Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0C002201.5ON1161116146740.0
KAFR0D001401.5ON10419789211e-106
NCAS0B091101.5ON10208537694e-85
YCL061C (MRC1)1.5ON10964797424e-81
Smik_3.141.5ON11134747301e-79
Suva_3.1521.5ON11403727195e-78
TBLA0A075701.5ON12526136844e-73
NDAI0A001401.5ON10914376708e-72
TPHA0E040101.5ON9657676562e-70
SAKL0C00462g1.5ON11773736577e-70
Kpol_2002.81.5ON9854196492e-69
ZYRO0F18480g1.5ON9604035959e-63
TDEL0C069701.5ON9415805842e-61
CAGL0B00330g1.5ON11364005874e-61
KLLA0C00484g1.5ON9253854909e-50
Ecym_10081.5ON11183774634e-46
KLTH0F00484g1.5ON9933864591e-45
AFR745W1.5ON10183374501e-44
Kwal_33.130051.5ON9706284383e-43
Skud_3.31.5ON11523591604e-10
KLTH0D09482g8.603ON22455790.71
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0C00220
         (1161 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0C00220 Chr3 complement(33011..36496) [3486 bp, 1161 aa] {ON...  1805   0.0  
KAFR0D00140 Chr4 complement(13233..16358) [3126 bp, 1041 aa] {ON...   359   e-106
NCAS0B09110 Chr2 (1746358..1749420) [3063 bp, 1020 aa] {ON} Anc_...   300   4e-85
YCL061C Chr3 complement(18816..22106) [3291 bp, 1096 aa] {ON}  M...   290   4e-81
Smik_3.14 Chr3 complement(20226..23567) [3342 bp, 1113 aa] {ON} ...   285   1e-79
Suva_3.152 Chr3 complement(228665..232087) [3423 bp, 1140 aa] {O...   281   5e-78
TBLA0A07570 Chr1 (1874419..1878177) [3759 bp, 1252 aa] {ON} Anc_...   268   4e-73
NDAI0A00140 Chr1 complement(8373..11648) [3276 bp, 1091 aa] {ON}...   262   8e-72
TPHA0E04010 Chr5 (839903..842800) [2898 bp, 965 aa] {ON} Anc_1.5...   257   2e-70
SAKL0C00462g Chr3 complement(41257..44790) [3534 bp, 1177 aa] {O...   257   7e-70
Kpol_2002.8 s2002 complement(11914..14871) [2958 bp, 985 aa] {ON...   254   2e-69
ZYRO0F18480g Chr6 (1524051..1526933) [2883 bp, 960 aa] {ON} weak...   233   9e-63
TDEL0C06970 Chr3 (1264155..1266980) [2826 bp, 941 aa] {ON} Anc_1...   229   2e-61
CAGL0B00330g Chr2 complement(18031..21441) [3411 bp, 1136 aa] {O...   230   4e-61
KLLA0C00484g Chr3 complement(35397..38174) [2778 bp, 925 aa] {ON...   193   9e-50
Ecym_1008 Chr1 complement(13340..16696) [3357 bp, 1118 aa] {ON} ...   182   4e-46
KLTH0F00484g Chr6 complement(37017..39998) [2982 bp, 993 aa] {ON...   181   1e-45
AFR745W Chr6 (1803046..1806102) [3057 bp, 1018 aa] {ON} Syntenic...   177   1e-44
Kwal_33.13005 s33 complement(36797..39709) [2913 bp, 970 aa] {ON...   173   3e-43
Skud_3.3 Chr3 complement(6855..10313) [3459 bp, 1152 aa] {ON} YC...    66   4e-10
KLTH0D09482g Chr4 complement(781892..782566) [675 bp, 224 aa] {O...    35   0.71 

>KNAG0C00220 Chr3 complement(33011..36496) [3486 bp, 1161 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1161

 Score = 1805 bits (4674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 922/1161 (79%), Positives = 922/1161 (79%)

Query: 1    MDDLLERFNSXXXXXXXXXXXXQQNSTDEAAGDDDCVPTSLAGNGFLFGNATVDKIKNRL 60
            MDDLLERFNS            QQNSTDEAAGDDDCVPTSLAGNGFLFGNATVDKIKNRL
Sbjct: 1    MDDLLERFNSVKVKRRTTYKKVQQNSTDEAAGDDDCVPTSLAGNGFLFGNATVDKIKNRL 60

Query: 61   NNEDHPNSSIDVTKSSSEDQIPVSQSQLLSTLYDGGEDXXXXXXXXXXXXXXXXXXXXXX 120
            NNEDHPNSSIDVTKSSSEDQIPVSQSQLLSTLYDGGED                      
Sbjct: 61   NNEDHPNSSIDVTKSSSEDQIPVSQSQLLSTLYDGGEDLESLERKKERKKRKEEQKLLEQ 120

Query: 121  XXXXXNGLVDTHVDYTQVIYANAPVRRSTRKAKLTKRNALDESDQHTNNFDKVQESDLSH 180
                 NGLVDTHVDYTQVIYANAPVRRSTRKAKLTKRNALDESDQHTNNFDKVQESDLSH
Sbjct: 121  KLKEKNGLVDTHVDYTQVIYANAPVRRSTRKAKLTKRNALDESDQHTNNFDKVQESDLSH 180

Query: 181  TNVGNKLEEQLESKDVSRQLRDIKLQSTTHLPTSTSRTRQINYSPTSEGAIGGELLKTQT 240
            TNVGNKLEEQLESKDVSRQLRDIKLQSTTHLPTSTSRTRQINYSPTSEGAIGGELLKTQT
Sbjct: 181  TNVGNKLEEQLESKDVSRQLRDIKLQSTTHLPTSTSRTRQINYSPTSEGAIGGELLKTQT 240

Query: 241  VNARTQATQVIHSDTQPTQLVDTDTQPTQIVXXXXXXXXXXXXXXXXXXXXXAQPAQIID 300
            VNARTQATQVIHSDTQPTQLVDTDTQPTQIV                     AQPAQIID
Sbjct: 241  VNARTQATQVIHSDTQPTQLVDTDTQPTQIVDTDSQPTQIIDTDTQPTQLIDAQPAQIID 300

Query: 301  AETQPTQIIDTNAQPTQIIDPDTQPTQLINYSHESNGKHIPTLPAPDAXXXXXXXXXXXN 360
            AETQPTQIIDTNAQPTQIIDPDTQPTQLINYSHESNGKHIPTLPAPDA           N
Sbjct: 301  AETQPTQIIDTNAQPTQIIDPDTQPTQLINYSHESNGKHIPTLPAPDALLSTGTSLLGLN 360

Query: 361  IPLHRYATAGTTSNPKHKNDSQHIIEDNIATMRDRLETQEFQPTVADDVKSGGNTLKIHE 420
            IPLHRYATAGTTSNPKHKNDSQHIIEDNIATMRDRLETQEFQPTVADDVKSGGNTLKIHE
Sbjct: 361  IPLHRYATAGTTSNPKHKNDSQHIIEDNIATMRDRLETQEFQPTVADDVKSGGNTLKIHE 420

Query: 421  IQTQIDEETRNMLNRGVEHRKSRGVPSRVEVRFTKESFXXXXXXXXXXXXXXXXXXQIND 480
            IQTQIDEETRNMLNRGVEHRKSRGVPSRVEVRFTKESF                  QIND
Sbjct: 421  IQTQIDEETRNMLNRGVEHRKSRGVPSRVEVRFTKESFMADFEESDSASDMESDSDQIND 480

Query: 481  TTPETGSSQNSDSNKARKPTEAPKTKRVTGLSSYETILRNKVNDDECLDLGXXXXXXXXX 540
            TTPETGSSQNSDSNKARKPTEAPKTKRVTGLSSYETILRNKVNDDECLDLG         
Sbjct: 481  TTPETGSSQNSDSNKARKPTEAPKTKRVTGLSSYETILRNKVNDDECLDLGSDDTYSSEE 540

Query: 541  XXXXXXXVSQASXXXXXXXXXXXXXXXXXXXXXXTNKTTLDSLFSDLKKKNRQQILSHQA 600
                   VSQAS                      TNKTTLDSLFSDLKKKNRQQILSHQA
Sbjct: 541  EYDKESKVSQASKAAVLNIKAKALKKKAIVKAANTNKTTLDSLFSDLKKKNRQQILSHQA 600

Query: 601  EIIGTKGINHKDLEREKEIVEDLLEQEIXXXXXXXXXXXXXXXXXXXXSDMDNNYSANEL 660
            EIIGTKGINHKDLEREKEIVEDLLEQEI                    SDMDNNYSANEL
Sbjct: 601  EIIGTKGINHKDLEREKEIVEDLLEQEILRNKRLREREREREQKEEEQSDMDNNYSANEL 660

Query: 661  ESFDDSDHDSLXXXXXXXXXXXXXXXXXXXXXXXXFAAFQVLKGKKRKNMQIQPESDSEE 720
            ESFDDSDHDSL                        FAAFQVLKGKKRKNMQIQPESDSEE
Sbjct: 661  ESFDDSDHDSLNEDEPNINDDNNSSNGVDSEDEEEFAAFQVLKGKKRKNMQIQPESDSEE 720

Query: 721  ETVNSNDKRVNAPSESKPIHPVNNINAIDLGDYGNNLEIRAELNNTEKLDTKCMLDEKEH 780
            ETVNSNDKRVNAPSESKPIHPVNNINAIDLGDYGNNLEIRAELNNTEKLDTKCMLDEKEH
Sbjct: 721  ETVNSNDKRVNAPSESKPIHPVNNINAIDLGDYGNNLEIRAELNNTEKLDTKCMLDEKEH 780

Query: 781  ARAVDKERLKTIMKEKKLMLKRAELKEKGVSNFFXXXXXXXXXXWHGIGGIDGEVSDEYD 840
            ARAVDKERLKTIMKEKKLMLKRAELKEKGVSNFF          WHGIGGIDGEVSDEYD
Sbjct: 781  ARAVDKERLKTIMKEKKLMLKRAELKEKGVSNFFEEEAEESEDEWHGIGGIDGEVSDEYD 840

Query: 841  SEVEKMIDDYSRADMDPEEIRKLLVSENKEMDVKMVNKILFDIKNGNFRKRGRDTXXXXX 900
            SEVEKMIDDYSRADMDPEEIRKLLVSENKEMDVKMVNKILFDIKNGNFRKRGRDT     
Sbjct: 841  SEVEKMIDDYSRADMDPEEIRKLLVSENKEMDVKMVNKILFDIKNGNFRKRGRDTLELEL 900

Query: 901  XXXXXXXXRQYRQKRNELMKQRXXXXXXXXXXXXXXXTKAFFDSLVEDIVEVKNPFGVMS 960
                    RQYRQKRNELMKQR               TKAFFDSLVEDIVEVKNPFGVMS
Sbjct: 901  SDEEDDDLRQYRQKRNELMKQRLLDLGDDKKLVKNVKTKAFFDSLVEDIVEVKNPFGVMS 960

Query: 961  DNXXXXXXXXXXXXXXXRESVSNKEEKPTQEKGKKTVLSEEFVQRSLSFLNSNRNLTEFE 1020
            DN               RESVSNKEEKPTQEKGKKTVLSEEFVQRSLSFLNSNRNLTEFE
Sbjct: 961  DNETQDTDETTTIDTQTRESVSNKEEKPTQEKGKKTVLSEEFVQRSLSFLNSNRNLTEFE 1020

Query: 1021 QNQDLARLQHDDDVSDLYTLXXXXXXXXXXXXXXXNEIINVDANDNSGTAVATATFRPPS 1080
            QNQDLARLQHDDDVSDLYTL               NEIINVDANDNSGTAVATATFRPPS
Sbjct: 1021 QNQDLARLQHDDDVSDLYTLKKQSSVKSFKSVGSKNEIINVDANDNSGTAVATATFRPPS 1080

Query: 1081 IIKSFNSKLNVDDKFRNGKKTVKTFKSYKAVGGSKTSVTYMNKVRKLTAPKSLKKLHSTG 1140
            IIKSFNSKLNVDDKFRNGKKTVKTFKSYKAVGGSKTSVTYMNKVRKLTAPKSLKKLHSTG
Sbjct: 1081 IIKSFNSKLNVDDKFRNGKKTVKTFKSYKAVGGSKTSVTYMNKVRKLTAPKSLKKLHSTG 1140

Query: 1141 GERKISAQTSHSFKSNSNFDS 1161
            GERKISAQTSHSFKSNSNFDS
Sbjct: 1141 GERKISAQTSHSFKSNSNFDS 1161

>KAFR0D00140 Chr4 complement(13233..16358) [3126 bp, 1041 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1041

 Score =  359 bits (921), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 308/978 (31%), Positives = 454/978 (46%), Gaps = 142/978 (14%)

Query: 200  LRDIKLQSTTHLPTSTSRTRQINYSPTSEGAIGGELLKTQTVNARTQATQVIHSDTQP-T 258
            + D++L   T +  ST   ++  +SP S           + V    Q+TQVIHS TQ  T
Sbjct: 129  INDLRLMQPTQVIGSTQLAKE--FSPVSRTYF-------KYVPDVNQSTQVIHSATQDDT 179

