQLPRKVDLEIESGEYFLNKKEKQFKKLEERKEIQAEKQRVKDEERRK 300
                VYTPFPPAQ PRK+DLEIESGEYFL+KKEK+  KL+ER+E QAEKQ  K+E R K
Sbjct: 241 RAEKKVYTPFPPAQQPRKIDLEIESGEYFLSKKEKEINKLKERREKQAEKQEEKEEARSK 300

Query: 301 DYTAPKEKAY 310
           DY APKE  Y
Sbjct: 301 DYIAPKEDVY 310

>KLTH0F00506g Chr6 complement(40222..41220) [999 bp, 332 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 332

 Score =  498 bits (1282), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 253/311 (81%), Positives = 269/311 (86%), Gaps = 1/311 (0%)

Query: 1   MVSTHNKDKPWDTDDIDKWHIEEFKPEDNASGQPFAEESSFMTLFPKYRETYLKSVWKDV 60
           M STHNKDKPWDT DIDKW IEEFKPEDN SG PFAEESSFMTLFPKYRE YLKSVW DV
Sbjct: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNVSGMPFAEESSFMTLFPKYREAYLKSVWNDV 60

Query: 61  TKALDSHHIACTLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQED 120
           T+ALD H+IAC LDLVEGSMTVKTTR+TYDPAIILKARDLIKLLARSVPFPQAVKILQ+D
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRRTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 TACDVIKIGNIVTNKERFVKRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           TACDVIKIGN V+NKERFVKRRQRLVGP+GNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 TACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KELRRVVEDCMHNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXX-XXX 239
           KE+RRVVEDCM N+HPIYHIKELMIKRELAK+P+LA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240

Query: 240 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLNKKEKQFKKLEERKEIQAEKQRVKDEERR 299
                 VYTPFPPAQ PRK+DL+IESGEYFL KKEK+ KKLEERK  QAEKQ  K++ER 
Sbjct: 241 KPKENKVYTPFPPAQQPRKIDLQIESGEYFLTKKEKEAKKLEERKREQAEKQVEKNKERA 300

Query: 300 KDYTAPKEKAY 310
           KDY AP EK Y
Sbjct: 301 KDYVAPIEKGY 311

>TBLA0A04940 Chr1 complement(1218143..1219093) [951 bp, 316 aa] {ON}
           Anc_1.6 YCL059C
          Length = 316

 Score =  495 bits (1274), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 249/310 (80%), Positives = 274/310 (88%)

Query: 1   MVSTHNKDKPWDTDDIDKWHIEEFKPEDNASGQPFAEESSFMTLFPKYRETYLKSVWKDV 60
           MVSTHN+DKPWDT DI+KW I+EFKPEDNASG PF EESSFMTLFPKYRETYL+ VW DV
Sbjct: 1   MVSTHNRDKPWDTPDINKWEIQEFKPEDNASGLPFTEESSFMTLFPKYRETYLREVWGDV 60

Query: 61  TKALDSHHIACTLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQED 120
           TK+LD +H+ACTLDL+EGSMTVKTTRKTYDPAIILKARDLIKLLARSVP+PQA++ILQ+D
Sbjct: 61  TKSLDKYHVACTLDLIEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPYPQAIRILQDD 120

Query: 121 TACDVIKIGNIVTNKERFVKRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
            ACDVIKIGN+V NKERFVKRRQRLVGP+GNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 IACDVIKIGNVVNNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KELRRVVEDCMHNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVEDCM NVHPIYHIKELMIKREL+K+PELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELSKRPELANEDWSRFLPMFKKRNVARKKSKKP 240

Query: 241 XXXXXVYTPFPPAQLPRKVDLEIESGEYFLNKKEKQFKKLEERKEIQAEKQRVKDEERRK 300
                VYTPFPPAQLPRKVDLEIESGEYFL+KKEK+ KKL+ER+E Q EKQ  K++ERRK
Sbjct: 241 KKEKKVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEIKKLKERREKQEEKQVEKEKERRK 300

Query: 301 DYTAPKEKAY 310
           D+ AP EK Y
Sbjct: 301 DFIAPSEKEY 310

>AFR744W Chr6 (1801815..1802846) [1032 bp, 343 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL059C (KRR1)
          Length = 343

 Score =  494 bits (1273), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 248/311 (79%), Positives = 269/311 (86%), Gaps = 1/311 (0%)

Query: 1   MVSTHNKDKPWDTDDIDKWHIEEFKPEDNASGQPFAEESSFMTLFPKYRETYLKSVWKDV 60
           MVST NKDKPWDT D+DKW IEEF PED+ASG PFAEESSFMTLFPKYRETYLKS+WK+V
Sbjct: 1   MVSTPNKDKPWDTPDVDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEV 60

