Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0C00210na 1ON81581541650.0
NCAS0C002308.880ON6103264633e-48
Suva_13.488.880ON5913494491e-46
KAFR0A030708.880ON5623254453e-46
NDAI0E001208.880ON7493314462e-45
NDAI0G01400singletonON6833294442e-45
KNAG0D05350singletonON6613394202e-42
TDEL0B004908.880ON6953264151e-41
NDAI0K001408.880ON6453444131e-41
TBLA0C062608.880ON7703394101e-40
TPHA0C049908.880ON5733603897e-39
Kpol_455.118.880ON5583263871e-38
KAFR0D00130na 1ON5953513562e-34
KAFR0A03050singletonON5222833034e-28
KLLA0F24816g8.779ON4782692215e-18
TPHA0I007108.779ON4862622199e-18
SAKL0B05566g8.779ON5052592101e-16
KLTH0H15180g8.779ON4942522064e-16
Kwal_34.159228.779ON4962542055e-16
ZYRO0F12342g8.779ON4562562038e-16
Ecym_14828.779ON5072522039e-16
Kpol_1045.68.779ON4782731941e-14
TBLA0B028708.779ON4812511931e-14
AFR538C8.779ON4322631823e-13
KNAG0G03660singletonON1991111698e-13
TDEL0B033008.779ON4812561789e-13
KAFR0B035108.779ON6232861772e-12
NDAI0K008208.779ON5172511691e-11
KAFR0C03740singletonON7293191682e-11
NDAI0K02960singletonON4612251663e-11
CAGL0M05159g8.779ON4492611654e-11
KNAG0J006808.779ON4692511637e-11
CAGL0I09636g8.779ON7342481612e-10
Suva_13.4248.779ON4692371582e-10
NCAS0C007908.779ON6752591593e-10
Skud_13.4108.779ON4742381556e-10
Smik_13.4518.779ON4722191547e-10
YMR239C (RNT1)8.779ON4712381531e-09
Smik_4.3678.279ON106666791.0
Skud_8.2624.362ON575118743.7
TBLA0A058401.127ON202367743.8
ABR092C2.601ON100144725.4
KLTH0F03388g1.127ON197247717.6
NDAI0D017005.287ON578119717.9
ZYRO0G17380g7.459ON40357709.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0C00210
         (815 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0C00210 Chr3 complement(30184..32631) [2448 bp, 815 aa] {ON}     1608   0.0  
NCAS0C00230 Chr3 complement(25138..26970) [1833 bp, 610 aa] {ON}      182   3e-48
Suva_13.48 Chr13 (73725..75500) [1776 bp, 591 aa] {ON} YMR239C (...   177   1e-46
KAFR0A03070 Chr1 (629671..631359) [1689 bp, 562 aa] {ON}              176   3e-46
NDAI0E00120 Chr5 (1990..4239) [2250 bp, 749 aa] {ON}                  176   2e-45
NDAI0G01400 Chr7 complement(312005..314056) [2052 bp, 683 aa] {ON}    175   2e-45
KNAG0D05350 Chr4 complement(978518..980503) [1986 bp, 661 aa] {O...   166   2e-42
TDEL0B00490 Chr2 complement(86668..88755) [2088 bp, 695 aa] {ON}      164   1e-41
NDAI0K00140 Chr11 (18609..20546) [1938 bp, 645 aa] {ON}               163   1e-41
TBLA0C06260 Chr3 (1515789..1518101) [2313 bp, 770 aa] {ON}            162   1e-40
TPHA0C04990 Chr3 complement(1075250..1076971) [1722 bp, 573 aa] ...   154   7e-39
Kpol_455.11 s455 complement(14820..16496) [1677 bp, 558 aa] {ON}...   153   1e-38
KAFR0D00130 Chr4 complement(10547..12334) [1788 bp, 595 aa] {ON}...   141   2e-34
KAFR0A03050 Chr1 complement(623884..625452) [1569 bp, 522 aa] {O...   121   4e-28
KLLA0F24816g Chr6 (2308342..2309778) [1437 bp, 478 aa] {ON} simi...    90   5e-18
TPHA0I00710 Chr9 (143903..145363) [1461 bp, 486 aa] {ON} Anc_8.7...    89   9e-18
SAKL0B05566g Chr2 complement(482433..483950) [1518 bp, 505 aa] {...    86   1e-16
KLTH0H15180g Chr8 complement(1317079..1318563) [1485 bp, 494 aa]...    84   4e-16
Kwal_34.15922 s34 (115736..117226) [1491 bp, 496 aa] {ON} YMR239...    84   5e-16
ZYRO0F12342g Chr6 complement(1005809..1007179) [1371 bp, 456 aa]...    83   8e-16
Ecym_1482 Chr1 complement(995669..997192) [1524 bp, 507 aa] {ON}...    83   9e-16
Kpol_1045.6 s1045 (8627..10063) [1437 bp, 478 aa] {ON} (8627..10...    79   1e-14
TBLA0B02870 Chr2 (660516..661961) [1446 bp, 481 aa] {ON} Anc_8.7...    79   1e-14
AFR538C Chr6 complement(1404410..1405708) [1299 bp, 432 aa] {ON}...    75   3e-13
KNAG0G03660 Chr7 complement(770911..771510) [600 bp, 199 aa] {ON}      70   8e-13
TDEL0B03300 Chr2 (588444..589889) [1446 bp, 481 aa] {ON}               73   9e-13
KAFR0B03510 Chr2 complement(729872..731743) [1872 bp, 623 aa] {O...    73   2e-12
NDAI0K00820 Chr11 (183793..185346) [1554 bp, 517 aa] {ON} Anc_8....    70   1e-11
KAFR0C03740 Chr3 (763425..765614) [2190 bp, 729 aa] {ON}               69   2e-11
NDAI0K02960 Chr11 complement(672616..674001) [1386 bp, 461 aa] {...    69   3e-11
CAGL0M05159g Chr13 complement(556347..557696) [1350 bp, 449 aa] ...    68   4e-11
KNAG0J00680 Chr10 (115634..117043) [1410 bp, 469 aa] {ON} Anc_8....    67   7e-11
CAGL0I09636g Chr9 complement(921232..923436) [2205 bp, 734 aa] {...    67   2e-10
Suva_13.424 Chr13 complement(729834..731243) [1410 bp, 469 aa] {...    65   2e-10
NCAS0C00790 Chr3 (137927..139954) [2028 bp, 675 aa] {ON} Anc_8.7...    66   3e-10
Skud_13.410 Chr13 complement(723047..724471) [1425 bp, 474 aa] {...    64   6e-10
Smik_13.451 Chr13 complement(732656..734074) [1419 bp, 472 aa] {...    64   7e-10
YMR239C Chr13 complement(748262..749677) [1416 bp, 471 aa] {ON} ...    64   1e-09
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...    35   1.0  
Skud_8.262 Chr8 (460838..462565) [1728 bp, 575 aa] {ON} YHR196W ...    33   3.7  
TBLA0A05840 Chr1 complement(1440357..1446428) [6072 bp, 2023 aa]...    33   3.8  
ABR092C Chr2 complement(551739..554744) [3006 bp, 1001 aa] {ON} ...    32   5.4  
KLTH0F03388g Chr6 complement(290517..296435) [5919 bp, 1972 aa] ...    32   7.6  
NDAI0D01700 Chr4 complement(399539..401275) [1737 bp, 578 aa] {O...    32   7.9  
ZYRO0G17380g Chr7 (1429164..1430375) [1212 bp, 403 aa] {ON} high...    32   9.7  