Query: 259  QLV---DTDTQPTQIVXXXXXXXXXXXXXXXXXXXXXAQPAQIIDAETQPTQIIDTNAQP 315
            Q+V   + DTQ TQ+                          Q++ A TQ       N Q 
Sbjct: 180  QVVSAREADTQATQMT-------------------------QVLSASTQGI----YNTQE 210

Query: 316  TQIIDPDTQPTQLINYSHESNGKHIPTLPAPDAXXXXXXXXXXXNIPLHRYATAGTTSNP 375
            TQ I   TQP    + + +         P P+             IP      A T   P
Sbjct: 211  TQSITDSTQPISYSSSTQDYKTNKFNRHPTPEDTQI---------IPREFDDDASTLPIP 261

Query: 376  ---KHKNDSQHIIEDNIATMRDRLETQEFQPTVADDVKSGGNTLKIHEIQTQIDEETRNM 432
               K + D+  +++  I +     E   +  TV+D       TLKIHEIQ +++E  +  
Sbjct: 262  EGDKTQKDTSAVLKTQIDST---TEGTSYSATVSD-------TLKIHEIQRELEESQKT- 310

Query: 433  LNRGVEHRKSRGVPSRVEVRFTKESF-------XXXXXXXXXXXXXXXXXXQINDTTPET 485
                 E+++    P  V V FTKES+                          + +T+P  
Sbjct: 311  -KTIPEYKQHVRTPKNVIV-FTKESYFDEFDSDDEEKEENLESEGDSQKVQLLKNTSPSD 368

Query: 486  GSSQNSD-SNKAR-KPTEAPKTKRVTGLSSYETILRNKVNDDECLDLGXXXXXXXXXXXX 543
             S+      +K R  P+  PK   + GL++YE  L+ ++N D+ +DL             
Sbjct: 369  KSNDGKRLPDKTRTSPSFKPK---LHGLNNYELKLKRQLNSDQQIDLNLDSDDEDGIDRM 425

Query: 544  XXXX-VSQASXXXXXXXXXXXXXXXXXXXXXXTNKTTLDSLFSDLKKKNRQQILSHQAEI 602
                 +SQ S                       +KTTL +LF+ L+K +RQQI+ HQ E+
Sbjct: 426  GEKGPISQMSKATVFDIKARLSKKRPIVKISNDSKTTLHTLFNKLQKASRQQIIEHQKEV 485

Query: 603  IGTKGINHKDLEREKEIVEDLLEQEIXXXXX----XXXXXXXXXXXXXXXSDMDNNYSAN 658
            I  KG+N +D+E+EK+IVE+LLEQEI                        +D+D ++SAN
Sbjct: 486  IEKKGLNLEDIEKEKKIVENLLEQEINRNKKIRQREKEREKQLADAQDDENDLDFDHSAN 545

Query: 659  EL--------ESFDDSDHDSLXXXXXXXXXXXXXXXXXXXXXXXXFAAFQVLKGKKRKNM 710
            EL        ES  DSD+D                          +  F + K K+ K  
Sbjct: 546  ELDESELSGEESAIDSDND--------------------------YDDFSLEKTKRSKKK 579

Query: 711  QIQPESDSE-EETVNSNDKRVNAPSESKPIHPVNNINAIDLGDYGNNLEIRAELNNTEKL 769
             I  +SD+E E+   S++ ++    E K      N NAI+LG YG+NL +      TEK 
Sbjct: 580  VIVEDSDTEIEDEKMSHNAQIR---EEKDDSLFQNRNAINLGPYGDNLSLAPIRITTEKQ 636

Query: 770  DTKCM-------------LDEKEHARAVDKERLKTIMKEKKLMLKRAELKEKGVSNFFXX 816
              K               + EK+  R +++++   + +++K M KR E+K KG++NF   
Sbjct: 637  SGKNFKVSRESGDERDEEIPEKDRIRLIEEKKQHELERQRKQMKKRKEMKAKGITNFLEE 696

Query: 817  XXXXXXXXWHGIGGIDGEVSDEYDSEVEKMIDDYSRADMDPEEIRKLLVSENKEMDVKMV 876
                    WHGIGGIDGE+SDEYDSEVEKMIDDYS+A+ +P+EIR++L  ENKE D+KMV
Sbjct: 697  EAEESEDEWHGIGGIDGEMSDEYDSEVEKMIDDYSKANFNPDEIRQMLADENKETDIKMV 756

Query: 877  NKILFDIKNGNFRKRGRDTXXXXXXXXXXXXXRQYRQKRNELMKQRXXXXXXXXXXXXXX 936
             KIL+DIKNG FRKR +               +QYR KR ELM+Q+              
Sbjct: 757  EKILYDIKNGGFRKRRKGAMDLELSDEEDDELKQYRLKRRELMRQKRLEVGEAETLVKNP 816

Query: 937  XTKAFFDSLVEDIVEVKNPFGVMSDNXXXXXXXXXXXXXXXRESVSNKEEKPTQEKGKKT 996
             +KAFF+S+V+DIVEVKNPF V                   +E+ ++ E   +Q   KK 
Sbjct: 817  KSKAFFESMVDDIVEVKNPFAVF----EPQRSGTITTDDGTQENANSNEGAASQNPSKKV 872

Query: 997  VLSEEFVQRSLSFLNSNRNLTEFEQNQDLARLQHDDDVSDLYTLXXXXXXXX--XXXXXX 1054
            +LSEEFVQR+LSFLNS++++ +F   + +    +D+ + DL  L                
Sbjct: 873  MLSEEFVQRTLSFLNSSKDMDQFAPARSMRAEANDELIEDLTALKKQSSIKSFKTTRASV 932

Query: 1055 XNEIINVDA-NDNSGTAVATATFRPPSIIKSFNSKLNVDDKFRNGKKTVKTFKSYKAVGG 1113
              E  + D  ND+S   +  +     SI+K+F++ ++++DKF+ G KTVK  K+YK+V  
Sbjct: 933  SQEPTDFDKENDDSFDDLLNSRVGTSSIMKTFSATVDINDKFQEGVKTVKVSKAYKSVSS 992

Query: 1114 SKTSVTYMNKVRKLTAPK 1131
            SK S+TYM K+RKL AP+
Sbjct: 993  SKASITYMGKMRKLVAPQ 1010

 Score = 52.0 bits (123), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 44/75 (58%), Gaps = 13/75 (17%)

Query: 24 QNSTDEAAGDDDCVPTSLAGNGFLFGNATVDKIKNRLNNEDHPNSSIDVTKSSSEDQIPV 83
          +N T E+  D    P +L G GFLF N T+++IK RL+ E+      DV + +    +  
Sbjct: 27 ENDTSESNND----PPALTGEGFLFDNPTLNRIKKRLDGEEK-----DVVQYT----MNF 73

Query: 84 SQSQLLSTLYDGGED 98
          SQ+QL+S LY GGED
Sbjct: 74 SQTQLISNLYGGGED 88

>NCAS0B09110 Chr2 (1746358..1749420) [3063 bp, 1020 aa] {ON} Anc_1.5
            YCL061C
          Length = 1020

 Score =  300 bits (769), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 278/853 (32%), Positives = 399/853 (46%), Gaps = 109/853 (12%)

Query: 360  NIPLHRYATAGTTSNPKHK-----------NDSQHIIEDNI----ATMRDRLETQEFQPT 404
            N+P H  AT  +TS   H+            D+Q I   N+    ATM D     E Q T
Sbjct: 212  NLPNH--ATDNSTSKRAHRISQELQRTMTDMDTQVINNTNLDVIEATMADLPNLNEPQST 269

Query: 405  VADDVKSGGNTLKIHEIQTQIDEETRNMLNRGVEHRKSRGVPSR----VEVRFTKESFXX 460
            VAD   +G   LKIHEIQ +++ E      R  +  K    PS+    + ++F+K S   
Sbjct: 270  VADIPSTG---LKIHEIQKELERE------RNSKELKEYKKPSKEIKVIPIKFSKTSLL- 319

Query: 461  XXXXXXXXXXXXXXXXQINDTTPETGSSQNSDSNKARKPT---EAPKTKR--------VT 509
                               D    + S    +  K  K T   E P++          +T
Sbjct: 320  -------------------DGFDNSSSDDELEVQKDMKITRTKEKPESSIKPKIKPKKLT 360

Query: 510  GLSSYETILRNKVNDDECLDLGXXXXXXXXXXXXXXXXVSQASXXXXXXXXXXXXXXXXX 569
            GL++YE  L+ K+ + + + L                 +S+ S                 
Sbjct: 361  GLNTYENKLKKKLLEKKHIQL--DSDSDNDSDIAKRFPISRTSKATLLNLKARLSKKKPV 418

Query: 570  XXXXXTNKTTLDSLFSDLKKKNRQQILSHQAEIIGTKGINHKDLEREKEIVEDLLEQEIX 629
                 TN T+LD LF +LK+ +R+QIL HQ E++  +G   +D+E+EKEIVE+LLE+EI 
Sbjct: 419  KSNKSTN-TSLDVLFQNLKQASRKQILDHQRELVENRGFKLEDIEKEKEIVENLLEEEIK 477

Query: 630  XXXXXXXXXXXXXXXXXXXSDMDNNYSANELE-SFDDSDHDSLXXXXXXXXXXXXXXXXX 688
                                D D + SANELE   +D  +DS                  
Sbjct: 478  RNKRIRMREKQKEKSLSENEDADFDLSANELEDEEEDGVNDSDNIANSQISDEEDEDSDS 537

Query: 689  XXXXXXXFAAFQVLKGKKRKNMQIQPE---SDSEEETVNSNDKRVNAP----SESKPIHP 741
                    A  +    ++  N  I  +   SD +E+++    ++   P     ES   + 
Sbjct: 538  VLDNGNHVADEEGDANREADNSSISSKNEISDEDEDSIFQLTRKEKHPVRIIQESDDENE 597

Query: 742  VNNINAIDLGDYGNNLEIRAELN-----NTEKLDTKCMLDEKE------HARAV-DKERL 789
            +N IN IDLG YG NL+    L+     N +  D K   + KE      HA  + +K+R+
Sbjct: 598  INKINTIDLGVYGGNLDNPNPLSSQTEPNEDDEDEKSTYENKEITEEERHALILAEKKRI 657

Query: 790  KTIMKEKKLMLKRAELKEKGVSNFFXXXXXXXXXXWHGIGGIDGEVSDEYDSEVEKMIDD 849
            + I  EKK   +  E+K+KGV+  F          WHGIGG DGEVSDEYDSEVEKMIDD
Sbjct: 658  QLI--EKKNAARTKEMKKKGVNKLFEMEAEESEDEWHGIGGADGEVSDEYDSEVEKMIDD 715

Query: 850  YSRADMDPEEIRKLLVSENKEMDVKMVNKILFDIKN--GNFRKRGRDTXXXXXXXXXXXX 907
            YS+++ +P+EIR++L  ENKEMD+ M+ KIL+DIKN     R+RG               
Sbjct: 716  YSKSNFNPDEIRQMLALENKEMDLNMITKILYDIKNGGFRKRRRGGLDLELSDDDEDDEE 775

Query: 908  XRQYRQKRNELMKQRXXXXXXXXXXXXXXXTKAFFDSLVEDIVEVKNPFGVMSDNXXXXX 967
             R+Y +++ ELMK+R               +KAFF+S+VEDIV+ KN FG +        
Sbjct: 776  LREYHKRKRELMKKRMLEIGDDKKLIKNPKSKAFFESMVEDIVDEKNAFGDIE------- 828

Query: 968  XXXXXXXXXXRESVSNKEEK-----PTQEKGKKTVLSEEFVQRSLSFLNSNRNLTEFEQN 1022
                         +  +EEK     P  +K KK V+SEEFVQ++LSFL S R+L EF   
Sbjct: 829  -----SIEKSSTELDTQEEKEQDVTPGVDK-KKNVISEEFVQKTLSFLRSGRDLEEFNIE 882

Query: 1023 QDLARLQHDDDVSDLYTLXXXXXXXXXXXXXXXNEIINVDANDNSGTAVATATFRPPSII 1082
            +DLA+ QH ++V DL++L               N I  ++  +N  ++     F+PPS+I
Sbjct: 883  EDLAKEQHGENVEDLFSLKQRSTIKEFRNPSQTNTIDLINNVENVESS-PLGGFKPPSVI 941

Query: 1083 KSFNSKLNVDDKFRNGKKTVKTFKSYKAVGGSKTSVTYMNKVRKLTAPKSLKKLHSTGGE 1142
            KSF+S+ ++++KF++G KTV   K YK VG SK S+TY+ K RKL  PK  K     G  
Sbjct: 942  KSFSSRTDINEKFKDGNKTVTISKVYKTVGSSKASITYLGKSRKLMPPKKNKNREKIGS- 1000

Query: 1143 RKISAQTSHSFKS 1155
             KI    S  F S
Sbjct: 1001 -KIKPTRSSLFSS 1012

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 33/59 (55%), Gaps = 11/59 (18%)

Query: 35 DCVPTSLAGNGFLFGNATVDKIKNRLNNEDHPNSSIDVTKSSSEDQIPVSQSQLLSTLY 93
          D +   + GNGF+FGNA +DKI+NRL+            K + ED    +Q+Q++  LY
Sbjct: 38 DVMAPPVIGNGFIFGNALIDKIRNRLDG-----------KENKEDTPVPTQTQMIDNLY 85