Query: 61  TKALDSHHIACTLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQED 120
           T+AL+ HHIAC L+LVEGSM+VKTTRKTYDPAIILKARDLIKLLARSVP PQA+KILQ+D
Sbjct: 61  TRALEKHHIACELNLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPLPQAIKILQDD 120

Query: 121 TACDVIKIGNIVTNKERFVKRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
            ACDVIKIGNIV +KERFVKRRQRLVGP+GNTLKALELLTKCYILVQGNTVSAMGPYKGL
Sbjct: 121 IACDVIKIGNIVASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KELRRVVEDCMHNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVEDCM N+HPIYHIKELMIKRELAK+PELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPELAEEDWSRFLPMF-KKRNVARKKPKK 239

Query: 241 XXXXXVYTPFPPAQLPRKVDLEIESGEYFLNKKEKQFKKLEERKEIQAEKQRVKDEERRK 300
                VYTPFPPAQLPRKVDLEIE+GEYFL+KKEK+ KKLE R+  QAEKQ  K++ER K
Sbjct: 240 IKEKKVYTPFPPAQLPRKVDLEIETGEYFLSKKEKEAKKLEARRAQQAEKQSEKEKERAK 299

Query: 301 DYTAPKEKAYG 311
           DY AP E  Y 
Sbjct: 300 DYIAPAEPEYS 310

>KAFR0D00150 Chr4 complement(16573..17607) [1035 bp, 344 aa] {ON}
           Anc_1.6 YCL059C
          Length = 344

 Score =  486 bits (1251), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 255/307 (83%), Positives = 275/307 (89%)

Query: 1   MVSTHNKDKPWDTDDIDKWHIEEFKPEDNASGQPFAEESSFMTLFPKYRETYLKSVWKDV 60
           MVST+NK+KPWDT+DIDKW  EEFKPEDNASG PFAEESSFMTLFPKYRE+YLKSVWKDV
Sbjct: 1   MVSTYNKEKPWDTEDIDKWQTEEFKPEDNASGLPFAEESSFMTLFPKYRESYLKSVWKDV 60

Query: 61  TKALDSHHIACTLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQED 120
           TKAL+ HHIAC LDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQA+KIL+++
Sbjct: 61  TKALEKHHIACILDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAIKILEDN 120

Query: 121 TACDVIKIGNIVTNKERFVKRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
            ACDVIKIGN V+NKERFVKRRQRLVGP+GNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KELRRVVEDCMHNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVEDCM NVHPIYHIKELMIKRELAKKPELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMLNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXXVYTPFPPAQLPRKVDLEIESGEYFLNKKEKQFKKLEERKEIQAEKQRVKDEERRK 300
                VYTPFPP QLPRKVDLEIESGEYFL+KKEK+ KKLEERKE QA+KQ  K++ER+K
Sbjct: 241 RKEKKVYTPFPPTQLPRKVDLEIESGEYFLSKKEKEVKKLEERKEEQAKKQEEKEKERKK 300

Query: 301 DYTAPKE 307
           +Y APKE
Sbjct: 301 NYIAPKE 307

>Kpol_543.13 s543 complement(30976..31782) [807 bp, 268 aa] {ON}
           complement(30976..31782) [807 nt, 269 aa]
          Length = 268

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 68/146 (46%), Gaps = 4/146 (2%)

Query: 46  PKYRETYLKSVWKDVTKALDSH-HIACTLDLVEGSMTVKTTRK-TYDPAIILKARDLIKL 103
           P +R T L++ W  +   L  H  +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 96  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTNPKHTTDPGALQKGADFIKA 155

Query: 104 LARSVPFPQAVKILQ-EDTACDVIKIGNIVT-NKERFVKRRQRLVGPDGNTLKALELLTK 161
                    ++ +L+ +D   +  +I ++ T N +   +   R+ G DG T  A+E  T+
Sbjct: 156 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 215

Query: 162 CYILVQGNTVSAMGPYKGLKELRRVV 187
             I++  + +  +G +  ++  R  V
Sbjct: 216 TRIVLADSKIHILGGFTHIRMAREAV 241

>KLTH0G02574g Chr7 complement(201390..202205) [816 bp, 271 aa] {ON}
           similar to uniprot|Q7LHP7 Saccharomyces cerevisiae
           YOR145C PNO1 Partner of Nob1 Protein required for cell
           viability
          Length = 271

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 76/171 (44%), Gaps = 4/171 (2%)