>KNAG0C00210 Chr3 complement(30184..32631) [2448 bp, 815 aa] {ON} 
          Length = 815

 Score = 1608 bits (4165), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 782/815 (95%), Positives = 782/815 (95%)

Query: 1   MGSCMTPKENIALKKFTKIQNACTELRNSMEIIYENALTEDELTSLTTGSEIEKFIAFTP 60
           MGSCMTPKENIALKKFTKIQNACTELRNSMEIIYENALTEDELTSLTTGSEIEKFIAFTP
Sbjct: 1   MGSCMTPKENIALKKFTKIQNACTELRNSMEIIYENALTEDELTSLTTGSEIEKFIAFTP 60

Query: 61  ACMISTYLANARSSVDIVKICDYYKFDENIWSSTALIKEPIITNPILEFLVLAHKKLQKS 120
           ACMISTYLANARSSVDIVKICDYYKFDENIWSSTALIKEPIITNPILEFLVLAHKKLQKS
Sbjct: 61  ACMISTYLANARSSVDIVKICDYYKFDENIWSSTALIKEPIITNPILEFLVLAHKKLQKS 120

Query: 121 NTAKNNELLQFVGDSWLKSLIASILYKKFPHASAKALEKLKSDLLTNETLDLWSANNRLL 180
           NTAKNNELLQFVGDSWLKSLIASILYKKFPHASAKALEKLKSDLLTNETLDLWSANNRLL
Sbjct: 121 NTAKNNELLQFVGDSWLKSLIASILYKKFPHASAKALEKLKSDLLTNETLDLWSANNRLL 180

Query: 181 KSLPDLVTKMHPNASEEEVLNYRRSCFKAYIGALILDRSHHELNDVVSWLSSLCETRVGI 240
           KSLPDLVTKMHPNASEEEVLNYRRSCFKAYIGALILDRSHHELNDVVSWLSSLCETRVGI
Sbjct: 181 KSLPDLVTKMHPNASEEEVLNYRRSCFKAYIGALILDRSHHELNDVVSWLSSLCETRVGI 240

Query: 241 LKAQNLRGLYAKNLKEQLVQFMEGNKSEKPLKFITTHIGASHSCKVVIGSTVLGTARGVT 300
           LKAQNLRGLYAKNLKEQLVQFMEGNKSEKPLKFITTHIGASHSCKVVIGSTVLGTARGVT
Sbjct: 241 LKAQNLRGLYAKNLKEQLVQFMEGNKSEKPLKFITTHIGASHSCKVVIGSTVLGTARGVT 300

Query: 301 AVEAERKAASIVLGNVELLTKYTVYSDSVPIYQKPLASNNSENSEEKAVIXXXXXXXXXX 360
           AVEAERKAASIVLGNVELLTKYTVYSDSVPIYQKPLASNNSENSEEKAVI          
Sbjct: 301 AVEAERKAASIVLGNVELLTKYTVYSDSVPIYQKPLASNNSENSEEKAVIAESEAVKENE 360

Query: 361 XXXXXRAKIFSPIDDEKLTEHILSKLSERLESMVSEITLKILQEKNISSPDNNENSTKPV 420
                RAKIFSPIDDEKLTEHILSKLSERLESMVSEITLKILQEKNISSPDNNENSTKPV
Sbjct: 361 NAENERAKIFSPIDDEKLTEHILSKLSERLESMVSEITLKILQEKNISSPDNNENSTKPV 420

Query: 421 PDAPIATVSTENTENGSVSELHAEQKEPVDDLMEPNFSVAMESEEPAENLISKGLDFASN 480
           PDAPIATVSTENTENGSVSELHAEQKEPVDDLMEPNFSVAMESEEPAENLISKGLDFASN
Sbjct: 421 PDAPIATVSTENTENGSVSELHAEQKEPVDDLMEPNFSVAMESEEPAENLISKGLDFASN 480

Query: 481 NPATLFNKVKQPEVSTKPVEKREFSDATTYHNRTHLNSFIPDRKLSTPPMDEPVNNSNPH 540
           NPATLFNKVKQPEVSTKPVEKREFSDATTYHNRTHLNSFIPDRKLSTPPMDEPVNNSNPH
Sbjct: 481 NPATLFNKVKQPEVSTKPVEKREFSDATTYHNRTHLNSFIPDRKLSTPPMDEPVNNSNPH 540

Query: 541 QHIAIPPLPAMIERKATDAAHVKEEVVAQKSAETNDHQSPVVSRQYEHAAEHPQSNASLT 600
           QHIAIPPLPAMIERKATDAAHVKEEVVAQKSAETNDHQSPVVSRQYEHAAEHPQSNASLT
Sbjct: 541 QHIAIPPLPAMIERKATDAAHVKEEVVAQKSAETNDHQSPVVSRQYEHAAEHPQSNASLT 600