>YCL061C Chr3 complement(18816..22106) [3291 bp, 1096 aa] {ON}
            MRC1S-phase checkpoint protein required for DNA
            replication; interacts with and stabilizes Pol2p at
            stalled replication forks during stress, where it forms a
            pausing complex with Tof1p and is phosphorylated by
            Mec1p; protects uncapped telomeres
          Length = 1096

 Score =  290 bits (742), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 190/479 (39%), Positives = 259/479 (54%), Gaps = 58/479 (12%)

Query: 701  VLKGKKRKNMQ-IQPESDSEEETVNSNDKRVNAPSESKPIHPVNNINAIDLGDYGNNL-- 757
            +LK KK  +++ I  ESDS        D  V A  + K    +    AI+LG YG+N+  
Sbjct: 589  ILKQKKSHHVKHIINESDS--------DTEVEAKPKEKADESLPKRIAINLGHYGDNIGE 640

Query: 758  -----------------EIRAELNNTE---KLDTKC--MLDEKEHARAVDKERLKTIMKE 795
                             E+ AE N  E   K D       DE    + +DKE+L+   KE
Sbjct: 641  DTDKFQETNVLDTQNIEEVMAERNTIENEVKDDVYVNEEADEAIRRQLIDKEKLQLKQKE 700

Query: 796  KKLMLKRAELKEKGVSNFFXXXXXXXXXXWHGIGGIDGEVSDEYDSEVEKMIDDYSRADM 855
            K+   K  ELK++GV+NFF          WHGIGG DGE SD+YDS++EKMIDDYS+ + 
Sbjct: 701  KEHEAKIKELKKRGVTNFFEMEAEESEDEWHGIGGADGEGSDDYDSDLEKMIDDYSKNNF 760

Query: 856  DPEEIRKLLVSENKEMDVKMVNKILFDIKNGNFR-KRGRDTXXXXXXXXXXXXX-RQYRQ 913
            +P EIR++L +ENKEMD+KM+NKIL+DIKNG FR KR +++              +QYR 
Sbjct: 761  NPHEIREMLAAENKEMDIKMINKILYDIKNGGFRNKRAKNSLELELSDDDEDDVLQQYRL 820

Query: 914  KRNELMKQRXXXXXXXXXXXXXXXTKAFFDSLVEDIVEVKNPFGV-----MSDNXXXXXX 968
            KR ELM++R               + AFF+S+VEDI+E KNPFG      +         
Sbjct: 821  KRRELMRKRRLEIGDDAKLVKNPKSSAFFESMVEDIIEYKNPFGAEEEYNLDITSTATDL 880

Query: 969  XXXXXXXXXRESVSNKEEKPTQEKGKKTVLSEEFVQRSLSFLNSNRNLTEFEQNQDLARL 1028
                      ++  N E+KP  +K KK ++SE+FVQ+SLSFL SN N  +FE +++L+R+
Sbjct: 881  DTQDNSINVGDNTGNNEQKPVDQKNKKVIISEDFVQKSLSFLKSN-NYEDFETDKELSRI 939

Query: 1029 QHDDD--VSDLYTLXXXXXXXX-------XXXXXXXNEIINV-------DANDNSGTAVA 1072
            QH +D  + DLYTL                      N II++       D  +N  T++ 
Sbjct: 940  QHGNDEAIEDLYTLKQNSSIKSFTNSQTDSTTSKTVNTIIDLEKRPEDEDEVENGDTSLV 999

Query: 1073 TATFRPPSIIKSFNSKLNVDDKFRNGKKTVKTFKSYKAVGGSKTSVTYMNKVRKLTAPK 1131
               F+ PSIIKSF S+ +++DKF+ G KTVK  KSYK VG SK S+TYM K RKL APK
Sbjct: 1000 -GVFKHPSIIKSFASRTDINDKFKEGNKTVKILKSYKTVGSSKASITYMGKTRKLIAPK 1057

 Score = 61.6 bits (148), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 41/61 (67%), Gaps = 3/61 (4%)

Query: 38  PTSLAGNGFLFGNATVDKIKNRLNNEDHPNSSIDVTKSSSEDQIPVSQSQLLSTLYDGGE 97
           P  L GNGFLF NAT++++KNRL  +  P  + +  K  SE+ +P   +QL+S LYDGGE
Sbjct: 45  PPELTGNGFLFANATLNRVKNRLEGKKAPEQNHNNGKDRSENSLP---TQLISNLYDGGE 101

Query: 98  D 98
           +
Sbjct: 102 E 102

 Score = 58.5 bits (140), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 69/247 (27%), Positives = 105/247 (42%), Gaps = 31/247 (12%)

Query: 404 TVADDVKSGGNTLKIHEIQTQI-DEETRNMLNRGVEHRKSRGVPSRVEVRFTKESFXXXX 462
           T+ D+V    +TLKI EIQ+++  E+++    R VE++K +  P   +  F+KESF    
Sbjct: 280 TLQDEVP---HTLKIREIQSELASEDSKREKARNVEYKKPQK-PIPTKKFFSKESFLADF 335

Query: 463 XXXXXXXXXXXXXXQINDTTPETGSSQNSDSNKARKPTEAPKT-------KRVTGLSSYE 515
                         ++ +  P+    QN D     K  E   T       KRV  LSSY 
Sbjct: 336 DDSSSNEDDDI---KLENAHPK--PVQNDDELHENKSVELNLTDETRINEKRVPLLSSYA 390

Query: 516 TILRNKVNDDECLDLGXXXXXXXX----------XXXXXXXXVSQASXXXXXXXXXXXXX 565
             L+ +++  +C+ L                           +SQ S             
Sbjct: 391 NNLKREIDSSKCITLDLDSDSDEYGDDDMDSIKLSKDESVLPISQLSKATILNLKARLSK 450

Query: 566 XXXXXXXXXTN----KTTLDSLFSDLKKKNRQQILSHQAEIIGTKGINHKDLEREKEIVE 621
                          K   + L + L+K +R+QIL HQ E+I TKG+  +D+ +EKEIVE
Sbjct: 451 QNQKLSQRPNKSKDPKVDHNVLLNTLRKASRKQILDHQKEVIETKGLKLEDMAKEKEIVE 510

Query: 622 DLLEQEI 628
           +LLEQEI
Sbjct: 511 NLLEQEI 517

>Smik_3.14 Chr3 complement(20226..23567) [3342 bp, 1113 aa] {ON}
            YCL061C (REAL)
          Length = 1113

 Score =  285 bits (730), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 184/474 (38%), Positives = 250/474 (52%), Gaps = 71/474 (14%)

Query: 715  ESDSEEETVNSNDKRVNAPSESKPIHPVNNINAIDLGDYGNNLEIRAELN--------NT 766
            ESDSE E V       + P             AI+LG YG+N+E   E+N        NT
Sbjct: 622  ESDSENEAVPKEKVDASVPKRI----------AINLGHYGDNIE--EEVNKFQETNDMNT 669

Query: 767  EKLDTKCM-------------------------LDEKEHARAVDKERLKTIMKEKKLMLK 801
            ++ D   M                          DE      +DKE+L+   KE +  +K
Sbjct: 670  QQTDKITMERNIVENKAILEDTAVVDEDNINEEADEAIRRELIDKEKLQLRQKELEKAIK 729

Query: 802  RAELKEKGVSNFFXXXXXXXXXXWHGIGGIDGEVSDEYDSEVEKMIDDYSRADMDPEEIR 861
              ELK KGV+NFF          WHGIGG DGE SDEYDS+VEKMIDDYS+ + +  EIR
Sbjct: 730  LKELKHKGVTNFFEMEAEESDDEWHGIGGADGEGSDEYDSDVEKMIDDYSKNNFNSHEIR 789

Query: 862  KLLVSENKEMDVKMVNKILFDIKNGNFR-KRGRDTXXXXXXXXXXXXXRQYRQKRNELMK 920
            ++L +ENKEMDVKM+NKIL+DIKNG FR KR +++             +QYR KR ELM+
Sbjct: 790  EMLAAENKEMDVKMINKILYDIKNGGFRNKRAKNSLELELSDDEDDVLQQYRLKRRELMR 849

Query: 921  QRXXXXXXXXXXXXXXXTKAFFDSLVEDIVEVKNPFGVMSDNXXXXXXXXX------XXX 974
            +R               +KAFF+S+VEDI+E KNPF    ++                  
Sbjct: 850  KRRLEIGDGTKLVKNPKSKAFFESMVEDIMEYKNPFRAEEESNQDITSTATDLDTLDNNS 909

Query: 975  XXXRESVSNKEEKPTQEKGKKTVLSEEFVQRSLSFLNSNRNLTEFEQNQDLARLQH---D 1031
               R+S  N E+ P  +K KK ++SE+FVQ+SLSFL SN N  EFE +++LA++QH   D
Sbjct: 910  LNVRDSTRNNEKGPVDDKSKKIIISEDFVQKSLSFLKSN-NYNEFEMDKELAKMQHGNDD 968

Query: 1032 DDVSDLYTLXXXXXXXXXXXXXXXN-------EIINV-------DANDNSGTAVATATFR 1077
            + + DL+TL               +        +I++       D  +N  +++ +  F+
Sbjct: 969  EPIEDLFTLKQHSSIKSFTNSQTDSFTSRTVTTMIDLEKRTEDEDEMENGDSSLVSG-FK 1027

Query: 1078 PPSIIKSFNSKLNVDDKFRNGKKTVKTFKSYKAVGGSKTSVTYMNKVRKLTAPK 1131
             PSI+KSF S+ +++DKF+ G KTVK  KSYK VG SK S+TYM K RKL APK
Sbjct: 1028 HPSIVKSFASRTDINDKFKEGNKTVKISKSYKMVGSSKASITYMGKTRKLMAPK 1081

 Score = 61.6 bits (148), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 40/66 (60%), Gaps = 3/66 (4%)

Query: 33  DDDCVPTSLAGNGFLFGNATVDKIKNRLNNEDHPNSSIDVTKSSSEDQIPVSQSQLLSTL 92
           +D   P +L GNGFLF NAT++++KNRL     P    D      ED   VS SQL++ L
Sbjct: 41  NDIVAPPALTGNGFLFANATLNRVKNRLEGGKAPEQEHDNKDDEDED---VSSSQLIANL 97

Query: 93  YDGGED 98
           Y+GGED
Sbjct: 98  YEGGED 103

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/46 (58%), Positives = 37/46 (80%)

Query: 583 LFSDLKKKNRQQILSHQAEIIGTKGINHKDLEREKEIVEDLLEQEI 628
           LF+ L+K +R+QIL HQ E+I TKG   +D+ +EKE+VE+LLEQEI
Sbjct: 488 LFNTLRKASRKQILDHQREVIETKGFKLEDMVKEKELVENLLEQEI 533

>Suva_3.152 Chr3 complement(228665..232087) [3423 bp, 1140 aa] {ON}
            YCL061C (REAL)
          Length = 1140

 Score =  281 bits (719), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 162/372 (43%), Positives = 215/372 (57%), Gaps = 25/372 (6%)

Query: 784  VDKERLKTIMKEKKLMLKRAELKEKGVSNFFXXXXXXXXXXWHGIGGIDGEVSDEYDSEV 843
            +D+E+ +   KEK+   K  ELK KGV+NFF          WHG+GG DGE SDEYDSEV
Sbjct: 738  IDREKSERRQKEKEQATKLKELKSKGVTNFFEMEAEESEDEWHGVGGADGEGSDEYDSEV 797

Query: 844  EKMIDDYSRADMDPEEIRKLLVSENKEMDVKMVNKILFDIKNGNFR-KRGRDTXXXXXXX 902
            EKMIDDYS+   +  EIR++L +ENKEMDVKM+NKIL+DIKNG FR KR +++       
Sbjct: 798  EKMIDDYSKNKFNSHEIREMLAAENKEMDVKMINKILYDIKNGGFRNKRAKNSLELELSD 857

Query: 903  XXXXXXRQYRQKRNELMKQRXXXXXXXXXXXXXXXTKAFFDSLVEDIVEVKNPFGVMSDN 962
                  +QYR KR ELM++R               +KAFF+S+VEDI+E KNPFG   ++
Sbjct: 858  DEDDVLQQYRLKRRELMRKRRLEIGDDTKLVKNPKSKAFFESMVEDIMEFKNPFGAEKES 917

Query: 963  XXXXXXXXXXXXXXXRESV-------SNKEEKPTQEKGKKTVLSEEFVQRSLSFLNSNRN 1015
                            ++        +N+  K   +K KK ++SE+FVQ+SLSFL SN N
Sbjct: 918  DQDVTSTATDLDTQDNDNTKPGDNTSNNEHNKHVGDKSKKLIISEDFVQKSLSFLKSN-N 976

Query: 1016 LTEFEQNQDLARLQH---DDDVSDLYTLXX-------XXXXXXXXXXXXXNEIINV---- 1061
              EFE +++LAR+QH   + DV DL+TL                      N +IN+    
Sbjct: 977  YDEFEMDRELARIQHGNGEGDVVDLFTLKQHSSIKSFTNSQTNSLSSRTMNTVINLEEHT 1036