Query: 30  ASGQPFAEESSFMTLFPKYRETYLKSVWKDVTKALDSH-HIACTLDLVEGSMTVKTTRK- 87
           ASG+   +  S     P +R T L++ W  +   L  H  +   ++L   ++ ++T  K 
Sbjct: 83  ASGEMKVKPESRKVPVPPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKTVELRTHPKH 142

Query: 88  TYDPAIILKARDLIKLLARSVPFPQAVKILQ-EDTACDVIKIGNIVT-NKERFVKRRQRL 145
           T DP  + K  D IK          A+ +L+ +D   +  +I ++ T N +   +   R+
Sbjct: 143 TTDPGALQKGADFIKAFTLGFDLDDAIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRI 202

Query: 146 VGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGLKELRRVVEDCMHNVHP 196
            G DG T  A+E  T+  I++  + +  +G +  ++  R  V   +    P
Sbjct: 203 AGKDGKTKFAIENATRTRIVLADSKIHILGGFTHIRMARESVVSLILGSPP 253

>SAKL0G03740g Chr7 complement(309922..310722) [801 bp, 266 aa] {ON}
           similar to uniprot|Q7LHP7 Saccharomyces cerevisiae
           YOR145C PNO1 Partner of Nob1 Protein required for cell
           viability
          Length = 266

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 70/155 (45%), Gaps = 4/155 (2%)

Query: 46  PKYRETYLKSVWKDVTKALDSH-HIACTLDLVEGSMTVKTTRK-TYDPAIILKARDLIKL 103
           P +R T L++ W  +   L  H  +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 94  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 153

Query: 104 LARSVPFPQAVKILQ-EDTACDVIKIGNIVT-NKERFVKRRQRLVGPDGNTLKALELLTK 161
            A       A+ +L+ +D   +  ++ ++ T   +   +   R+ G DG T  A+E  T+
Sbjct: 154 FALGFDLDDAIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 213

Query: 162 CYILVQGNTVSAMGPYKGLKELRRVVEDCMHNVHP 196
             I++  + +  +G +  ++  R  V   +    P
Sbjct: 214 TRIVLADSKIHILGGFTHIRMAREAVVSLILGSPP 248

>TDEL0A03460 Chr1 complement(617779..618597) [819 bp, 272 aa] {ON}
           Anc_5.482 YOR145C
          Length = 272

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 70/155 (45%), Gaps = 4/155 (2%)

Query: 46  PKYRETYLKSVWKDVTKALDSH-HIACTLDLVEGSMTVKTTRK-TYDPAIILKARDLIKL 103
           P +R T L++ W  +   L  H  +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 100 PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKHTTDPGALQKGADFIKA 159

Query: 104 LARSVPFPQAVKILQ-EDTACDVIKIGNIVT-NKERFVKRRQRLVGPDGNTLKALELLTK 161
                    ++ +L+ +D   +  +I ++ T N +   +   R+ G DG T  A+E  T+
Sbjct: 160 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 219

Query: 162 CYILVQGNTVSAMGPYKGLKELRRVVEDCMHNVHP 196
             I++  + +  +G +  ++  R  V   +    P
Sbjct: 220 TRIVLADSKIHILGGFTHIRMAREAVVSLILGSPP 254

>ZYRO0D11440g Chr4 complement(964606..965415) [810 bp, 269 aa] {ON}
           highly similar to uniprot|Q7LHP7 Saccharomyces
           cerevisiae YOR145C PNO1 Partner of Nob1 Protein required
           for cell viability
          Length = 269

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 79/177 (44%), Gaps = 5/177 (2%)

Query: 24  FKPEDNASGQPFAEESSFMTLFPKYRETYLKSVWKDVTKALDSH-HIACTLDLVEGSMTV 82
           F     +SG+    ES  + + P +R T L++ W  +   L  H  +   ++L   S+ +
Sbjct: 76  FGSAKKSSGERVKIESRKVGV-PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVEL 134

Query: 83  KT-TRKTYDPAIILKARDLIKLLARSVPFPQAVKILQ-EDTACDVIKIGNIVT-NKERFV 139
           ++  R+T DP  + K  D IK          ++ +L+ +D   +  ++ ++ T N +   
Sbjct: 135 RSHPRQTTDPGALQKGADFIKAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLNGDHLS 194

Query: 140 KRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGLKELRRVVEDCMHNVHP 196
           +   R+ G DG T  A+E  T+  I++    +  +G +  ++  R  V   +    P
Sbjct: 195 RAIGRIAGKDGKTKFAIENATRTRIVLADAKIHILGGFTHIRMAREAVVSLILGSPP 251