Query: 601 GASKLPLQHQFDKTAKAQVYGAVGRLNMFPEYVTVQLGVNDFYSCCSIKGEPDSLMGEGR 660
           GASKLPLQHQFDKTAKAQVYGAVGRLNMFPEYVTVQLGVNDFYSCCSIKGEPDSLMGEGR
Sbjct: 601 GASKLPLQHQFDKTAKAQVYGAVGRLNMFPEYVTVQLGVNDFYSCCSIKGEPDSLMGEGR 660

Query: 661 GFSKKIAEQVAAGAALQSDKWRILSEXXXXXXXXLFGVDILEDTTDDPMKTGNKNEVDHY 720
           GFSKKIAEQVAAGAALQSDKWRILSE        LFGVDILEDTTDDPMKTGNKNEVDHY
Sbjct: 661 GFSKKIAEQVAAGAALQSDKWRILSEKKKKAAAALFGVDILEDTTDDPMKTGNKNEVDHY 720

Query: 721 KHFQXXXXXXXXXXIVHTSCDKTAMGRLQALLGEAGFIPEYKTRMLAPSHFYSTCNVRGT 780
           KHFQ          IVHTSCDKTAMGRLQALLGEAGFIPEYKTRMLAPSHFYSTCNVRGT
Sbjct: 721 KHFQPEPEPEVEKPIVHTSCDKTAMGRLQALLGEAGFIPEYKTRMLAPSHFYSTCNVRGT 780

Query: 781 SVLLAEGHGLTKLVSQQIAAENAMFNSSIDEFLED 815
           SVLLAEGHGLTKLVSQQIAAENAMFNSSIDEFLED
Sbjct: 781 SVLLAEGHGLTKLVSQQIAAENAMFNSSIDEFLED 815

>NCAS0C00230 Chr3 complement(25138..26970) [1833 bp, 610 aa] {ON} 
          Length = 610

 Score =  182 bits (463), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 109/326 (33%), Positives = 177/326 (54%), Gaps = 18/326 (5%)

Query: 13  LKKFTKIQNACTELRNSMEIIYENALTEDELTSLTT-GSEIEKFIAFTPACMISTYLANA 71
           L+ F K+QNAC +LR S+++IYEN L+ D+L ++   G+++EK IA +PA  +++ L   
Sbjct: 25  LRNFYKVQNACAQLRESIKVIYENGLSSDQLNTMAKHGNDLEKSIANSPAMSVASCLNQV 84

Query: 72  RSSVDIVKICDYYKFDENIWSSTALIKEPIITNPILEFLVLAHKKLQKSN--------TA 123
           R ++DI  I D+YKF+ N       +  P+ ++  LE L   H+ L   N        T 
Sbjct: 85  RPTLDIKNIFDHYKFENNSSPVDPYVHYPVCSDQNLENLAFIHRSLPNMNVKLTELQKTV 144

Query: 124 KNNELLQFVGDSWLKSLIASILYKKFPHASAKALEKLKSDLLTNETLDL----WSANNRL 179
            +NE L+F+GDSWL +L+A I+YKK+P+A+  AL K+K  ++ N  L+          RL
Sbjct: 145 MSNERLEFLGDSWLGALVAYIIYKKYPYANEGALSKMKEAIVNNNNLEKICEKLGFKERL 204

Query: 180 LKSLPDLVTKMHPNASEEEVLNYRRSCFKAYIGALILDRSHHELNDVVSWLSSLCETRVG 239
            +++P    K+    ++    NY   C +AYIGAL++DR   E NDV  WL  L E    
Sbjct: 205 KENIPRSSMKIKDRLTK----NYA-DCVEAYIGALVIDRFSTEFNDVALWLEELSEEHFI 259

Query: 240 ILKAQNLRGLYAKNLKEQLVQFMEGNKSEKPLKFITTHIGASHSCKVVIGSTVLGTARGV 299
            L    ++    KN K +L  F++ N     + +   +  +    +V +G+ +LG   G 
Sbjct: 260 ELGPMMVKEPLNKNAKGELGAFLQFNNIGAKISYKRLNDKSPFKVEVRLGNNLLGIGDGS 319

Query: 300 TAVEAERKAASIVLGNVELLTKYTVY 325
              EAE++AA   L   +L+ KY+++
Sbjct: 320 NVREAEQRAAMEALAQPKLIQKYSLH 345

 Score = 70.9 bits (172), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 50/79 (63%)

Query: 735 IVHTSCDKTAMGRLQALLGEAGFIPEYKTRMLAPSHFYSTCNVRGTSVLLAEGHGLTKLV 794
           ++++  DK A GRL ALLG+    PEY T  L  + FY+ C ++G  V + +GHG +K +
Sbjct: 526 LLNSVYDKEASGRLYALLGKYKLYPEYNTEQLGMTDFYTVCFIKGVGVEIGKGHGRSKKI 585

Query: 795 SQQIAAENAMFNSSIDEFL 813
           SQ  +AE+A+   ++ E+L
Sbjct: 586 SQHKSAEDALNGKALKEYL 604

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 44/70 (62%), Gaps = 1/70 (1%)

Query: 607 LQHQFDKTAKAQVYGAVGRLNMFPEYVTVQLGVNDFYSCCSIKGEPDSLMGEGRGFSKKI 666
           L   +DK A  ++Y  +G+  ++PEY T QLG+ DFY+ C IKG     +G+G G SKKI
Sbjct: 527 LNSVYDKEASGRLYALLGKYKLYPEYNTEQLGMTDFYTVCFIKGV-GVEIGKGHGRSKKI 585

Query: 667 AEQVAAGAAL 676
           ++  +A  AL
Sbjct: 586 SQHKSAEDAL 595

>Suva_13.48 Chr13 (73725..75500) [1776 bp, 591 aa] {ON} YMR239C
           (REAL)
          Length = 591

 Score =  177 bits (449), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 108/349 (30%), Positives = 186/349 (53%), Gaps = 24/349 (6%)

Query: 2   GSCMTPKENIALKKFTKIQNACTELRNSMEIIYENALTEDELTSLTT-GSEIEKFIAFTP 60
           G     ++ + L++F KI NAC +LR ++++IY+NA T +E+  +   GS +E+ I  +P
Sbjct: 8   GGLFAGRDPLQLRRFYKIHNACVQLREAIKVIYDNAPTNEEINDMVKHGSRLEQSIGVSP 67