Query: 1062 DAND--NSGTAVATATFRPPSIIKSFNSKLNVDDKFRNGKKTVKTFKSYKAVGGSKTSVT 1119
            + ND   +G       F+ PS+IKSF S+ +++DKF+ G KTVK  KSYK VG SK S+T
Sbjct: 1037 EGNDEGENGDQSLIGGFKHPSVIKSFASRTDINDKFKEGNKTVKISKSYKTVGSSKASIT 1096

Query: 1120 YMNKVRKLTAPK 1131
            YM K RKL APK
Sbjct: 1097 YMGKTRKLMAPK 1108

 Score = 60.8 bits (146), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 72/253 (28%), Positives = 103/253 (40%), Gaps = 23/253 (9%)

Query: 394 DRLETQEFQPTVADDVKSGGNTLKIHEIQTQIDEETRNMLN-RGVEHRK-SRGVPSRVEV 451
           DR +      T+ D V     TLKIHE+Q+++  E  N    +  E+RK  + +P  +  
Sbjct: 299 DRTQMDTVAQTMQDKVPP---TLKIHELQSELALEDFNRKKAQNTEYRKLQKTIP--IVK 353

Query: 452 RFTKESFXXXXXXXXXXXXXXXXXXQINDTTPETGSSQN--SDSNKARKPTEAPKTKRVT 509
           RF+KESF                         + G      S SN      E  K K+V 
Sbjct: 354 RFSKESFLADFDNSSSDEDTNFKLESSQPKQQQNGYEMIDISQSNPQPAEKENKKDKKVP 413

Query: 510 GLSSYETILRNKVNDDEC----LDLGX------XXXXXXXXXXXXXXXVSQASXXXXXXX 559
            LS+Y   L+ +++  +C    LD G                      +SQ S       
Sbjct: 414 LLSTYANNLKREIDSSKCITLDLDSGSDKDNDNHMDTDKLNEDESALPISQLSKATIFNL 473

Query: 560 XXXXXXXXXXXXXXXTN----KTTLDSLFSDLKKKNRQQILSHQAEIIGTKGINHKDLER 615
                                K+  + L + L+K +R+QIL HQ EI+ TKG   +D+ +
Sbjct: 474 KARLSKQNQKLAQGSNKNKDFKSDHNKLINTLRKASRKQILDHQREIVETKGFKLEDMVK 533

Query: 616 EKEIVEDLLEQEI 628
           EKEIVEDLLEQEI
Sbjct: 534 EKEIVEDLLEQEI 546

 Score = 55.5 bits (132), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 39/62 (62%), Gaps = 3/62 (4%)

Query: 37  VPTSLAGNGFLFGNATVDKIKNRLNNEDHPNSSIDVTKSSSEDQIPVSQSQLLSTLYDGG 96
            P +L GNGFLFGNAT++++KNRL   +         ++  ED   V  +QL++ LYDGG
Sbjct: 88  APPALTGNGFLFGNATLNRVKNRLEGRNELGQDGQDKENEDED---VFSTQLIANLYDGG 144

Query: 97  ED 98
           E+
Sbjct: 145 EE 146

>TBLA0A07570 Chr1 (1874419..1878177) [3759 bp, 1252 aa] {ON} Anc_1.5
            YCL061C
          Length = 1252

 Score =  268 bits (684), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 209/613 (34%), Positives = 294/613 (47%), Gaps = 89/613 (14%)

Query: 575  TNKTTLDSLFSDLKKKNRQQILSHQAEIIGTKGINHKDLEREKEIVEDLLEQEIXXXXXX 634
            T +T LD LF+ LKK +++QI  HQ   I +KG+  +DL++EKEIVE+LLEQEI      
Sbjct: 639  TIQTNLDQLFNKLKKASKKQIFDHQKNAIESKGLKLEDLKKEKEIVENLLEQEIERNRKI 698

Query: 635  XXXXXXXXXXXXXXSDM---------DNNYSANELES--FDDSDHDSLXXXXXXXXXXXX 683
                           D          D ++SANELE   ++DSD +              
Sbjct: 699  RAKERKRENKKNKVDDKSVQSASDEDDFDHSANELEDSFYNDSDENKEIIEPEEEDSEDD 758

Query: 684  XXXXXXXXXXXXFAAFQVLKGKKRKNMQIQPESDSEEETVNSNDKRVNAPSESKPIHPVN 743
                           F+  KG K     +  ESDSE      ND  +   SE  PI+P  
Sbjct: 759  IN------------IFRHKKGLKL----VTEESDSE------NDNPLE--SEKIPINP-- 792

Query: 744  NINAIDLGDYGNNLEIRAEL--NNTEKL--------------DTKCMLDEKEHARAVDKE 787
              N I+LG YG+NL+ ++ +   N++K               ++   L+E E+ R + +E
Sbjct: 793  --NIINLGHYGDNLDSKSTIFNENSKKFIEDIEQFEADNSTENSNNELNELEYKRHIKQE 850

Query: 788  RLKTIMKEKKLMLKRAELKEKGVSNFFXXXXXXXXXXWHGIGGIDGEVSDEYDSEVEKMI 847
              K  +KE K   K  ELK+ G S  F          W GIGG DGEVSDEYDSEVEK+I
Sbjct: 851  LEKQKLKEAKKKAKLRELKKVGASKMFDMEAEESEDEWFGIGGADGEVSDEYDSEVEKLI 910

Query: 848  DDYSRADMDPEEIRKLLVSENKEMDVKMVNKILFDIKNGNFRKRGRDTXXXXXXXXXXXX 907
            DDYSR D +P+EIR  L++ENKEMD+KMVN+IL+DIKNG FRKR R+             
Sbjct: 911  DDYSRQDFNPDEIRNKLMNENKEMDIKMVNRILYDIKNGGFRKRNRNNIDLELSDDEDDE 970

Query: 908  XRQYRQKRNELMKQRXXXXXXXXXXXXXXXTKAFFDSLVEDIVEVKNPFGV--------- 958
             R+YR KR E+MK++               +KAFF S+V+DIVE  NPF +         
Sbjct: 971  LREYRIKRREIMKKKRLEVTNTDKILKTSKSKAFFMSMVDDIVETSNPFMITQPSDDDSD 1030

Query: 959  ------MSDNXXXXXXXXXXXXXXXRESVSNKEEKPTQEKGKKTVLSEEFVQRSLSFLNS 1012
                  +S+                R   ++   + +Q   KK V+SE+FV ++LSFL  
Sbjct: 1031 DNNMDSISNKNHKDANNAKKDKKDKR---TDDHARLSQSSRKKFVMSEDFVHKTLSFLTK 1087

Query: 1013 NRNLTEFEQN-----------QDLARLQHDDDVSDLYTLXXXXXXXXXXXXXXXNE---- 1057
            ++ + EF+              D+  L+    +  ++ L                +    
Sbjct: 1088 SKEVNEFQHVNEHYKSQIGTINDIQSLKQKSSIKTMHVLSMMSQDTNVDLDASDKDDDDM 1147

Query: 1058 IINVDANDNSGTAVATATFRPPSIIKSFNSKLNVDDKFRNGKKTVKTFKSYKAVGGSKTS 1117
            I +  + DNS     ++  + PSIIK F S  +++DKF++G KTV    SYK VGG KTS
Sbjct: 1148 IHHAGSFDNSFDDPLSSVSKAPSIIKIFGSTHDINDKFKDGNKTVTISNSYKTVGGMKTS 1207

Query: 1118 VTYMNKVRKLTAP 1130
            +T   + RKL AP
Sbjct: 1208 ITSFGR-RKLVAP 1219

 Score = 33.1 bits (74), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%)

Query: 37 VPTSLAGNGFLFGNATVDKIKNRLN 61
          VP+     GFLF N  ++KIKNRLN
Sbjct: 43 VPSFNLSEGFLFANDKLEKIKNRLN 67

>NDAI0A00140 Chr1 complement(8373..11648) [3276 bp, 1091 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1091

 Score =  262 bits (670), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 174/437 (39%), Positives = 243/437 (55%), Gaps = 40/437 (9%)

Query: 746  NAIDLGDYGNNL---EIRAELNNT--------EKLDTKCM-LDEKEHARAVDKERLKTIM 793
            NAIDLG YG+NL    ++++ ++         E LDT+ + L E+E    ++ E+ K  M
Sbjct: 649  NAIDLGAYGDNLTTANVKSQDDDDLEVDDDKNENLDTQPLELTEQERIDIIEAEKTKIKM 708

Query: 794  KEKKLMLKRAELKEKGVSNFFXXXXXXXXXXWHGIGGIDGEVSDEYDSEVEKMIDDYSRA 853
            +++K+  K  E+ +KGV+ FF          WHGIGGIDGE+SDEYDS+VEKMIDDYS+A
Sbjct: 709  QQEKMRHKEKEMMKKGVTKFFEMEAEESEDEWHGIGGIDGEMSDEYDSDVEKMIDDYSKA 768

Query: 854  DMDPEEIRKLLVSENKEMDVKMVNKILFDIKNGNFRKRGR-DTXXXXXXXXXXXXXRQYR 912
            + DP EIR++L +ENKEMD+ M+NKIL+DIKNG FRKR R                R+Y 
Sbjct: 769  NFDPNEIREMLAAENKEMDLNMINKILYDIKNGGFRKRKRGGLELELSEDEDDDALREYH 828

Query: 913  QKRNELM-KQRXXXXXXXXXXXXXXXTKAFFDSLVEDIVEVKNPFGVMSDNXXXXXXXXX 971
             KR ELM K+R               +KAFF+S+VEDI + KN F     N         
Sbjct: 829  LKRKELMRKRRLELGDDEKKLVKNPKSKAFFESMVEDITDDKNAF-----NDEPLGETST 883

Query: 972  XXXXXXRESVSNKEEKPTQEKG-------KKTVLSEEFVQRSLSFLNSNRNLTEFEQNQD 1024
                  ++ +  ++    +E G       KKT++SEEFVQR+LSFL S+R   EF  N++
Sbjct: 884  QEINNTQDDMKEEDAAVVKENGDSKRIKKKKTIISEEFVQRTLSFLKSSREDEEFAMNEN 943

Query: 1025 LARLQHDDDVSDLYTLXXXXXXXXXXX-XXXXNEIINVDANDNSGTAVAT---ATFRPPS 1080
            LA+ QH   V +L +L                +++I +D  +N          A F+ PS
Sbjct: 944  LAKEQHGTKVENLLSLKQQSSIKVFQSPSNNSSKVIKLDDINNDDDDDEDSPIALFKVPS 1003

Query: 1081 IIKSFNSKLNVDDKFRNGKKTVKTFKSYKAVGGSKTSVTYMNKVRKLTAP--KSLKKLHS 1138
            I+KSF SK ++++KF++G KTV   KSY+ VG SK S+TY+ K RKL AP    +K L S
Sbjct: 1004 ILKSFGSKTDINEKFQDGNKTVTISKSYRTVGSSKASITYLGKSRKLMAPTHSKMKPLRS 1063

Query: 1139 --------TGGERKISA 1147
                    T GER I +
Sbjct: 1064 RVTDNNKITKGERNIGS 1080

 Score = 65.9 bits (159), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 66/242 (27%), Positives = 106/242 (43%), Gaps = 19/242 (7%)

Query: 404 TVADDVKSGGNTLKIHEIQTQIDEETRNMLNRGVEHRKSRGVPSRVE---VRFTKESF-- 458
           TVADD  S G+ L IH+ Q +++EE +  L    ++++ +G+   +    V+FTK+SF  
Sbjct: 289 TVADDKLSSGSNLAIHKFQKELEEEEQ--LANNSKYKEYKGISKPILTNIVKFTKDSFLQ 346

Query: 459 -----XXXXXXXXXXXXXXXXXXQINDTTPETGSSQNSDSNKARKPTEAPKTK------- 506
                                     +T+  + S++N++S  +   T             
Sbjct: 347 GFDNSSSSSSEEEGDKVKETKRNGKENTSSNSYSTKNNNSTASSDGTTIKPKIKSPKKFS 406

Query: 507 RVTGLSSYETILRNKVNDDECLDLGXXXXXXXXXXXXXXXXVSQASXXXXXXXXXXXXXX 566
           ++  LS YE  L+  +N    L LG                 +  +              
Sbjct: 407 KLNTLSRYENKLKTVLNSKNQLQLGSDDESSDDTENSLPVSRTSKATILTIKARLSKQKS 466

Query: 567 XXXXXXXXTNKTTLDSLFSDLKKKNRQQILSHQAEIIGTKGINHKDLEREKEIVEDLLEQ 626
                   T  T L+ LF +LKK +R+QIL +Q E+I  KG+N +D+E EKE+VE+LLEQ
Sbjct: 467 KKNVQKDGTVNTNLNKLFENLKKSSRKQILENQRELIENKGLNFEDIEMEKELVENLLEQ 526

Query: 627 EI 628
           EI
Sbjct: 527 EI 528

 Score = 40.8 bits (94), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 44/72 (61%), Gaps = 8/72 (11%)

Query: 27  TDEAAGDDDCVPTSLAGNGFLFGNATVDKIKNRLNNEDHPNSSIDVTKSSSEDQIPVSQS 86
           TD  +G +   PT L G GFLF N+T+DK++ RL+ +++     + T  +S +Q    ++
Sbjct: 38  TDVTSGGN-VTPTIL-GTGFLFKNSTIDKVRARLSGKNYIEQ--EKTPLASSEQ----ET 89