>Suva_8.197 Chr8 complement(354586..355410) [825 bp, 274 aa] {ON}
           YOR145C (REAL)
          Length = 274

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 35/157 (22%), Positives = 71/157 (45%), Gaps = 4/157 (2%)

Query: 44  LFPKYRETYLKSVWKDVTKALDSH-HIACTLDLVEGSMTVKTTRK-TYDPAIILKARDLI 101
           + P +R T L++ W  +   L  H  +   ++L   S+ ++T  K T DP  + K  D I
Sbjct: 100 MVPPHRLTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFPQAVKILQ-EDTACDVIKIGNIVT-NKERFVKRRQRLVGPDGNTLKALELL 159
           K  A       ++ +L+ +D   +  ++ ++ T   +   +   R+ G DG T  A+E  
Sbjct: 160 KAFALGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVSAMGPYKGLKELRRVVEDCMHNVHP 196
           T+  I++  + +  +G +  ++  R  V   +    P
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMAREFVVSLILGSPP 256

>Ecym_4552 Chr4 (1087732..1088547) [816 bp, 271 aa] {ON} similar to
           Ashbya gossypii AFR390C
          Length = 271

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 68/146 (46%), Gaps = 4/146 (2%)

Query: 46  PKYRETYLKSVWKDVTKALDSH-HIACTLDLVEGSMTVKTTRK-TYDPAIILKARDLIKL 103
           P +R T L++ W  +   L  H  +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 99  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTVDPGALQKGADFIKT 158

Query: 104 LARSVPFPQAVKILQ-EDTACDVIKIGNIVT-NKERFVKRRQRLVGPDGNTLKALELLTK 161
                    ++ +L+ +D   +  +I ++ T N +   +   R+ G DG T  A+E  T+
Sbjct: 159 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSAMGPYKGLKELRRVV 187
             I++  + +  +G +  ++  R  +
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARETI 244

>Kwal_47.18864 s47 (1004428..1005243) [816 bp, 271 aa] {ON} YOR145C
           - Protein required for cell viability [contig 189] FULL
          Length = 271

 Score = 42.4 bits (98), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 70/155 (45%), Gaps = 4/155 (2%)

Query: 46  PKYRETYLKSVWKDVTKALDSH-HIACTLDLVEGSMTVKTTRK-TYDPAIILKARDLIKL 103
           P +R T L++ W  +   L  H  +   ++L   ++ ++T  K T DP  + K  D IK 
Sbjct: 99  PPHRLTPLRNNWTKIYPPLVDHLKLQVRMNLKTKTVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPFPQAVKILQ-EDTACDVIKIGNIVT-NKERFVKRRQRLVGPDGNTLKALELLTK 161
                    A+ +L+ +D   +  +I ++ T N +   +   R+ G DG T  A+E  T+
Sbjct: 159 FTLGFDLDDAIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSAMGPYKGLKELRRVVEDCMHNVHP 196
             I++  + +  +G +  ++  R  V   +    P
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESVVSLILGSPP 253

>NCAS0A11960 Chr1 complement(2371549..2372361) [813 bp, 270 aa] {ON}
           Anc_5.482 YOR145C
          Length = 270

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/177 (22%), Positives = 76/177 (42%), Gaps = 5/177 (2%)

Query: 24  FKPEDNASGQPFAEESSFMTLFPKYRETYLKSVWKDVTKALDSH-HIACTLDLVEGSMTV 82
           F   + A G     ES  + + P +R T L++ W  +   L  H  +   ++L   S+ +
Sbjct: 77  FSSANKAEGAKVKLESRKVPV-PPHRMTPLRNSWTKIYPPLVDHLKLQVRMNLKTKSVEL 135

Query: 83  KTTRK-TYDPAIILKARDLIKLLARSVPFPQAVKILQ-EDTACDVIKIGNIVT-NKERFV 139
           +T  K T DP  + K  D IK          ++ +L+ +D   +  +I ++ T   +   
Sbjct: 136 RTHPKHTTDPGALQKGADFIKAFTLGFDLDDSIALLRLDDLYIETFEIKDVKTLTGDHLS 195

Query: 140 KRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGLKELRRVVEDCMHNVHP 196
           +   R+ G DG T  A+E  T+  I++    +  +G +  ++  R  V   +    P
Sbjct: 196 RAIGRIAGKDGKTKFAIENATRTRIVLADTKIHILGGFTHIRMAREAVVSLILGSPP 252

>Skud_15.310 Chr15 complement(554002..554832) [831 bp, 276 aa] {ON}
           YOR145C (REAL)
          Length = 276