Query: 61  ACMISTYLANARSSVDIVKICDYYKFDENIWSST-ALIKEPIITNPILEFLVLAHKKLQK 119
           A  +++YL   + S+DI  +   YKF EN+ S     +  P++TN  LE L   H+ +  
Sbjct: 68  AMSVASYLKTDQRSLDIESVFQRYKF-ENVDSPVHQFVHYPVVTNIHLENLAFVHRSVPN 126

Query: 120 SN--------TAKNNELLQFVGDSWLKSLIASILYKKFPHASAKALEKLKSDLLTNETLD 171
            N        T  +NE L+F+GDSWL + +A ILY+K+P +   AL ++KS ++ N  L+
Sbjct: 127 MNVNLTEVQKTVMSNERLEFLGDSWLGAFVAYILYRKYPFSDEGALSRMKSAIVNNNNLE 186

Query: 172 LWSA----NNRLLKSLPDLVTKMHPNASEEEVLNYRRSCFKAYIGALILDRSHHELNDVV 227
             S       RL +++P   +KM     +++   +   C +AYIGAL++DR   E  DVV
Sbjct: 187 RLSQKLGFKERLKENIPR--SKMR---IKDKPFKHYADCVEAYIGALVIDRFSAEFVDVV 241

Query: 228 SWLSSLCETRVGILKAQNLRGLYAKNLKEQLVQFMEGNKSEKPLKFITTHIGASHSCKVV 287
            W+  L + +   L     +    KN K +L  +++ NK    +K+   +     + +V 
Sbjct: 242 DWIEELSQDQFNTLGGIMEKKPLNKNAKGELGNYLQFNKLGAKIKYFCLNNQPPFTSEVR 301

Query: 288 IGSTVLGTARGVTAVEAERKAASIVLGNVELLTKYTVYS----DSVPIY 332
           +G   LG   G    EAE++AA   + +++++ KY+++     DSV  Y
Sbjct: 302 LGDIFLGRGEGQNIKEAEQRAAMEAIDDIDIIQKYSIHDMEDRDSVYPY 350

 Score = 48.1 bits (113), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 56/130 (43%), Gaps = 16/130 (12%)

Query: 564 EEVVAQKSAETNDHQS----------PVVSRQYEHAAEHPQSNASLTGASKLPL-----Q 608
           ++V+A  S  + DHQ           P  S  +  A     S      A  LP       
Sbjct: 452 DDVLANMSISSQDHQCSTSFSTDISEPASSISFSSATASKSSPKGCNLAGDLPPILEPDS 511

Query: 609 HQFDKTAKAQVYGAVGRLNMFPEYVTVQLGVNDFYSCCSIKGEPDSLMGEGRGFSKKIAE 668
              DK A  ++Y  +GR ++ P+Y   +L    F+  C+  GE  + +GEG    +KIA+
Sbjct: 512 TGVDKIASDKLYAYMGRFHLTPKYTFKKLTNGSFHCVCT-AGEFATTLGEGDAKRRKIAQ 570

Query: 669 QVAAGAALQS 678
             AA  AL+S
Sbjct: 571 HTAAAQALRS 580

 Score = 38.1 bits (87), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 29/67 (43%)

Query: 738 TSCDKTAMGRLQALLGEAGFIPEYKTRMLAPSHFYSTCNVRGTSVLLAEGHGLTKLVSQQ 797
           T  DK A  +L A +G     P+Y  + L    F+  C     +  L EG    + ++Q 
Sbjct: 512 TGVDKIASDKLYAYMGRFHLTPKYTFKKLTNGSFHCVCTAGEFATTLGEGDAKRRKIAQH 571

Query: 798 IAAENAM 804
            AA  A+
Sbjct: 572 TAAAQAL 578

>KAFR0A03070 Chr1 (629671..631359) [1689 bp, 562 aa] {ON} 
          Length = 562

 Score =  176 bits (445), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 108/325 (33%), Positives = 169/325 (52%), Gaps = 18/325 (5%)

Query: 13  LKKFTKIQNACTELRNSMEIIYENALTEDELTS-LTTGSEIEKFIAFTPACMISTYLANA 71
           L+KF KIQNAC++L  S+ ++YENAL+ +E+ S L  G+ +EK IA +PA  +++ L  A
Sbjct: 21  LRKFYKIQNACSQLEASINVLYENALSTEEIDSMLKHGTNLEKLIAASPAMHVASRLKAA 80

Query: 72  RSSVDIVKICDYYKFDENIWSSTALIKEPIITNPILEFLVLAHKKLQKSNTAKN------ 125
           +  +DI  +   Y F+ +       I  PI T+  LE L   H      N          
Sbjct: 81  KKVLDIQSVFKQYNFESDNSPVDEYIHYPICTDRRLENLAFIHSSYPNMNVKLTETQKIV 140

Query: 126 --NELLQFVGDSWLKSLIASILYKKFPHASAKALEKLKSDLLTNETLDL----WSANNRL 179
             NE L+F+GDSWL +L+A I+Y K+P+A   AL K+K  +++N  L+          RL
Sbjct: 141 MCNERLEFLGDSWLGALVAYIIYNKYPYADEGALSKMKDAIVSNSNLEKICTKLGFKERL 200

Query: 180 LKSLPDLVTKMHPNASEEEVLNYRRSCFKAYIGALILDRSHHELNDVVSWLSSLCETRVG 239
           L+++P    K+    S+     Y   C +AYIGAL++DR   E  D+  WL+ L +    
Sbjct: 201 LENIPRSSMKIKNKFSK-----YYADCVEAYIGALVVDRFSAEFKDIADWLTELAQEHFE 255

Query: 240 ILKAQNLRGLYAKNLKEQLVQFMEGNKSEKPLKFITTHIGASHSCKVVIGSTVLGTARGV 299
            L     +    KN K +L +F++ NK    L ++          ++ +G+ +L   +G 
Sbjct: 256 ELGPDMFKKPLNKNAKGELAEFLQFNKLGLKLAYVRVTNKTPFKVQLKLGTILLAEGQGP 315

Query: 300 TAVEAERKAASIVLGNVELLTKYTV 324
              EAE +AA  VL N EL+ KY++
Sbjct: 316 NVREAEHRAAMEVLANKELIEKYSL 340

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 47/70 (67%), Gaps = 1/70 (1%)