Query: 87  QLLSTLYDGGED 98
           Q+++ LY  GED
Sbjct: 90  QIITNLYTNGED 101

>TPHA0E04010 Chr5 (839903..842800) [2898 bp, 965 aa] {ON} Anc_1.5
            YCL061C
          Length = 965

 Score =  257 bits (656), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 244/767 (31%), Positives = 347/767 (45%), Gaps = 76/767 (9%)

Query: 397  ETQEFQPTVADDVKSGGNTLKIHEIQTQIDEETR--NMLNRGVEHRKSRGVPSRVEVRFT 454
            +TQE  PTV DDV      LKI +I+ +++EE R       G E  K +   S++  +F+
Sbjct: 215  DTQELMPTV-DDVAMRSTGLKITDIEKELEEEQRLAKETEFGTEF-KFKESESKISKKFS 272

Query: 455  KESFXXXXXXXXXXXXXXXXXXQINDTTPETGSSQNSDSNKARKPTEAPKT----KRVTG 510
            KE F                    N+  P      N D ++   P    KT    K + G
Sbjct: 273  KEDFLNHFDDSSSSEDETSK----NEKGP------NVDKSEVLHPDNKSKTLLKVKSING 322

Query: 511  LSSYETILRNKVNDDECLDLGXXXXXXXXXXXXXXXXVSQASXXXXXXXXXXXXXXXXXX 570
            L +YE  LR K N+++ ++                   S AS                  
Sbjct: 323  LGNYEHNLRRKANNEQIIEFSESDEDSDTNISP-----SYASKAVILNIRANKSKQQPKV 377

Query: 571  XXXXTNKTTLDSLFSDLKKKNRQQILSHQAEIIGTKGINHKDLEREKEIVEDLLEQEIXX 630
                +++TTL  L+++LK+ +++QI+S+Q E++  KGIN ++LE+E EIVE+LLEQEI  
Sbjct: 378  SQK-SDQTTLLMLYNNLKRASKEQIVSYQKELMEKKGINLEELEKENEIVENLLEQEIAR 436

Query: 631  XXXXXXXXXXXXXXXXXXSDMDNN-----YSANELESFDDSDHDSLXXXXXXXXXXXXXX 685
                               D+++N      SANELE  D    D                
Sbjct: 437  NQKIRQREKQKQKKENQ-DDLNSNPEEFDLSANELEDSDIPGSDFAESNNNSEKDDEEEE 495

Query: 686  XXXXXXXXXXFA----------AFQVLKGKKRKNMQIQPESDSEEETVNSNDKRVNAPSE 735
                       A           F + K +K K  +I  +SDSE E    + K +     
Sbjct: 496  NDEEEEDEQEDAPKSTVDEEDEGFAIGK-RKHKKTEIVDDSDSEIEAQIVDSKEIITA-- 552

Query: 736  SKPIHPVNNINAIDLGDYGNNL--EIRAELNNTEKLDTKCMLDEKEHARAVDKERLKTIM 793
                      N IDLG YG+N+  + R  LN TE+ D +      E   A+  E    I 
Sbjct: 553  ----------NTIDLGHYGDNIIQQSRETLNETEESDEEDE----ERYNAIISE---GIR 595

Query: 794  KEKKLMLKRA----ELKEKGVSNFFXXXXXXXXXXWHGIGGIDGEVSDEYDSEVEKMIDD 849
            K+K+L  + A    E+K  GVS  F          WHGIGG+D + SD YDSEVEKMIDD
Sbjct: 596  KQKELEKREAKRLKEMKTSGVSKMFEVEAEESEDEWHGIGGVDSDFSDAYDSEVEKMIDD 655

Query: 850  YSRADMDPEEIRKLLVSENKEMDVKMVNKILFDIKNGNFRKRGRDTXXXXXXXXXXXXXR 909
            YSR + +P EIR++L  ENKE D+ +VNKIL+DIKNG FR R R               +
Sbjct: 656  YSRQNFNPSEIREMLAKENKETDLALVNKILYDIKNGGFRTRKRRDRDLEFSDDDDDDLK 715

Query: 910  QYRQKRNELMKQRXXXXXXXXXXXXXXXTKAFFDSLVEDIVEVKNPFGVMSDNXXXXXXX 969
             YR KR  LM+++               +KAFF+S+V+DI+E KNPF  M+ +       
Sbjct: 716  AYRAKRRALMREKRLDIEGDKKIVKNPKSKAFFESIVDDIIETKNPFDDMNTSIEQIVEK 775

Query: 970  XXXXXXXXRESVSNKEEKPTQ--EKGKKTVLSEEFVQRSLSFLNSNRNLTEFEQNQDLAR 1027
                       + N E+  T   +K KK V+SEEFVQRSLSFLNS R   EFE N     
Sbjct: 776  ETPTV-----DIDNDEKLATNVTKKKKKIVISEEFVQRSLSFLNSCREQDEFEINNQHNG 830

Query: 1028 LQHDDDVSDLYTLXXXXXXXX---XXXXXXXNEIINVDANDNSGTAVATATFRPPSIIKS 1084
             +     +DLYTL                  +   N++   +  +       R  S++ S
Sbjct: 831  GEKATSTADLYTLKRYSSIKTLQSVTSSRSSSIASNLNEQPSQSSGSLFNDLRKTSVLNS 890

Query: 1085 FNSKLNVDDKFRNGKKTVKTFKSYKAVGGSKTSVTYMNKVRKLTAPK 1131
            F+S ++++ KF+ G K+VK   +YK VG ++ S+TYM   R+L APK
Sbjct: 891  FSSDVDINSKFKEGTKSVKVSNAYKTVGSARASITYMGTSRRLVAPK 937

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 37/65 (56%), Gaps = 14/65 (21%)

Query: 45  GFLFGNATVDKIKNRLNNEDHPNSSIDVTKSSSED-----------QIPVSQSQLLSTLY 93
           G LFGN+ + +I+NRLNN D  N   D  K +SE            QI   Q+Q+++ LY
Sbjct: 50  GILFGNSILGQIRNRLNNID--NEDKDKGKEASESITSKDNEQDSTQI-FPQTQIINNLY 106

Query: 94  DGGED 98
           DGGED
Sbjct: 107 DGGED 111

>SAKL0C00462g Chr3 complement(41257..44790) [3534 bp, 1177 aa] {ON}
            some similarities with uniprot|P25588 Saccharomyces
            cerevisiae YCL061C MRC1 S-phase checkpoint protein found
            at replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 1177

 Score =  257 bits (657), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 145/373 (38%), Positives = 211/373 (56%), Gaps = 27/373 (7%)

Query: 776  DEKEHARAVDKERLKTIMKEKKLMLKRAELKEKGVSNFFXXXXXXXXXXWHGIGGIDGEV 835
            D++E+ +A+ +   +   +E K+  KR E+K KGVS  F          WHG+GG DGE+
Sbjct: 781  DKEEYEKAMRQVLARKREQEHKIRQKRKEMKRKGVSKMFEMEAEESEDEWHGVGGADGEL 840

Query: 836  SDEYDSEVEKMIDDYSRADMDPEEIRKLLVSENKEMDVKMVNKILFDIKNGNFRKRGRDT 895
            SDEYDSE+EKM+DDY++   DP EIR++L +E+KE D K+VNKIL DIKNG FR+RG+  
Sbjct: 841  SDEYDSELEKMVDDYTKTTFDPAEIRQMLAAEDKEYDEKIVNKILHDIKNGGFRRRGKGA 900

Query: 896  XXXXXXXXXXXXXRQYRQKRNELMKQRXXXXXXXXXXXXXXXTKAFFDSLVEDIVEVKNP 955
                         ++Y  KR EL++Q+               + AFF+S+VED+VE KNP
Sbjct: 901  LDIELSDDEDDELQRYHAKRRELLRQKVLENGEASKLVSNPKSHAFFESMVEDLVESKNP 960

Query: 956  FGVMSDNXXXXXXXXXXXXXXXRESVSNKEE---------KPTQEKGKKTVLSEEFVQRS 1006
            F +                    + V N  E         +P + + K+  +S+EFVQRS
Sbjct: 961  FSI------GETADPDSGAISENDKVDNASEHGTQPDAGGQPVRTERKRIKISQEFVQRS 1014

Query: 1007 LSFLNSNRNL-TEFEQNQDLARLQH------DDDVSDLYTLXXXXX-XXXXXXXXXXNEI 1058
            LSFLNS   L  EFE ++ LA+ QH      +DD+ DL+TL                +  
Sbjct: 1015 LSFLNSKDELDNEFELDRRLAKHQHSTLGDDNDDLEDLFTLKQNSCIKTLHTPARTSSRT 1074

Query: 1059 INVDANDNSGTAVATATFRPPSIIKSFNSKLNVDDKFRNGKKTVKTFKSYKAVGGSKTSV 1118
            ++++ + NS        F+ PS+I SF+S++++++KF+ G KTVK  KSYK +GGS+ S+
Sbjct: 1075 VDLEVDGNS----PANGFKLPSVISSFSSRIDINEKFKEGTKTVKVSKSYKTIGGSRASI 1130

Query: 1119 TYMNKVRKLTAPK 1131
            TY+ KVRKL APK
Sbjct: 1131 TYLGKVRKLNAPK 1143

 Score = 59.3 bits (142), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 39/50 (78%)

Query: 579 TLDSLFSDLKKKNRQQILSHQAEIIGTKGINHKDLEREKEIVEDLLEQEI 628
           +L  LFS LKK N++QIL H+ EI   +G+N +D+EREK+ VE+LLEQEI
Sbjct: 479 SLKELFSSLKKANKKQILDHRREITEKRGLNLEDIEREKKEVENLLEQEI 528

 Score = 36.2 bits (82), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 8/56 (14%)

Query: 41 LAGNGFLFGNAT-VDKIKNRLNNEDHPNSSIDVTKSSSEDQIPVSQSQLLSTLYDG 95
          L+   FLFGN+T VDK+K+RLN       S + T     D +P  Q+Q++   YDG
Sbjct: 42 LSSASFLFGNSTIVDKVKSRLN-----GVSNEETDGERGDALP--QTQVIPNYYDG 90

>Kpol_2002.8 s2002 complement(11914..14871) [2958 bp, 985 aa] {ON}
            complement(11914..14871) [2958 nt, 986 aa]
          Length = 985

 Score =  254 bits (649), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 166/419 (39%), Positives = 231/419 (55%), Gaps = 19/419 (4%)

Query: 745  INAIDLGDYGNNLEIRAELNNTEK--LDTKCMLDEKEHARAVDKERLKTIMKEKKLMLKR 802
            +N I+LG YG+NL   ++ NN E+  +D+    DE+ +   V KE  +   +E+K   K 
Sbjct: 577  LNTINLGHYGDNL---SQENNNERNNIDSDESEDEELYKEMVKKEIDRRRDQERKQRQKL 633

Query: 803  AELKEKGVSNFFXXXXXXXXXXWHGIGGIDGEVSDEYDSEVEKMIDDYSRADMDPEEIRK 862
             ELK+KG+++ F          WHGIGG+DGE+SDEYDSEVEKMIDDYS+ + +  EIR+
Sbjct: 634  RELKDKGITDMFEVEAEESEDEWHGIGGVDGELSDEYDSEVEKMIDDYSKENFNAGEIRE 693

Query: 863  LLVSENKEMDVKMVNKILFDIKNGNFRKRGRDTXXXXXXXXXXXXXRQYRQKRNELMKQR 922
             L +ENK+MD+KMVN+IL DIKNG FRKR R+              + YR KR +LMK++
Sbjct: 694  KLAAENKDMDLKMVNRILNDIKNGGFRKR-RNALEIELSDDEDDDLKAYRAKRRQLMKEK 752

Query: 923  XXXXXXXXXXXXXXXTKAFFDSLVEDIVEVKNPFGVMSDNXXXXXXXXXXXXXXXRESVS 982
                           + AF +S+V+DIVEVKNPF    DN                  + 
Sbjct: 753  RLETDHNKKLMTNKKSHAFLESMVDDIVEVKNPFDERDDNIMDDTPETDAEGDVNSNELL 812

Query: 983  NKEEKPTQEKGKKTVLSEEFVQRSLSFLNSNRNLTEFEQNQDLARLQHDDDVSDLYTLXX 1042
            NK+        KK +LSE FVQ+SLSFL+S+RNL EFE N +LA+ QH    +D++ L  
Sbjct: 813  NKK--------KKFILSEAFVQKSLSFLSSSRNLEEFEMNNNLAKEQHSHAATDMFALKS 864

Query: 1043 XXXXXXXXXX--XXXNEIIN-VDANDNSGTAVATATFRPPSIIKSFNSKLNVDDKFRNGK 1099
                           N I + +D       +   +  +  S+IKSF+S +++D KF++G 
Sbjct: 865  HCSIKSLESLPGSHNNSISSKLDLLHEEIVSTPFSGLKQTSVIKSFSSSIDIDSKFKDGN 924

Query: 1100 KTVKTFKSYKAVGGSKTSVTYMNKVRKLTAPKSLKKLHSTGGERKISAQTSHSFKSNSN 1158
            KTVK  KSY+ VG +K S+TY+ K RKL  PK  KK H     +  +A  S  F    N
Sbjct: 925  KTVKVSKSYRTVGSAKASITYLGKARKLVPPK--KKEHKPHSHKSKTASASRLFDEQDN 981