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/157 (21%), Positives = 70/157 (44%), Gaps = 4/157 (2%)

Query: 44  LFPKYRETYLKSVWKDVTKALDSH-HIACTLDLVEGSMTVKTTRK-TYDPAIILKARDLI 101
           + P +R T L++ W  +   L  H  +   ++L   S+ ++T  K T DP  + K  D I
Sbjct: 102 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 161

Query: 102 KLLARSVPFPQAVKILQ-EDTACDVIKIGNIVT-NKERFVKRRQRLVGPDGNTLKALELL 159
           K          ++ +L+ +D   +  ++ ++ T   +   +   R+ G DG T  A+E  
Sbjct: 162 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 221

Query: 160 TKCYILVQGNTVSAMGPYKGLKELRRVVEDCMHNVHP 196
           T+  I++  + +  +G +  ++  R  V   +    P
Sbjct: 222 TRTRIVLADSKIHILGGFTHIRMARESVVSLILGSPP 258

>YOR145C Chr15 complement(605347..606171) [825 bp, 274 aa] {ON}
           PNO1Essential nucleolar protein required for pre-18S
           rRNA processing, interacts with Dim1p, an 18S rRNA
           dimethyltransferase, and also with Nob1p, which is
           involved in proteasome biogenesis; contains a KH domain
          Length = 274

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/157 (21%), Positives = 70/157 (44%), Gaps = 4/157 (2%)

Query: 44  LFPKYRETYLKSVWKDVTKALDSH-HIACTLDLVEGSMTVKTTRK-TYDPAIILKARDLI 101
           + P +R T L++ W  +   L  H  +   ++L   S+ ++T  K T DP  + K  D I
Sbjct: 100 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFPQAVKILQ-EDTACDVIKIGNIVT-NKERFVKRRQRLVGPDGNTLKALELL 159
           K          ++ +L+ +D   +  ++ ++ T   +   +   R+ G DG T  A+E  
Sbjct: 160 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVSAMGPYKGLKELRRVVEDCMHNVHP 196
           T+  I++  + +  +G +  ++  R  V   +    P
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMARESVVSLILGSPP 256

>KLLA0C06446g Chr3 complement(566371..567195) [825 bp, 274 aa] {ON}
           highly similar to uniprot|Q7LHP7 Saccharomyces
           cerevisiae YOR145C PNO1 Partner of Nob1 Protein required
           for cell viability,
          Length = 274

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 68/146 (46%), Gaps = 4/146 (2%)

Query: 46  PKYRETYLKSVWKDVTKALDSH-HIACTLDLVEGSMTVKTTRK-TYDPAIILKARDLIKL 103
           P +R T LK+ W  +   L  H  +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 102 PPHRMTPLKNNWSKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 161

Query: 104 LARSVPFPQAVKILQ-EDTACDVIKIGNIVTNKERFVKRR-QRLVGPDGNTLKALELLTK 161
                    ++ +L+ +D   +  +I ++ T +   + R   R+ G DG T  A+E  T+
Sbjct: 162 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLQGDHLSRAIGRIAGKDGKTKFAIENATR 221

Query: 162 CYILVQGNTVSAMGPYKGLKELRRVV 187
             I++  + +  +G +  ++  R  V
Sbjct: 222 TRIVLADSKIHILGGFTHIRMARESV 247

>TPHA0J02820 Chr10 complement(627383..628189) [807 bp, 268 aa] {ON}
           Anc_5.482 YOR145C
          Length = 268

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 69/155 (44%), Gaps = 4/155 (2%)

Query: 46  PKYRETYLKSVWKDVTKALDSH-HIACTLDLVEGSMTVKTTRK-TYDPAIILKARDLIKL 103
           P +R T L++ W  +   L  H  +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 96  PPHRMTPLRNSWSKIYPPLVDHLKLQVRMNLKSKSVELRTHPKHTTDPGALQKGADFIKA 155

Query: 104 LARSVPFPQAVKILQ-EDTACDVIKIGNIVT-NKERFVKRRQRLVGPDGNTLKALELLTK 161
                    ++ +L+ +D   +  +I ++ T + +   +   R+ G DG T  A+E  T+
Sbjct: 156 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLHGDHLSRAIGRIAGKDGKTKFAIENATR 215

Query: 162 CYILVQGNTVSAMGPYKGLKELRRVVEDCMHNVHP 196
             I++    +  +G +  ++  R  V   +    P
Sbjct: 216 TRIVLADTKIHILGGFTHIRMAREAVVSLILGSPP 250

>Smik_15.326 Chr15 complement(561176..562000) [825 bp, 274 aa] {ON}
           YOR145C (REAL)
          Length = 274