Query: 610 QFDKTAKAQVYGAVGRLNMFPEYVTVQLGVNDFYSCCSIKGEPDSLMGEGRGFSKKIAEQ 669
           ++DK +  ++Y  +G + + P+Y   Q G ++F++ CSIKG   + +GEG G SKKIA+ 
Sbjct: 485 EYDKESSGRLYALLGSIKLHPDYEIFQEGPSEFHAICSIKG-TGTFLGEGTGRSKKIAQH 543

Query: 670 VAAGAALQSD 679
           +AAG AL S+
Sbjct: 544 IAAGNALNSE 553

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 45/73 (61%)

Query: 741 DKTAMGRLQALLGEAGFIPEYKTRMLAPSHFYSTCNVRGTSVLLAEGHGLTKLVSQQIAA 800
           DK + GRL ALLG     P+Y+     PS F++ C+++GT   L EG G +K ++Q IAA
Sbjct: 487 DKESSGRLYALLGSIKLHPDYEIFQEGPSEFHAICSIKGTGTFLGEGTGRSKKIAQHIAA 546

Query: 801 ENAMFNSSIDEFL 813
            NA+ + ++ + L
Sbjct: 547 GNALNSEALQDIL 559

>NDAI0E00120 Chr5 (1990..4239) [2250 bp, 749 aa] {ON} 
          Length = 749

 Score =  176 bits (446), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 112/331 (33%), Positives = 175/331 (52%), Gaps = 18/331 (5%)

Query: 6   TPKENIALKKFTKIQNACTELRNSMEIIYENALTEDELTSL-TTGSEIEKFIAFTPACMI 64
           T K    L+ F K+QNAC +L+ +++IIY NA   +EL  L T G+E+E+ IA +PA  I
Sbjct: 14  TEKHGEELRSFYKVQNACVQLKEAIKIIYANAKPNEELVELFTNGNELEQAIAKSPAMSI 73

Query: 65  STYLANARSSVDIVKICDYYKFDENIWSSTALIKEPIITNPILEFLVLAHKKLQKSN--- 121
           ++YL + + S D+  I ++Y F E+       IK P++++  LE L   H+ L   N   
Sbjct: 74  ASYLYSVQPSFDVESIFEHYAFHEDSTPVDQFIKYPVVSDASLENLAFIHRSLPNMNVNL 133

Query: 122 -----TAKNNELLQFVGDSWLKSLIASILYKKFPHASAKALEKLKSDLLTNETLDLWSAN 176
                T  +NE L+F+GDSWL +L+A  LYKK+P A+  AL K+K  ++ N+ L+  S  
Sbjct: 134 TESQRTMMSNERLEFLGDSWLGALVAYSLYKKYPFANEGALSKMKQAIVNNDNLEKISKK 193

Query: 177 ----NRLLKSLPDLVTKMHPNASEEEVLNYRRSCFKAYIGALILDRSHHELNDVVSWLSS 232
                +L  ++P    +     S+         C +AYIGAL++DR   E  +V  WL  
Sbjct: 194 LGFPEKLRGNIPHTSLRKKDKKSK-----LYADCVEAYIGALVVDRYSAEFKEVSQWLED 248

Query: 233 LCETRVGILKAQNLRGLYAKNLKEQLVQFMEGNKSEKPLKFITTHIGASHSCKVVIGSTV 292
           L E     +     R    KN K +L + ++ NK  K +++ T +  +    +V +G+ V
Sbjct: 249 LSEDIFEEMGDSLTRDPLNKNSKGELAEILQFNKLGKKVEYKTLNKKSPFRVEVRLGNIV 308

Query: 293 LGTARGVTAVEAERKAASIVLGNVELLTKYT 323
           LG   G    EAE+++A   L N + L KYT
Sbjct: 309 LGVGVGDNIKEAEQRSAMFALENPKELEKYT 339

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 59/99 (59%), Gaps = 5/99 (5%)

Query: 589 AAEHPQSNASLTGASKLPLQH---QFDKTAKAQVYGAVGRLNMFPEYVTVQLGVNDFYSC 645
           A   P  +++  G  K+P  +   ++DK A  ++Y  +G+ NM PEY T   G + FY+ 
Sbjct: 650 AGLDPSKDSNNRGGEKVPSSNNSTRYDKEASEKLYALLGKSNMCPEYETTNEG-DGFYTV 708

Query: 646 CSIKGEPDSLMGEGRGFSKKIAEQVAAGAALQSDKWRIL 684
           C IKG   ++ GEG G SKKI++ +AAG AL++ + + L
Sbjct: 709 CRIKGMGITI-GEGSGRSKKISQHIAAGNALRNKEVKKL 746

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 44/76 (57%), Gaps = 1/76 (1%)

Query: 738 TSCDKTAMGRLQALLGEAGFIPEYKTRMLAPSHFYSTCNVRGTSVLLAEGHGLTKLVSQQ 797
           T  DK A  +L ALLG++   PEY+T       FY+ C ++G  + + EG G +K +SQ 
Sbjct: 673 TRYDKEASEKLYALLGKSNMCPEYETTNEG-DGFYTVCRIKGMGITIGEGSGRSKKISQH 731

Query: 798 IAAENAMFNSSIDEFL 813
           IAA NA+ N  + + L
Sbjct: 732 IAAGNALRNKEVKKLL 747

>NDAI0G01400 Chr7 complement(312005..314056) [2052 bp, 683 aa] {ON}
          Length = 683

 Score =  175 bits (444), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 112/329 (34%), Positives = 172/329 (52%), Gaps = 25/329 (7%)

Query: 6   TPKE--NIALKKFTKIQNACTELRNSMEIIYENALTEDELTSLTT-GSEIEKFIAFTPAC 62
           TP E  N +L +F K+QNAC +L  +++ IY   LT +ELT +   G+  EK IA +PA 
Sbjct: 16  TPIESTNDSLNRFYKVQNACAQLETAIKTIYSEGLTNEELTYMVNDGTAQEKLIASSPAS 75

Query: 63  MISTYLANARSSVDIVKICDYYKFDENIWSSTALIKEPIITNPILEFLVLAHKKLQKSNT 122
            I TYL NA++S+DI KI +YY++D         IKEPIIT+  L+   LA   +    T
Sbjct: 76  FIGTYLKNAQASLDISKIFEYYQYDSESSPLDNYIKEPIITDTNLQ--KLASSTVSNGIT 133