 Score = 62.4 bits (150), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 68/225 (30%), Positives = 103/225 (45%), Gaps = 15/225 (6%)

Query: 406 ADDVKSGGNTLKIHEIQTQIDEETRNMLNR--GVEHRKSRGVPSRVEVRFTKESFXXXXX 463
            DD     + LKI+EI+ Q+DEE + +  +  G E++++   P   +V+F+K  F     
Sbjct: 226 VDDNTHSNSELKINEIERQLDEEDQILKEKSMGTEYKRNIA-PVMSKVKFSKNDFLEHFD 284

Query: 464 XXXXXXXXXXXXXQINDTTPETGSSQNSDSNKARKPTEAPKTKRVTGLSSYETILRNKVN 523
                        +++ T PET +      N      +  K  +  GLS+YE IL+  +N
Sbjct: 285 SSSSEEDEEGVV-KLSSTEPETAAM-----NLENSLPQFSKESKFIGLSNYENILKKDIN 338

Query: 524 DDECLDLGXXXXXXXXXXXXXXXXVSQASXXXXXXXXXXXXXXXXXXXXXXTNKTTLDSL 583
              C++                  VS+AS                       NK  L +L
Sbjct: 339 KQNCIEFSDSEDETEVTSK-----VSRASKATILSIKANLSRHKPAQSSI-NNKNALGNL 392

Query: 584 FSDLKKKNRQQILSHQAEIIGTKGINHKDLEREKEIVEDLLEQEI 628
           FSDLKK  + QIL H+ EI+  KG   +++E+EKEIVE+LLEQEI
Sbjct: 393 FSDLKKATKAQILDHKKEIMEQKGYKMEEIEKEKEIVENLLEQEI 437

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 8/58 (13%)

Query: 43 GNGFLFGNATVDKIKNRL--NNEDHPNSSIDVTKSSSEDQIPVSQSQLLSTLYDGGED 98
          G   LF N+ + +I+NRL  NN D  N S     S +E Q+ ++ +Q++S LY+GGED
Sbjct: 44 GQSILFNNSKLKQIRNRLEGNNNDSENDS-----SQAETQV-IADTQIISNLYEGGED 95

>ZYRO0F18480g Chr6 (1524051..1526933) [2883 bp, 960 aa] {ON} weakly
            similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061C MRC1 S-phase checkpoint protein found at
            replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 960

 Score =  233 bits (595), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 144/403 (35%), Positives = 216/403 (53%), Gaps = 29/403 (7%)

Query: 746  NAIDLGDYGNNLEIRAE-------LNNTEKLDTKCMLDEKEHARAVDKERLKTI-MKEKK 797
            N IDLG YGNNL++  E       L+++ ++D      E+E    +  E+++ I M++KK
Sbjct: 557  NIIDLGPYGNNLQVNHEEDMENLPLSDSAEIDAA----EEEKTNELIMEKIRKIEMRKKK 612

Query: 798  LMLKRAELKEKGVSNFFXXXXXXXXXXWHGIGGIDGEVSDEYDSEVEKMIDDYSRADMDP 857
               +  ++K KG++             W G+GG+DG++SDE+DS++E+MIDD+++++ + 
Sbjct: 613  KEQRLKDMKAKGLNKMLEMEAEESEDEWKGVGGVDGDLSDEHDSDLEEMIDDFTKSNENF 672

Query: 858  EEIRKLLVSENKEMDVKMVNKILFDIKNGNFRKRGRDTXXXXXXXXXXXXXRQYRQKRNE 917
            +++R+LL  ENKE+D KMVNKIL+DIKNG FRKRGR+              R YR KR E
Sbjct: 673  DDVRQLLAKENKELDEKMVNKILYDIKNGGFRKRGRNALDLELSDDEDEDLRNYRLKRRE 732

Query: 918  LMKQRXXXXXXXXXXXXXXXTKAFFDSLVEDIVEVKNPFGVMSDNXXXXXXXXXXXXXXX 977
            LMK+                +KAF +S+V+DI E KNPFG    +               
Sbjct: 733  LMKKSRIEGKDKEKAFRNAKSKAFLESMVDDIDESKNPFG----DPEMDVEDNTDVDTQE 788

Query: 978  RESVSNKEEKPTQEKGKKTVLSEEFVQRSLSFLNSNRNLTEFEQNQDLARLQHDDDVSDL 1037
             +   NKE         K  LS+EFVQRSLSFL++N +  EFE  + +     + DVS L
Sbjct: 789  NDYPKNKE---------KNTLSQEFVQRSLSFLSNNNSSREFELGEQITLGDEEQDVSSL 839

Query: 1038 YTLXXXXXXXXXXXXXXXNEIINVDANDNSGTAVATATFRPPSIIKSFNSKLNVDDKFRN 1097
                                  +++  +     +    F+PPS+IKS     + ++KF++
Sbjct: 840  KRNSSIHALHNSSSPIKE----DLEKENQDEDFITLPNFKPPSLIKSLAGGFDPNNKFQS 895

Query: 1098 GKKTVKTFKSYKAVGGSKTSVTYMNKVRKLTAPKSLKKLHSTG 1140
            GKKTV   KSY+AVGGS++S+TY  K+RKL  PK+     S G
Sbjct: 896  GKKTVTVSKSYRAVGGSRSSITYFGKMRKLVGPKNRNSTLSKG 938

 Score = 64.7 bits (156), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 67/254 (26%), Positives = 111/254 (43%), Gaps = 26/254 (10%)

Query: 390 ATMRDRLETQE--------------FQPTVADDVKSGGNTLKIHEIQTQIDEETRNM-LN 434
           AT  D+L+TQE              FQ T +D  KS    LK+H+I+ +++E+ +     
Sbjct: 198 ATSEDQLDTQEQNPITQLDISNSLLFQATDSDIPKSPPQRLKMHDIEKELEEKRQERDHR 257

Query: 435 RGVEHRKSRGVPSRVEVRFTKESFXXXXXXXXXXXXXXXXXXQINDTTPETGSSQNSDSN 494
           R +E+R     P  V+  F+KE+F                    +     T   +++  N
Sbjct: 258 RNIEYRAPEK-PVNVKRVFSKEAFLKNFDEESSSEDELIELRSRDIEKKHTEKDKSTLEN 316

Query: 495 KARKPTEAPKTKRVTGLSSYETILRNKVNDDECLDLGXXXXXXXXXXXXXXXXVSQASXX 554
                TE+ + +RV   S YE  L+ +++   C+ L                 VS+A+  
Sbjct: 317 T----TESSQRQRV--FSVYEYKLKGELDSKRCIQLDDDEDESDEDVEVPLSRVSKATVL 370

Query: 555 XXXXXXXXXXXXXXXXXXXXTNKTTLDSLFSDLKKKNRQQILSHQAEIIGTKGINHKDLE 614
                                 KTTL+ L   LKK +++QI  HQ E++ ++G   +D+E
Sbjct: 371 DIKARRSKQEPLSKIKQK----KTTLNDLICTLKKASKKQITDHQNELMKSRGYKLEDIE 426

Query: 615 REKEIVEDLLEQEI 628
           ++KE +E+LLEQEI
Sbjct: 427 KQKEEIENLLEQEI 440

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 40/63 (63%), Gaps = 2/63 (3%)

Query: 38  PTSLAGNGFLFGNATVDKIKNRLNN-EDHPNS-SIDVTKSSSEDQIPVSQSQLLSTLYDG 95
           P  + GNGFLF N+T+DK++NRL N ED  N       +   E +  ++Q+Q+++ LY+G
Sbjct: 39  PPPILGNGFLFQNSTIDKVRNRLRNAEDGANKVQQKEQEQEQEQETQLNQTQVIADLYEG 98

Query: 96  GED 98
            E+
Sbjct: 99  AEE 101

>TDEL0C06970 Chr3 (1264155..1266980) [2826 bp, 941 aa] {ON} Anc_1.5
            YCL061C
          Length = 941

 Score =  229 bits (584), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 189/580 (32%), Positives = 284/580 (48%), Gaps = 73/580 (12%)

Query: 577  KTTLDSLFSDLKKKNRQQILSHQAEIIGTKGINHKDLEREKEIVEDLLEQEIXXXXXXXX 636
            K +L +L  +L+   ++QIL  Q E I  +G+  +D+E+EKEIVE+LLEQEI        
Sbjct: 380  KASLSALMKNLRNSTKRQILDRQKEGIERQGLKFEDVEKEKEIVENLLEQEIARNKRIRM 439

Query: 637  XXXXXXXXXXXXS---------DMDNNYSANELESF--DDSDHDSLXXXXXXXXXXXXXX 685
                        S         D D+NYS ++ +S   +D D+  L              
Sbjct: 440  KEKEKAQMNDVPSLALPNRVEEDNDSNYSVSDEDSVIKEDLDYSDLESDDSGSNEPKIAS 499

Query: 686  XXXXXXXXXXFAAFQVLKGKKRKNMQIQPESDSEEETVNSNDKRVNAPSESKPIHPVNNI 745
                          + +KGK  K   +  +   EEE +  N                   
Sbjct: 500  DSAGVEIDSDEDDIRFMKGKAHKISLLNDDESEEEEDLTVN------------------- 540

Query: 746  NAIDLGDYGNNL--EIRAELNNTEKLDTKCMLDE--KEHARAVDKERLKTIMKEKKLMLK 801
            +AI+LG YG+NL    + E + + +  T  +++E  +   R ++KE+ K   +E+K  LK
Sbjct: 541  SAINLGAYGDNLITTTKDEAHTSAEEHTTQLVNEISESQYRTMEKEKSKIRAQEEKQRLK 600

Query: 802  RAELKEKGVSNFFXXXXXXXXXXWHGIGGIDGEVSDEYDSEVEKMIDDYSRADMDPEEIR 861
              ++KE GV+N F          W G+GG+DGE  D+YDS++EKMIDD+S    + ++IR
Sbjct: 601  --QMKESGVTNMFDMEAEESDDEWRGVGGVDGETIDDYDSDLEKMIDDFSNTTSNADQIR 658

Query: 862  KLLVSENKEMDVKMVNKILFDIKNGNFRKRGRDTXXXXXXXXXXXXXRQYRQKRNELM-K 920
            +LL++ENKE D+K VNKIL DIKNG FRKR ++                Y++++ ELM K
Sbjct: 659  QLLMAENKETDLKTVNKILHDIKNGGFRKRRQNNLQLELSDDEDDELLNYKKRKLELMRK 718

Query: 921  QRXXXXXXXXXXXXXXXTKAFFDSLVEDIVEVKNPFGVMSDNXXXXXXXXXXXXXXXRES 980
            +R               +KAFF+S+VEDI+++K+PF   ++                   
Sbjct: 719  RRLQFGADDKKLLKNSRSKAFFESMVEDIIDLKDPFSNQAETSEKDKKSEGLV------D 772

Query: 981  VSNKEEKPTQEKGKKTVLSEEFVQRSLSFLNSNRNLTEF---------EQNQDLARLQHD 1031
             SNK+         K  +S EFVQ+SLSFL+S+R+ +EF         E+N DL  L+ D
Sbjct: 773  ASNKQ---------KDTISHEFVQQSLSFLSSSRDFSEFEVARVSQEGERNTDLNSLKQD 823

Query: 1032 DDVSDLYTLXXXXXXXXXXXXXXXNEIINVDANDNSGTAVATATFRPPSIIKSFNSKLNV 1091
              V  LY                 +E  + +  DNS   V ++     S++KSF   LN 
Sbjct: 824  STVKTLYA---------PSNIISESERADHEEFDNSVLPVESSY---SSVVKSFGFDLNA 871

Query: 1092 DDKFRNGKKTVKTFKSYKAVGGSKTSVTYMNKVRKLTAPK 1131
            +DK + G+KTV   KSY+ VGG+K S+TY+ K+RKL APK
Sbjct: 872  NDKLKEGRKTVTVSKSYRTVGGNKASITYLGKMRKLVAPK 911

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 52/99 (52%), Gaps = 15/99 (15%)

Query: 1  MDDLLERFNSXXXXXXXXXXXXQQNSTDEAAGDDDCVPTSLAGNGFLFGNATVDKIKNRL 60
          MD L E F++             QN  DE   +D  VP ++ GNGFLF ++T+DK+KNRL
Sbjct: 1  MDKLFESFDNAIKKRRATYQKAVQNEDDEYT-EDPLVPPAVLGNGFLFNSSTLDKVKNRL 59

Query: 61 N-NEDHPNSSIDVTKSSSEDQIPVSQSQLLSTLYDGGED 98
          N +++    +ID T             Q+LS LY+ GED
Sbjct: 60 NKDQEQGTQAIDTT-------------QVLSNLYEDGED 85

>CAGL0B00330g Chr2 complement(18031..21441) [3411 bp, 1136 aa] {ON}
            similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061c
          Length = 1136

 Score =  230 bits (587), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 146/400 (36%), Positives = 214/400 (53%), Gaps = 45/400 (11%)