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/157 (21%), Positives = 70/157 (44%), Gaps = 4/157 (2%)

Query: 44  LFPKYRETYLKSVWKDVTKALDSH-HIACTLDLVEGSMTVKTTRK-TYDPAIILKARDLI 101
           + P +R T L++ W  +   L  H  +   ++L   S+ ++T  K T DP  + K  D I
Sbjct: 100 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFPQAVKILQ-EDTACDVIKIGNIVT-NKERFVKRRQRLVGPDGNTLKALELL 159
           K          ++ +L+ +D   +  ++ ++ T   +   +   R+ G DG T  A+E  
Sbjct: 160 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVSAMGPYKGLKELRRVVEDCMHNVHP 196
           T+  I++  + +  +G +  ++  R  V   +    P
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMARESVVSLILGSPP 256

>AFR390C Chr6 complement(1138631..1139566) [936 bp, 311 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR145C
           (PNO1)
          Length = 311

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 68/146 (46%), Gaps = 4/146 (2%)

Query: 46  PKYRETYLKSVWKDVTKALDSH-HIACTLDLVEGSMTVKT-TRKTYDPAIILKARDLIKL 103
           P +R T L++ W  +   L  H  +   ++L   S+ ++T  R T DP  + K  D IK 
Sbjct: 139 PPHRMTPLRNSWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPRHTTDPGALQKGADFIKA 198

Query: 104 LARSVPFPQAVKILQ-EDTACDVIKIGNIVT-NKERFVKRRQRLVGPDGNTLKALELLTK 161
                    ++ +L+ +D   +  +I ++ T + +   +   R+ G DG +  A+E  T+
Sbjct: 199 FTLGFDLDDSISLLRLDDLYIETFEIKDVKTLHGDHLSRAIGRIAGKDGKSKFAIENATR 258

Query: 162 CYILVQGNTVSAMGPYKGLKELRRVV 187
             I++  + +  +G +  ++  R  V
Sbjct: 259 TRIVLADSKIHILGGFTHIRMAREAV 284

>KAFR0E03600 Chr5 (724338..725168) [831 bp, 276 aa] {ON} Anc_5.482
           YOR145C
          Length = 276

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 69/155 (44%), Gaps = 4/155 (2%)

Query: 46  PKYRETYLKSVWKDVTKALDSH-HIACTLDLVEGSMTVKTTRK-TYDPAIILKARDLIKL 103
           P +R T L++ W  +   L  H  +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 104 PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 163

Query: 104 LARSVPFPQAVKILQ-EDTACDVIKIGNIVT-NKERFVKRRQRLVGPDGNTLKALELLTK 161
                    ++ +L+ +D   +  ++ ++ T   +   +   R+ G DG T  A+E  T+
Sbjct: 164 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 223

Query: 162 CYILVQGNTVSAMGPYKGLKELRRVVEDCMHNVHP 196
             I++  + +  +G +  ++  R  V   +    P
Sbjct: 224 TRIVLADSKIHILGGFTHIRMAREAVVSLILGSPP 258

>CAGL0K09460g Chr11 complement(935326..936111) [786 bp, 261 aa] {ON}
           highly similar to uniprot|Q99216 Saccharomyces
           cerevisiae YOR145c
          Length = 261

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 69/155 (44%), Gaps = 4/155 (2%)

Query: 46  PKYRETYLKSVWKDVTKALDSH-HIACTLDLVEGSMTVKTTRK-TYDPAIILKARDLIKL 103
           P +R T L++ W  +   L  H  +   ++L   ++ ++T  K T DP  + K  D IK 
Sbjct: 89  PPHRMTPLRNSWNKIYPPLVDHLKLQVRMNLKTRTVELRTHPKHTTDPGALQKGADFIKA 148

Query: 104 LARSVPFPQAVKILQ-EDTACDVIKIGNIVT-NKERFVKRRQRLVGPDGNTLKALELLTK 161
                    ++ +L+ +D   +  ++ ++ T   +   +   R+ G DG T  A+E  T+
Sbjct: 149 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 208

Query: 162 CYILVQGNTVSAMGPYKGLKELRRVVEDCMHNVHP 196
             I++  + +  +G +  ++  R  V   +    P
Sbjct: 209 TRIVLADSKIHILGGFTHIRMAREAVVSLILGSPP 243

>NDAI0A04310 Chr1 (970952..971776) [825 bp, 274 aa] {ON} Anc_5.482
           YOR145C
          Length = 274

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 68/155 (43%), Gaps = 4/155 (2%)