Query: 123 AKNNELLQFVGDSWLKSLIASILYKKFPHASAKALEKLKSDLLTNETLDLWSANNRLLKS 182
           + +   L+++G +W+ +LI+ +L+ +FP+A+ K LE L   +L N+  D W  +      
Sbjct: 134 SIDRNRLEYLGANWMNALISIVLFNQFPNANKKGLENLHDQIL-NDKQD-WIKSTTF--- 188

Query: 183 LPDLVTKMHPNASEEEVLNYRRSCFKAYIGALILDRSHHELNDVVSWLSSLCETRVGILK 242
                            +N+      +Y GALI DRS  + ND++ WLS   + ++  +K
Sbjct: 189 ---------------NTMNHNNENLNSYFGALIFDRSIPQFNDILKWLSISTKDKLNSIK 233

Query: 243 AQNLRGLYAKNLKEQLVQFMEGNKSEKPLKFITTHIGASHSCKVVIGSTVLGTARGVTAV 302
              L  + AK  KE L++FM+ NK    L+FI   + +    +V +G+  LG        
Sbjct: 234 YNYLIDVNAKTPKEALIEFMKDNKDGLKLRFIRLTVNSPFIIEVKLGNVSLGKGEDNVIE 293

Query: 303 EAERKAASIVLGNVELLTKYTVYSDSVPI 331
            AE+KAA   L   EL+  Y+ Y    PI
Sbjct: 294 IAEQKAAQDALSKPELIENYSKYPIVSPI 322

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 52/80 (65%)

Query: 736 VHTSCDKTAMGRLQALLGEAGFIPEYKTRMLAPSHFYSTCNVRGTSVLLAEGHGLTKLVS 795
           V   CDK++   L A+LG+    PEYKT  +  + FYS C +RGT+++L EG G  K +S
Sbjct: 602 VEVECDKSSKASLYAILGKVNLFPEYKTSQIDMNDFYSFCILRGTAIILGEGRGSNKQIS 661

Query: 796 QQIAAENAMFNSSIDEFLED 815
           QQIAAE+A+   ++ E LE+
Sbjct: 662 QQIAAEHAIEGEALAELLEE 681

>KNAG0D05350 Chr4 complement(978518..980503) [1986 bp, 661 aa] {ON} 
          Length = 661

 Score =  166 bits (420), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 97/339 (28%), Positives = 174/339 (51%), Gaps = 22/339 (6%)

Query: 6   TPKENIALKKFTKIQNACTELRNSMEIIYENALTEDELTSL--TTGSEIEKFIAFTPACM 63
           +P +N+  ++F K+Q+AC  L  +   +YE +    EL ++   +G  + + IA +PA  
Sbjct: 23  SPADNV--RRFFKLQSACAALLEAARTVYECSFPTGELKTMGSKSGDPLSEAIAASPAAQ 80

Query: 64  ISTYLANARSSVDIVKICDYYKFDENIWSSTALIKEPIITNPILEFLVLAHKKLQKSN-- 121
           I +YL   R ++D+  + + ++FD N       I+ P++++  LE L   H+     N  
Sbjct: 81  IGSYLVENREALDLEHMFEVFRFDANESPVHCFIQYPVVSDAQLENLAFVHRSFPNMNVH 140

Query: 122 ------TAKNNELLQFVGDSWLKSLIASILYKKFPHASAKALEKLKSDLLTNETLDLWSA 175
                 T  +NE L+F+GDSWL +++A  LYKK+P+A+  AL ++KS ++ N  L+   +
Sbjct: 141 LSAAERTVMSNERLEFLGDSWLGAIVAYFLYKKYPYANEGALSRMKSAIVNNNNLEKICS 200

Query: 176 N----NRLLKSLPDLVTKMHPNASEEEVLNYRRSCFKAYIGALILDRSHHELNDVVSWLS 231
                 RL  ++P    K+  + S+     Y     +AYIGA ++DR   E  ++  W+ 
Sbjct: 201 RLGFKQRLRANVPGYKMKIRDSFSK-----YHADVVEAYIGAFVVDRFKTEFQELADWIE 255

Query: 232 SLCETRVGILKAQNLRGLYAKNLKEQLVQFMEGNKSEKPLKFITTHIGASHSCKVVIGST 291
            L E ++ +   + L     KN K +L + ++ NK+   L +      +    + ++G+ 
Sbjct: 256 KLSEEQLQLFGPEMLNTPLNKNAKGELAELLQFNKTGGKLTYRRMTQTSPFKVQALLGNI 315

Query: 292 VLGTARGVTAVEAERKAASIVLGNVELLTKYTVYSDSVP 330
           VL    G    +AER+AA   L   EL+ KY+++ D VP
Sbjct: 316 VLSEGSGANVKDAERRAAMAALDKPELIAKYSLF-DIVP 353

 Score = 39.7 bits (91), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%)

Query: 748 LQALLGEAGFIPEYKTRMLAPSHFYSTCNVRGTSVLLAEGHGLTKLVSQQI 798
           L  LL +    P+YK    A   F + C V+GT+++L EG G TK  ++Q+
Sbjct: 595 LYTLLNQHHRFPDYKILPTADGGFKARCFVKGTAIMLGEGTGRTKKEAKQV 645

 Score = 32.3 bits (72), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 615 AKAQVYGAVGRLNMFPEYVTVQLGVNDFYSCCSIKGEPDSLMGEGRGFSKKIAEQV 670
           A   +Y  + + + FP+Y  +      F + C +KG    ++GEG G +KK A+QV
Sbjct: 591 AARDLYTLLNQHHRFPDYKILPTADGGFKARCFVKGTA-IMLGEGTGRTKKEAKQV 645

>TDEL0B00490 Chr2 complement(86668..88755) [2088 bp, 695 aa] {ON} 
          Length = 695

 Score =  164 bits (415), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 94/326 (28%), Positives = 171/326 (52%), Gaps = 20/326 (6%)

Query: 13  LKKFTKIQNACTELRNSMEIIYENALTEDELTSLTTGS-EIEKFIAFTPACMISTYLANA 71
           L++++K+++AC  L+ ++++I ENAL  +E++ L+    E+E+ IA +PA ++S Y+   
Sbjct: 17  LRRYSKLRSACNALQEAVKVINENALNAEEISQLSKSDIELERAIADSPAILVSKYINEV 76