Query: 764  NNTEKLDTKCMLDEKEHARAVDKERLKTIMKEKKLMLKRAELKEKGVSNFFXXXXXXXXX 823
            +++E +DT     E+E   A+ ++  +   +E K   K  EL  KGV+ +F         
Sbjct: 762  DSSEDIDT-----EQERIAAIKQQVKRQQEREVKERKKLQELANKGVNQYFEEEAEESDD 816

Query: 824  XWHGIGGIDGEVSDEYDSEVEKMIDDYSRADMDPEEIRKLLVSENKEMDVKMVNKILFDI 883
             W GIGG+DG+   EYDSEVEKMIDDYS+ ++D   +R+ ++ ENKEMD+K+VNKIL+DI
Sbjct: 817  EWRGIGGVDGDDFGEYDSEVEKMIDDYSKTEVDLTSLRQKIMDENKEMDLKLVNKILYDI 876

Query: 884  KNGNFRKRGRDTXXXXXXXXXXXXXRQYRQKRNELMKQRXXXXXXXXXXXXXXXTKAFFD 943
            KNG FRKRGR+              +++R+KR ELMKQR               +KAFF+
Sbjct: 877  KNGGFRKRGRNDMELEFSDDEDAELQEFRRKRRELMKQRMLENEDTDKLTKNPKSKAFFE 936

Query: 944  SLVEDIVEVKNPFGVMSDNXXXXXXXXXXXXXXXRESVSNKEEKPTQE------------ 991
            S++ D+VE KN F  +SD                   +  KEE  TQE            
Sbjct: 937  SMIVDLVEDKNNFDDLSD------------------QIELKEENITQEDNEKEYNEAKSN 978

Query: 992  KGKKTVLSEEFVQRSLSFLNSNRNLTEFEQNQDLARLQHDDDVSDLYTLXXXXXXXXXXX 1051
            K  K  +SE+FVQ++LSFL+++ +  EF+ +  +++   +  + D+  L           
Sbjct: 979  KRGKIRISEDFVQKTLSFLHNDESTQEFQPSFIMSK---EKGIGDMNALKSNSSLSFCSK 1035

Query: 1052 XXXXNEIINVDANDNSGTAVATATFRPPSIIKSFNSKLNVDDKFRNGKKTVKTFKSYKAV 1111
                 +II    ND         +F+ PSII+SF+SK  +DDKF++G K+VK   SYK V
Sbjct: 1036 LSTSRKII----NDEEDVIEEFESFKRPSIIQSFSSKFTIDDKFKDGNKSVKVSTSYKTV 1091

Query: 1112 GGSKTSVTYMNKVRKLTAPK---SLKKLHSTGGERKISAQ 1148
            GGSK S+TY+ K RKL  PK   +++K +S    R  + Q
Sbjct: 1092 GGSKASITYLGKTRKLVPPKNGPTVRKRNSNNTSRLFNIQ 1131

 Score = 55.1 bits (131), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 39/46 (84%)

Query: 583 LFSDLKKKNRQQILSHQAEIIGTKGINHKDLEREKEIVEDLLEQEI 628
           LF++L+K  +QQI+ H+ E++ ++G+N +DLE++K +VEDLLE+EI
Sbjct: 566 LFNNLRKATKQQIMLHRKELMESRGLNFEDLEKQKVMVEDLLEKEI 611

>KLLA0C00484g Chr3 complement(35397..38174) [2778 bp, 925 aa] {ON}
            weakly similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061C MRC1 S-phase checkpoint protein found at
            replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 925

 Score =  193 bits (490), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 139/385 (36%), Positives = 195/385 (50%), Gaps = 43/385 (11%)

Query: 775  LDEKEHARAVDKERLKTIMKEKKLMLKRAELKEKGVSNFFXXXXXXXXXXWHGIGGIDGE 834
            LDE E  R  ++ +++  M+ +    ++  LK  G++             WHG+GG DGE
Sbjct: 580  LDEVERNRLQERAKMRRRMEIEAAKKRKQVLKSTGLNKILEMEAEESEDEWHGVGGADGE 639

Query: 835  VSDEYDSEVEKMIDDYSRADMDPEEIRKLLVSENKEMDVKMVNKILFDIKNGNFRKRGRD 894
             SD+YDS+++ MIDD+S++  D   IR+ L  ENKEMD +M+NKIL DI  G FRKRGR 
Sbjct: 640  NSDDYDSDLDTMIDDFSKSKFDTASIRERLALENKEMDERMINKILHDINTGGFRKRGRG 699

Query: 895  TXXXXXXXXXXXXXRQYRQKRNELMKQRXXXXXXXXXXXXXXXTKAFFDSLVEDIVEVKN 954
                          RQ+R+KR E+MKQ+               +KAFFDS+VEDI     
Sbjct: 700  ALDLELSDDEDELLRQFREKRREIMKQK--LLENVDGVVNNSKSKAFFDSMVEDITRKSI 757

Query: 955  PFGVMSDNXXXXXXXXXXXXXXXRESVSNKEEKPTQEKGKKTVLSEEFVQRSLSFLNS-N 1013
            P                        S SN  ++  +   KK V+SEEFVQ SLSFL++ +
Sbjct: 758  PAVT---------------------SFSNTRDEMGK---KKIVISEEFVQSSLSFLSAKD 793

Query: 1014 RNLTEFEQNQDLARLQHDDDVSDLYTLXXXXXXXXXXXXXXXNEIINVDANDNSGTAVAT 1073
             ++ EFE    +    H D   DL +L                     D  D  GT++  
Sbjct: 794  DDINEFE----VTEAAH-DATEDLESLKQRSNIKSLDSPQRNRNSAFFD--DVDGTSL-- 844

Query: 1074 ATFRPPSIIKSFNSKLNVDDKFRNGKKTVKTFKSYKAVGGSKTSVTYMNKVRKLTAPKSL 1133
              F+ PSI+KSF+S  +V+DKF+ G KTV   KSY+   GS++++T++ K RKL AP+  
Sbjct: 845  -DFKLPSIVKSFSSNSDVNDKFKTGIKTVTISKSYRVASGSRSAITFLGKKRKLKAPQGR 903

Query: 1134 KKLHSTGGERKISAQTSHSFKSNSN 1158
            K   ST   RK    TS  F SNS+
Sbjct: 904  K---STPLVRK---PTSSLFDSNSD 922

 Score = 48.9 bits (115), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 34/50 (68%)

Query: 579 TLDSLFSDLKKKNRQQILSHQAEIIGTKGINHKDLEREKEIVEDLLEQEI 628
           +L  LF+ LK KNR QIL  + EI G KGI+ + +E EK  VE LLEQE+
Sbjct: 368 SLKELFTSLKTKNRDQILEFRREISGKKGISLEAIEDEKIQVEKLLEQEL 417

>Ecym_1008 Chr1 complement(13340..16696) [3357 bp, 1118 aa] {ON}
            similar to Ashbya gossypii AFR745W
          Length = 1118

 Score =  182 bits (463), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 125/377 (33%), Positives = 187/377 (49%), Gaps = 30/377 (7%)

Query: 782  RAVDKE-RLKTIMKEKKLMLKRAELKEKGVSNFFXXXXXXXXXXWHGIGGIDGEVSDEYD 840
            R + KE  LK  ++EK    K+ E+++ GV+             WHG+GG+D E SDEYD
Sbjct: 753  RKIVKELMLKLRLQEKIKRQKQKEMRKLGVNKMVELEADESEDEWHGVGGVDYEASDEYD 812

Query: 841  SEVEKMIDDYSRADMDPEEIRKLLVSENKEMDVKMVNKILFDIKNGNFRKRGRDTXXXXX 900
            S+++KMIDDY++ + DP EIRK+L SE+ + D  MVNKIL DIK G FRKRGR       
Sbjct: 813  SDLDKMIDDYNKNEFDPVEIRKILASEDLQHDKNMVNKILHDIKTGGFRKRGRGELDLEL 872

Query: 901  XXXXXXXXRQYRQKRNELMKQRXXXXXXXXXXXXXXXTKAFFDSLVEDI-VEVKNPFGVM 959
                    + YR KR    KQ+               +  FF+S+V++  + V+   G  
Sbjct: 873  SEDEDGILQSYRAKRWNEQKQKMLDSEHNTSVKSNPKSLPFFESMVDEFTIPVERALGT- 931

Query: 960  SDNXXXXXXXXXXXXXXXRESVSNKEEKPTQEKGKKTVLSEEFVQRSLSFLNSNRNLTEF 1019
                               +S +  E K  Q   +K V+SE FV+++LSFL S+ N+T  
Sbjct: 932  -------------PDSPPAQSTNVLELK--QNTKQKIVISEHFVKQTLSFLTSDENMTNM 976

Query: 1020 EQNQDLARLQHDDD-----VSDLYTLXXXXXXXXXXXXXXXNEIINVDANDNSGTAVATA 1074
                ++ +  +D+D     V DLYTL                 I+N D +       A  
Sbjct: 977  RSEINVEKPNNDNDIYSSEVEDLYTLKETSTIKVLNTYSGK-PIVNEDEDG------AEF 1029

Query: 1075 TFRPPSIIKSFNSKLNVDDKFRNGKKTVKTFKSYKAVGGSKTSVTYMNKVRKLTAPKSLK 1134
             F+ PS++++F S+ +V+DKF++G K+VK    YK +G S+ ++T++ K RKL  PK   
Sbjct: 1030 GFKAPSVMQTFGSRNDVNDKFKDGFKSVKISNKYKTLGSSRAAITFLGKKRKLIIPKRSS 1089

Query: 1135 KLHSTGGERKISAQTSH 1151
            K       R I  +  H
Sbjct: 1090 KSPRDSAHRSIKNRLKH 1106

 Score = 55.5 bits (132), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 29/53 (54%), Positives = 38/53 (71%)

Query: 576 NKTTLDSLFSDLKKKNRQQILSHQAEIIGTKGINHKDLEREKEIVEDLLEQEI 628
           N  TL  LF  LKK N++QIL H+ EI   +GI+ + LE+E+E VEDLLEQ+I
Sbjct: 468 NSPTLKQLFISLKKANKKQILDHRREITEKRGISLEQLEQEREKVEDLLEQKI 520

>KLTH0F00484g Chr6 complement(37017..39998) [2982 bp, 993 aa] {ON}
            weakly similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061C MRC1 S-phase checkpoint protein found at
            replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 993

 Score =  181 bits (459), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 126/386 (32%), Positives = 182/386 (47%), Gaps = 35/386 (9%)

Query: 784  VDKERLKTIMKEKKLMLKRAELKEKGVSNFFXXXXXXXXXXWHGIGGIDGEVSDEYDSEV 843
            ++K + K +++E KL     +L +   S             WHGIGG+DGE  D++DS++
Sbjct: 629  IEKHKRKELLREAKL----EKLHQSKASRIIDYEAEESDDEWHGIGGVDGERFDDHDSDL 684

Query: 844  EKMIDDYSRADMDPEEIRKLLVSENKEMDVKMVNKILFDIKNGNFRKRGRDTXXXXXXXX 903
            EKMIDDYS +  D  E+RK  + E    D  MVNKIL DI+ G FRKRGR+         
Sbjct: 685  EKMIDDYSNSRFDSSEVRKRQIEEEISEDKSMVNKILHDIETGGFRKRGRNALDLELSDD 744

Query: 904  XXXXXRQYRQKRNELMKQRXXXXXXXXXXXXXXXTKAFFDSLVEDIVEVKNPFGVMSDNX 963
                  +Y  +R EL++Q+               +KAFF+++VEDI       G + D  
Sbjct: 745  DDEELLKYHSRRKELLRQKVSAQGEAKLLAENPKSKAFFETIVEDI----RSKGALEDEG 800

Query: 964  XXXXXXXXXXXXXXRESVSNKEEK--PTQEKGKKTVLSEEFVQRSLSFLNSNRNLTEFEQ 1021
                            SV+  EEK   + +KGKKTVLSE FVQ++LSFL S     E   
Sbjct: 801  PPPVRGFS--------SVNAPEEKNSDSDKKGKKTVLSEAFVQQTLSFLTSGEVGEEKGP 852

Query: 1022 NQDLARLQ------HDDDVSDLYTLXXXXXXXXXXXXXXXNEIINVDANDNSGTAVATAT 1075
              +L  L       + ++  D++ L               +  + +D  ++       + 
Sbjct: 853  ENNLGSLPTHVPSFNTEETQDIFALKQNSSIKSLSAPTRNSSNMLIDDQED-----LLSR 907

Query: 1076 FRPPSIIKSFNSKLNVDDKFRNGKKTVKTFKSYKAVGGSKTSVTYMNKVRKLTAPK---- 1131
             R  S    F  +++ ++KF  GKKTV++  SYK  G SK S+TY+ K RKL APK    
Sbjct: 908  KRACSFFARFTKRVDANEKFEEGKKTVRSLNSYKVAGSSKASITYLGKARKLNAPKKVAH 967

Query: 1132 --SLKKLHSTGGERKISAQTSHSFKS 1155
              S K+ H       I A  S SF+S
Sbjct: 968  QQSRKRGHKPAAGFGIFASNSESFES 993

 Score = 41.6 bits (96), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 37/62 (59%), Gaps = 4/62 (6%)