Query: 46  PKYRETYLKSVWKDVTKALDSH-HIACTLDLVEGSMTVKTTRK-TYDPAIILKARDLIKL 103
           P +R T L++ W  +   L  H  +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 102 PPHRMTPLRNSWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 161

Query: 104 LARSVPFPQAVKILQ-EDTACDVIKIGNIVT-NKERFVKRRQRLVGPDGNTLKALELLTK 161
                    ++ +L+ +D   +  +I ++ T   +   +   R+ G DG T  A+E  T+
Sbjct: 162 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 221

Query: 162 CYILVQGNTVSAMGPYKGLKELRRVVEDCMHNVHP 196
             I++    +  +G +  ++  R  V   +    P
Sbjct: 222 TRIVLADTKIHILGGFTHIRMARESVVSLILGSPP 256

>KNAG0C04610 Chr3 (905301..906134) [834 bp, 277 aa] {ON} Anc_5.482
           YOR145C
          Length = 277

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 38/168 (22%), Positives = 76/168 (45%), Gaps = 5/168 (2%)

Query: 24  FKPEDNASGQPFAEESSFMTLFPKYRETYLKSVWKDVTKALDSH-HIACTLDLVEGSMTV 82
           F   + AS      ES  + + P +R T L++ W  +   L  H  +   ++L   S+ +
Sbjct: 84  FSSANKASETKIKAESRKVAV-PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVEL 142

Query: 83  KTTRK-TYDPAIILKARDLIKLLARSVPFPQAVKILQ-EDTACDVIKIGNIVT-NKERFV 139
           +T  K T DP  + K  D IK          ++ +L+ +D   +  ++ ++ T + +   
Sbjct: 143 RTHPKHTTDPGALQKGADFIKAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLHGDHLS 202

Query: 140 KRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGLKELRRVV 187
           +   R+ G DG T  A+E  T+  I++  + +  +G +  ++  R  V
Sbjct: 203 RAIGRIAGKDGKTKFAIENATRTRIVLADSKIHILGGFTHIRMARESV 250

>TBLA0D01890 Chr4 (461527..462342) [816 bp, 271 aa] {ON} Anc_5.482
           YOR145C
          Length = 271

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 37/172 (21%), Positives = 74/172 (43%), Gaps = 4/172 (2%)

Query: 29  NASGQPFAEESSFMTLFPKYRETYLKSVWKDVTKALDSH-HIACTLDLVEGSMTVKTTRK 87
           N S Q   +  S     P +R T L++ W  +   L  H  +   ++L   S+ ++T  K
Sbjct: 82  NKSKQTKVKLESRKVAVPPHRMTPLRNNWPKIYPPLVDHLKLQVRMNLRTKSVELRTHPK 141

Query: 88  -TYDPAIILKARDLIKLLARSVPFPQAVKILQ-EDTACDVIKIGNIVT-NKERFVKRRQR 144
            T DP  + K  D IK          ++ +L+ +D   +  ++ ++ T   +   +   R
Sbjct: 142 HTTDPGALQKGADFIKAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGR 201

Query: 145 LVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGLKELRRVVEDCMHNVHP 196
           + G DG T  A+E  T+  I++  + +  +G +  ++  R  +   +    P
Sbjct: 202 IAGKDGKTKFAIENATRTRIVLADSKIHILGGFTHIRMARESIVSLILGSPP 253

>AAR002W Chr1 (341790..342326) [537 bp, 178 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR003W (MRPL32)
          Length = 178

 Score = 36.2 bits (82), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 65/161 (40%), Gaps = 31/161 (19%)

Query: 54  KSVWKDVTKALDSHHIACTLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQA 113
           ++VW +V +AL      CT  L          R       ++  R L++LL R+    QA
Sbjct: 4   QAVWGNVGRALSE----CTAALF--------PRLELGSGSVIAPRTLLELLRRAGGSQQA 51

Query: 114 VKILQEDTACDVIKIGNIVTNKERFVKRRQRLVGPDGNTLKALELLTKCYILVQGNTVSA 173
                     D + +  +   K    KRRQ+L GP    L+ +  L KC          +
Sbjct: 52  G---TAAVGADGLVLA-VPKKKVSHQKRRQKLYGPGKKQLQMVHHLGKC---------PS 98

Query: 174 MGPYKGLKELRRVVEDCMHNVHPIYHIKELMIKRELAKKPE 214
            G YK L  L      CM+ V  I HI ++  + + A+ P+
Sbjct: 99  CGHYKRLNTL------CMYCVGEIRHIWKVYTQTKPAEPPQ 133

>Smik_4.412 Chr4 (748318..749838) [1521 bp, 506 aa] {ON} YDR168W
           (REAL)
          Length = 506