Query: 72  RSSVDIVKICDYYKFDENIWSSTALIKEPIITNPILEFLVLAHKKLQKSNT--------A 123
                I  +  +YKF+E   +   ++K P+++N  LE L   H+     N          
Sbjct: 77  H--YGISNVFQHYKFEEGAPNVDRVVKYPVVSNAYLENLAFLHRSCSSMNVHVTEVDRAV 134

Query: 124 KNNELLQFVGDSWLKSLIASILYKKFPHASAKALEKLKSDLLTNETLDLWSA----NNRL 179
             NE L+F+GDSWL + ++  LYKK+P+A+  +L K++S ++ N  L  W      + RL
Sbjct: 135 ATNERLEFLGDSWLGAFVSYTLYKKYPYANEGSLSKMRSAIVNNVNLAKWCKQVGFDERL 194

Query: 180 LKSLPDLVTKMHPNASEEEVLNYRRSCFKAYIGALILDRSHHELNDVVSWLSSLCETRVG 239
             ++P +V K+    S+     Y   CF+AY+GAL++D+   E  ++V W+  L E    
Sbjct: 195 RGNIPKMVNKLKDMTSK-----YHADCFEAYVGALVVDKYSIEFGEIVDWIEDLSEEVFR 249

Query: 240 ILKAQNLRGLYAKNLKEQLVQFMEGNKSEKPLKFITTHIGASHSCKVVIGSTVLGTARGV 299
            +  + ++    KN K +L   +  NK    L++   +  +    +V +G   L T  G 
Sbjct: 250 EMGTKMIKEPMNKNAKHELATLLTCNKVGAKLEYQRLNSTSPFKVEVKLGDISLATGEGS 309

Query: 300 TAVEAERKAASIVLGNVELLTKYTVY 325
           +  EAE++AA   L +   +  Y+ Y
Sbjct: 310 SIKEAEQRAAMKALLDTSKIKTYSFY 335

 Score = 52.0 bits (123), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 42/75 (56%)

Query: 741 DKTAMGRLQALLGEAGFIPEYKTRMLAPSHFYSTCNVRGTSVLLAEGHGLTKLVSQQIAA 800
           D ++   L A LG+ GF P Y+T+      F S C ++G +++L  G   +K  ++QIAA
Sbjct: 598 DASSKQELYAYLGQRGFRPYYETKSEGLQSFSSDCMIQGFNIILGSGRASSKKQAEQIAA 657

Query: 801 ENAMFNSSIDEFLED 815
                + S+ EFLE+
Sbjct: 658 YFGFRSESLKEFLEN 672

 Score = 48.1 bits (113), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 51/109 (46%), Gaps = 2/109 (1%)

Query: 571 SAETNDHQSPVVSRQYEHAAEHPQSNASLTGASKLPLQHQFDKTAKAQVYGAVGRLNMFP 630
           S++T   Q PV       A   P    S   A      H  D ++K ++Y  +G+    P
Sbjct: 558 SSQTAARQYPVALSDSPVAYNKPAEGVSAQAAGHSDQLH-VDASSKQELYAYLGQRGFRP 616

Query: 631 EYVTVQLGVNDFYSCCSIKGEPDSLMGEGRGFSKKIAEQVAAGAALQSD 679
            Y T   G+  F S C I+G  + ++G GR  SKK AEQ+AA    +S+
Sbjct: 617 YYETKSEGLQSFSSDCMIQGF-NIILGSGRASSKKQAEQIAAYFGFRSE 664

>NDAI0K00140 Chr11 (18609..20546) [1938 bp, 645 aa] {ON} 
          Length = 645

 Score =  163 bits (413), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 109/344 (31%), Positives = 173/344 (50%), Gaps = 20/344 (5%)

Query: 13  LKKFTKIQNACTELRNSMEIIYENALTEDELTSLT-TGSEIEKFIAFTPACMISTYLANA 71
           L+ F K+QNAC  L  S+++IYE + + +E   +T  G+ +E+ IA +PA  ++ YL N 
Sbjct: 20  LRNFYKLQNACATLNESIKVIYEYSPSFEEREYMTRNGNPLEQTIANSPAVHVANYLTNM 79

Query: 72  RSSVDIVKICDYYKFDENIWSSTALIKEPIITNPILEFLVLAHKKLQKSN--------TA 123
           R+S D+  I   + F+         I  P+ T+P LE L   HK L   N        T 
Sbjct: 80  RNSFDLEAIFKAHHFENGKSPVDKFISYPVCTDPNLEHLAFIHKSLPNMNVRLTELQKTI 139

Query: 124 KNNELLQFVGDSWLKSLIASILYKKFPHASAKALEKLKSDLLTNETLDLWSAN----NRL 179
            +NE L+F+GDSWL + IA I+YKK+P+A+  AL K+K  ++ N  L+  S       RL
Sbjct: 140 MSNERLEFLGDSWLGAFIAFIIYKKYPYANEGALSKMKDAIVNNNNLEKLSEKLGFKERL 199

Query: 180 LKSLPDLVTKMHPNASEEEVLNYRRSCFKAYIGALILDRSHHELNDVVSWLSSLCETRVG 239
            +++P    K+     ++ +  +   C +AYIGAL++DR   E  DV  WL  L      
Sbjct: 200 KENIPRSSMKI-----KDRLTKHYADCVEAYIGALVVDRFATEFKDVSDWLEELSTEHFE 254

Query: 240 ILKAQNLRGLYAKNLKEQLVQFMEGNKSEKPLKFITTHIGASHSCKVVIGSTVLGTARGV 299
            L     R    +N K +L + ++ N     + +      +  S +V +G   LG   G 
Sbjct: 255 NLGPLMFREPLNRNAKGELGELLQFNNIGAKINYTKLTENSPFSVEVYLGDIFLGKGDGP 314

Query: 300 TAVEAERKAASIVLGNVELLTKYTVYSDSVPIYQKPLASNNSEN 343
              EAE++AA   L +  L+ KY+ Y   + + +K L  +N+ N
Sbjct: 315 NIREAEQRAAMAALADHALIQKYSSY--DIEVDKKYLGGSNASN 356

 Score = 55.5 bits (132), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 33/54 (61%)