Query: 35 DCVPTSLAGNGFLFGNATVDKIKNRLNNEDHPNSSIDVTKSSSEDQIP-VSQSQLLSTLY 93
          D +P  + G GFLFGN+ + ++K+RL   D  N   D TKS  ++    +SQ+Q++   Y
Sbjct: 26 DSLPL-VTGTGFLFGNSVLRRVKSRLG--DDENHEADSTKSPIDNGCCDLSQTQVVGLAY 82

Query: 94 DG 95
          DG
Sbjct: 83 DG 84

 Score = 41.2 bits (95), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 31/46 (67%)

Query: 583 LFSDLKKKNRQQILSHQAEIIGTKGINHKDLEREKEIVEDLLEQEI 628
           LF+ L+K N+ QIL ++ E   +KGI++  +  EK  +E LLE+E+
Sbjct: 394 LFASLRKANKSQILDYRKEKYQSKGIDYDKITEEKNSIESLLEREL 439

>AFR745W Chr6 (1803046..1806102) [3057 bp, 1018 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YCL061C (MRC1)
          Length = 1018

 Score =  177 bits (450), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 111/337 (32%), Positives = 169/337 (50%), Gaps = 30/337 (8%)

Query: 800  LKRAELKEKGVSNFFXXXXXXXXXXWHGIGGIDGEVSDEYDSEVEKMIDDYSRADMDPEE 859
            L+R E+K+KG++             WHGIGG D E+S++YDSEVEKMIDDYS    + + 
Sbjct: 676  LRRREMKKKGITKMLEMEAEESEDEWHGIGGSDNELSEDYDSEVEKMIDDYSVHSSNADH 735

Query: 860  IRKLLVSENKEMDVKMVNKILFDIKNGNFRKRGRDTXXXXXXXXXXXXXRQYRQKRNELM 919
            +R +L    ++ D  +VNKIL DI  G FR+RG+               +Q+RQKR EL+
Sbjct: 736  LRAILAKNERQHDENIVNKILHDISTGGFRRRGKGALDLEMSENEDQELQQFRQKRRELL 795

Query: 920  KQRXXXXXXXXXXXXXXXTKAFFDSLVEDIVEVKNPFGVMSDNXXXXXXXXXXXXXXXRE 979
            KQ+               + AFF ++V+D+ E    FG   D                  
Sbjct: 796  KQKILENGDTSKLVSNPKSYAFFQTMVDDVTEAS--FGNTFD------------------ 835

Query: 980  SVSNKEEK--PTQEKGKKTVLSEEFVQRSLSFLNSNRNLTEF--EQNQDLARLQHDDDVS 1035
              +N +EK  P+   G+K V+SE+FV+ +LSFL+S    +E   E     +     +++ 
Sbjct: 836  --ANIDEKTDPSA-AGRKIVISEQFVKETLSFLSSKSGDSEIPAETKSISSSTVEREEIQ 892

Query: 1036 DLYTLXXXXXXXXXXXXXXX-NEIINVDANDNSGTAVATATFRPPSIIKSFNSKLNVDDK 1094
            DL+TL                 ++  + + D      +   FR  S  KSFN+  NVDDK
Sbjct: 893  DLHTLKQNSNIKHLKGSLELPAQMAELSSGDEGDYGFSLDRFR--SAAKSFNNGTNVDDK 950

Query: 1095 FRNGKKTVKTFKSYKAVGGSKTSVTYMNKVRKLTAPK 1131
            F++G K V+  K+ K +GGSK ++T++ + R+L  PK
Sbjct: 951  FKSGTKAVRILKANKTIGGSKAAITFIGRKRRLIPPK 987

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 34/46 (73%)

Query: 583 LFSDLKKKNRQQILSHQAEIIGTKGINHKDLEREKEIVEDLLEQEI 628
           LF+ L+K NR+Q+L  +   I  +GIN ++LE+E+E + +LLEQE+
Sbjct: 416 LFAKLRKANREQLLEQRRNAIERRGINMQNLEQEREQLGNLLEQEL 461

>Kwal_33.13005 s33 complement(36797..39709) [2913 bp, 970 aa] {ON}
            YCL061C (MRC1) - protein involved in replication
            checkpoint [contig 123] FULL
          Length = 970

 Score =  173 bits (438), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 176/628 (28%), Positives = 259/628 (41%), Gaps = 87/628 (13%)

Query: 578  TTLDSLFSDLKKKNRQQILSHQAEIIGTKGINHKDLEREKEIVEDLLEQEIXXXXXXXXX 637
             +L  LFS L+K NR Q++ H+  ++  +G++  ++ +EKE VE LLE+E+         
Sbjct: 368  ASLRHLFSSLRKANRDQLVEHRNGLLLLRGVDLAEIAKEKESVESLLERELARNKKVKQE 427

Query: 638  XXXXXXXXXXXSDMDN--NYSANELESFDDSDHDSLXXXXXXXXXXXXXXXXXXXXXXXX 695
                       S  D   N S+  L S  DS  DS                         
Sbjct: 428  EIQKGEDSSSDSSSDEFCNDSSTSLGSHSDSADDS--------NGYDDYNQEVDESVDTE 479

Query: 696  FAAFQVLKGK-----KRKNMQI-QPESDSEEETVNSNDK----RVN-APSESKPIHPVNN 744
                  LK K     K  N+ I + ESD E++ +N   K    R N   S+ + +     
Sbjct: 480  VVDLGPLKSKHELSVKTTNLTIVRAESDEEDDPLNVTKKKKVRRWNLIDSDDEALSNDEQ 539

Query: 745  INAIDLGDYGNNL----------------------EIRAELNNTEK----LDTKC--MLD 776
               IDLG YG N+                      E + E N T+     L+  C   +D
Sbjct: 540  KTVIDLGAYGENILGTERIDEGAGAQVVGTSSSMCEAKLERNTTKSPVRILNRPCEEKID 599

Query: 777  EKEHAR------AVDKERLKTIMKEKKLMLKRAELKEKGVSNFFXXXXXXXXXXWHGIGG 830
            + E  R       ++K +LK  ++E K+     EL     +             W G+GG
Sbjct: 600  QDEETRNPIIKNLIEKRKLKEALREAKM----KELNRSKANGMIDFEAEESDDEWFGVGG 655

Query: 831  IDGEVSDEYDSEVEKMIDDYSRADMDPEEIRKLLVSENKEMDVKMVNKILFDIKNGNFRK 890
             DGE SD YDSE+++MIDDYS    DPE +RK L+ E K  D  MV++IL DI+NG FRK
Sbjct: 656  ADGENSDGYDSELDRMIDDYSNTKSDPEFLRKKLMEEEKLHDKDMVDRILHDIENGGFRK 715

Query: 891  RGRDTXXXXXXXXXXXXXRQYRQKRNELMKQRXXXXXXXXXXXXXXXTKAFFDSLVEDIV 950
            RGR                +Y  +R EL+ +R               +KAFFDS+ ED  
Sbjct: 716  RGRYAMDLTLSDDEDDDLLRYHARRKELLNERKSGNQEISVLATNPKSKAFFDSIFED-- 773

Query: 951  EVKNPFGVMSDNXXXXXXXXXXXXXXXRESVSNKEEKPTQEKGKKTVLSEEFVQRSLSFL 1010
            ++K     + +                ++ +S K E         T +SE+FVQ++LSFL
Sbjct: 774  DLKGGIANLKE-----YQSHASPLKAAKDEISGKRE---------TRISEQFVQKTLSFL 819

Query: 1011 NSNRNL---TEFEQNQDLARLQHDD--DVSDLYTLXXXXXXXXXXXXXXXNEIINVDAND 1065
             S  +     EF    D       D  + +D Y L               +  + V   D
Sbjct: 820  KSKEDEQGDAEFVSVADTQESSSGDFAEATDFYRLKQLSGIKSFSAPLRSSIRLQVRNKD 879

Query: 1066 NSGTAVATATFRPPSIIKSFNSKLNVDDKFRNGKKTVKTFKSYKAVGGSKTSVTYMNKVR 1125
               +  A  T     +++ F   ++ ++KF  G+KTVK+  SYK  G S+ S+T++ K R
Sbjct: 880  GVLSGKANTT-----LVERFVRSVDTNEKFEEGRKTVKSLNSYKIAGSSRASITFLGKAR 934

Query: 1126 KLTAPKSLKKLHSTGGERKISAQTSHSF 1153
             L A K      S    +KI   TSH F
Sbjct: 935  SLKARKRGPHARSAPHGQKI--MTSHQF 960

 Score = 34.3 bits (77), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 38/69 (55%), Gaps = 8/69 (11%)

Query: 33 DDDCVPTSLAGNGFLFGNATVDKIKNRL----NNEDHPNSSIDVTKSSSEDQIPVSQSQL 88
          DD+  PT + G GFLF N+  +++K R+    +NE + N+    T +S+E      ++Q 
Sbjct: 25 DDESCPT-VGGTGFLFENSIFNQVKKRIKATDDNEINHNAP---TTASTEILKDTCETQA 80

Query: 89 LSTLYDGGE 97
          +   YDG E
Sbjct: 81 IERPYDGEE 89

>Skud_3.3 Chr3 complement(6855..10313) [3459 bp, 1152 aa] {ON}
           YCL061C (REAL)
          Length = 1152

 Score = 66.2 bits (160), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 91/359 (25%), Positives = 143/359 (39%), Gaps = 39/359 (10%)

Query: 296 AQIIDAETQPTQIIDTNAQPTQIIDPDTQP----TQLINYSHESNGKHIPTLPAPDAXXX 351
           A+II   TQ     DT +Q  Q+  P T+P    TQ+I  +   +      +P   A   
Sbjct: 230 ARIIPVATQRIHSRDTASQTQQV--PFTKPIEPQTQIIGTTANDSDTQPLRIPVLTAEAS 287

Query: 352 XXXXXXXXNIPLHRYATAGTTSNPKHKNDSQHIIEDNIATMRDRLETQ--EFQPTVADDV 409
                    +P  R        + K+K      ++    T  D  +TQ      T+ DDV
Sbjct: 288 LLFQTTPDCVPTIRMDPPSQIEHDKYKTQ----LDTMTQTAHDEGKTQVDTMPQTIHDDV 343

Query: 410 KSGGNTLKIHEIQTQID-EETRNMLNRGVEHRKSR-GVPSRVEVRFTKES----FXXXXX 463
               +TLKI E+Q+++  E+++    R VE++KSR  +P+ +   F+KES    F     
Sbjct: 344 ---SHTLKIRELQSELALEDSKREKARNVEYKKSRRNIPTMI--NFSKESFLADFDNSSS 398

Query: 464 XXXXXXXXXXXXXQINDTTPETGSSQNSDSNKARKPTEAPKTKRVTGLSSYETILRNKVN 523
                        +      E   ++ S+ N  +   E+   K V  LSSY   L+ +++
Sbjct: 399 DEGTDVQLEKSQLKQQQDDNEVHENKPSEPNSVKNSRES--YKNVPLLSSYANNLKREID 456

Query: 524 DDECL--------------DLGXXXXXXXXXXXXXXXXVSQASXXXXXXXXXXXXXXXXX 569
             +C+               +G                   A                  
Sbjct: 457 SSKCIILDLDSDSDDDGDDYMGGNMSIKDESALPISRLSKAAILNLKARLSKQSQNLTQM 516

Query: 570 XXXXXTNKTTLDSLFSDLKKKNRQQILSHQAEIIGTKGINHKDLEREKEIVEDLLEQEI 628
                  K   + LF+ L+K +R+QIL HQ E+I TKG   +D+ +EKEIVE+LLEQEI
Sbjct: 517 PNKNKGAKVDHNKLFNILRKASRKQILDHQREVIETKGFKLEDMAKEKEIVENLLEQEI 575

 Score = 63.5 bits (153), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 41/62 (66%), Gaps = 3/62 (4%)

Query: 37  VPTSLAGNGFLFGNATVDKIKNRLNNEDHPNSSIDVTKSSSEDQIPVSQSQLLSTLYDGG 96
            P +L GNGFLFGNAT++++KNRL   D P     +  + +ED +    +QL++ LYDGG
Sbjct: 100 APPALTGNGFLFGNATLNRVKNRLEGIDVPEDDRQIKDNENEDAV---STQLIANLYDGG 156

Query: 97  ED 98
           ED
Sbjct: 157 ED 158

>KLTH0D09482g Chr4 complement(781892..782566) [675 bp, 224 aa] {ON}
           weakly similar to uniprot|P32773 Saccharomyces
           cerevisiae YOR194C TOA1 Transcription factor IIA large
           chain
          Length = 224

 Score = 35.0 bits (79), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 30/55 (54%), Gaps = 3/55 (5%)

Query: 182 NVGNKLEEQLESKDVSRQ-LRDIKLQSTTHLPTSTSRTRQINYSPTSEGAIGGEL 235
           NV N++ E  ES  +  Q L+D+KL   T L  S SR  +  + P  EGA+G  L
Sbjct: 16  NVVNEVREDFESAGIDEQTLQDLKLVWQTKL--SESRVAKFMWDPEDEGALGTSL 68

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.126    0.341 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 104,503,604
Number of extensions: 4281315
Number of successful extensions: 16952
Number of sequences better than 10.0: 55
Number of HSP's gapped: 17450
Number of HSP's successfully gapped: 95
Length of query: 1161
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1040
Effective length of database: 39,606,813
Effective search space: 41191085520
Effective search space used: 41191085520
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 71 (32.0 bits)