 Score = 33.5 bits (75), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 1/68 (1%)

Query: 92  AIILKARDLIKLLARSVPFPQAVKILQEDTACDVIKIGNIVTNKERFVKRRQRLV-GPDG 150
           AI+ K  D I  +   +P  +A KIL+     D+I I  I+ N++ F   + + V G D 
Sbjct: 418 AIMTKNLDNINKVFEDIPIAEAEKILEVFNDIDIIGIKAILENEKDFQSLKDQYVQGHDD 477

Query: 151 NTLKALEL 158
            T++ L L
Sbjct: 478 ATIEGLAL 485

>SAKL0D08822g Chr4 complement(734328..734879) [552 bp, 183 aa] {ON}
           similar to uniprot|P25348 Saccharomyces cerevisiae
           YCR003W MRPL32 Mitochondrial ribosomal protein of the
           large subunit
          Length = 183

 Score = 32.7 bits (73), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 27/61 (44%), Gaps = 15/61 (24%)

Query: 140 KRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGLKELRRVVEDCMHNVHPIYH 199
           K+RQ+L GP    LK +  L KC          + G YK      R    CMH V+ I H
Sbjct: 78  KKRQKLYGPGKKQLKMIHHLNKC---------PSCGHYK------RANTLCMHCVNEIRH 122

Query: 200 I 200
           I
Sbjct: 123 I 123

>KAFR0B03030 Chr2 (632585..633988) [1404 bp, 467 aa] {ON} Anc_8.309
           YLR116W
          Length = 467

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query: 145 LVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKG-LKELRRVVEDCMH 192
           L+GP GNTL+ L+  +KC I ++G      G +   L E    +ED +H
Sbjct: 151 LLGPRGNTLRKLQEQSKCKIAIRGRGSVKEGKHANDLPEGAMNMEDPLH 199

>ZYRO0E04356g Chr5 complement(332059..332619) [561 bp, 186 aa] {ON}
           similar to uniprot|P25348 Saccharomyces cerevisiae
           YCR003W MRPL32 Mitochondrial ribosomal protein of the
           large subunit
          Length = 186

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 35/85 (41%), Gaps = 15/85 (17%)

Query: 116 ILQEDTACDVIKIGNIVTNKERFVKRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMG 175
           I++ED   +  ++  +   K    K+RQRL  P    LK +  L KC          + G
Sbjct: 57  IVEEDFFSNNGRLLAVPKKKVTHQKKRQRLYAPGKKQLKFIHELNKC---------PSCG 107

Query: 176 PYKGLKELRRVVEDCMHNVHPIYHI 200
            YK    L      CMH V  + HI
Sbjct: 108 HYKRANCL------CMHCVQHVRHI 126

>KNAG0G02350 Chr7 (542717..544210) [1494 bp, 497 aa] {ON} Anc_8.309
           YLR116W
          Length = 497

 Score = 30.8 bits (68), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 1/49 (2%)

Query: 145 LVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKG-LKELRRVVEDCMH 192
           L+GP GNTLK L+  + C I ++G      G   G L +    +ED +H
Sbjct: 148 LLGPRGNTLKQLQKQSNCKIAIRGRGSVKEGKGSGDLPDGAMNMEDPLH 196

>KLTH0E14014g Chr5 (1239444..1240904) [1461 bp, 486 aa] {ON} similar
           to uniprot|Q12096 Saccharomyces cerevisiae YOR320C GNT1
           N-acetylglucosaminyltransferase capable of modification
           of N-linked glycans in the Golgi apparatus
          Length = 486

 Score = 30.8 bits (68), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 40/99 (40%), Gaps = 20/99 (20%)

Query: 137 RFV-KRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGLKELRRVVEDCMHNVH 195
           RF+ KRR RLVG  G  +  + L  KC +  Q N        + ++  R        N+H
Sbjct: 2   RFLFKRRLRLVGAIGAVVLLISLTAKCVVQFQLN--------REIEHYRTFFRKHKDNIH 53

Query: 196 PIYH-----------IKELMIKRELAKKPELANEDWSRF 223
            IY            I+ L   R+    P+ +  DW ++
Sbjct: 54  DIYDPLNIKQIPYETIESLYQLRKTGDVPKKSPIDWGKY 92

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,918,109
Number of extensions: 1429790
Number of successful extensions: 10150
Number of sequences better than 10.0: 130
Number of HSP's gapped: 10111
Number of HSP's successfully gapped: 149
Length of query: 349
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 239
Effective length of database: 40,868,139
Effective search space: 9767485221
Effective search space used: 9767485221
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)