Query: 739 SCDKTAMGRLQALLGEAGFIPEYKTRMLAPSHFYSTCNVRGTSVLLAEGHGLTK 792
           S DK A G+L A+LG+ G  PEY    L+  HF +TCN++G  + L  G G +K
Sbjct: 585 SYDKEASGKLYAMLGKIGLYPEYIIEQLSIDHFVATCNLKGLGIHLGTGEGRSK 638

 Score = 48.1 bits (113), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 34/54 (62%), Gaps = 1/54 (1%)

Query: 611 FDKTAKAQVYGAVGRLNMFPEYVTVQLGVNDFYSCCSIKGEPDSLMGEGRGFSK 664
           +DK A  ++Y  +G++ ++PEY+  QL ++ F + C++KG    L G G G SK
Sbjct: 586 YDKEASGKLYAMLGKIGLYPEYIIEQLSIDHFVATCNLKGLGIHL-GTGEGRSK 638

>TBLA0C06260 Chr3 (1515789..1518101) [2313 bp, 770 aa] {ON} 
          Length = 770

 Score =  162 bits (410), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 105/339 (30%), Positives = 171/339 (50%), Gaps = 28/339 (8%)

Query: 4   CMTPKENIALKKFTKIQNACTELRNSMEIIYENALTEDELTSL-TTGSEIEKFIA----F 58
            +T K+   L+ F K++ A      SM+II E AL +  L  + T G+ ++K I      
Sbjct: 8   ALTQKDATTLRNFYKLRRAINGFSESMKIIDELALDDYTLMDMKTNGNSLQKLIGSSATM 67

Query: 59  TPACMISTYLANARSSVDIVKICDYYKFDENIWSSTALIKEPIITNPILEFLVLAHKKLQ 118
             A +I + + + R   DI++ C+Y   DE        I+ PI++NP LE L   H+   
Sbjct: 68  DTASLIKSLIPSLR---DIIRECNY---DEQKNELGQYIRYPIVSNPELEHLAFIHRSYT 121

Query: 119 KSNT--------AKNNELLQFVGDSWLKSLIASILYKKFPHASAKALEKLKSDLLTNETL 170
             N           +NE L+F+GDSWL +L++ I+Y K+P A+  AL K+K  ++ N  L
Sbjct: 122 SMNVNLTEEQKIIMSNERLEFLGDSWLGALVSYIIYVKYPTANEGALSKMKEAIVNNINL 181

Query: 171 DLWSAN----NRLLKSLPDLVTKMHPNASEEEVLNYRRSCFKAYIGALILDRSHHELNDV 226
             WS      +RL  ++P    K+    S+         C +AYIGAL++DR   E  D+
Sbjct: 182 YEWSGQLGFRDRLQNNIPAASMKVKDKLSKRYA-----DCVEAYIGALVVDRYGSEYKDL 236

Query: 227 VSWLSSLCETRVGILKAQNLRGLYAKNLKEQLVQFMEGNKSEKPLKFITTHIGASHSCKV 286
             WL SL + ++  +    LR  + KN K +L  +++ NK    + ++  +       + 
Sbjct: 237 TDWLYSLSQDKLDEISPGLLRYDFNKNAKGELASYLQANKLGAKVHYVRLNDSTPFRAQA 296

Query: 287 VIGSTVLGTARGVTAVEAERKAASIVLGNVELLTKYTVY 325
           ++G  VLG A G  A EAE++AA + L N EL+ +Y+ +
Sbjct: 297 LLGDIVLGEAVGHNAREAEQRAAMVALSNRELIQQYSSF 335

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 49/92 (53%), Gaps = 2/92 (2%)

Query: 588 HAAEHPQSNASLTGASKLPLQHQFDKTAKAQVYGAVGRLNMFPEYVTVQLGVNDFYSCCS 647
           H   + Q+N S  G     ++   D  A   +Y A+ +  ++P+Y +++     F S C+
Sbjct: 670 HTIPYQQNNLSDNGNMNSTVKIPSDNNAMEVLYKALTKEQLYPDY-SIEDHAKGFLSVCT 728

Query: 648 IKGEPDSLMGEGRGFSKKIAEQVAAGAALQSD 679
           +KG   + +GEG G +KK+A+  AA  A++ +
Sbjct: 729 VKG-VGTYLGEGFGRNKKLAKHHAAQDAIRKN 759

 Score = 36.6 bits (83), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 31/69 (44%), Gaps = 1/69 (1%)

Query: 736 VHTSCDKTAMGRLQALLGEAGFIPEYKTRMLAPSHFYSTCNVRGTSVLLAEGHGLTKLVS 795
           V    D  AM  L   L +    P+Y     A   F S C V+G    L EG G  K ++
Sbjct: 689 VKIPSDNNAMEVLYKALTKEQLYPDYSIEDHAKG-FLSVCTVKGVGTYLGEGFGRNKKLA 747

Query: 796 QQIAAENAM 804
           +  AA++A+
Sbjct: 748 KHHAAQDAI 756

>TPHA0C04990 Chr3 complement(1075250..1076971) [1722 bp, 573 aa]
           {ON} 
          Length = 573

 Score =  154 bits (389), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 107/360 (29%), Positives = 183/360 (50%), Gaps = 34/360 (9%)

Query: 13  LKKFTKIQNACTELRNSMEIIYENALTEDELTSL-TTGSEIEKFIAFTPACMISTYLANA 71
           ++ F K++NAC +L+ +++ IYE   TED+L  L  +  E++  IA +    I++ +   
Sbjct: 25  IRNFYKVKNACIKLKEAIDCIYELGCTEDDLKVLFNSNDEMDNIIASSSTMNITSEIHKV 84

Query: 72  RSSVDIVKICDYYKFDENIWSSTALIKEPIITNPILEFLVLAHKKLQKSNT--------A 123
           R  +D V + D ++F+E        I  P++ +  L+ L   HK +   N          
Sbjct: 85  RPKMDFVTLFDNFEFNEKKSELDRYINYPVVYDEQLDNLAFIHKSIPNMNNNLDITSQKV 144

Query: 124 KNNELLQFVGDSWLKSLIASILYKKFPHASAKALEKLKSDLLTNETLDLWSANNRLLKSL 183
            +NE L+F+GDSWL S++A I+Y K+P+A    L  +K+ +++N+ L  WS   RL    
Sbjct: 145 LSNERLEFLGDSWLGSIVAYIVYNKYPNADEGLLTNIKAAIVSNQNLYEWSL--RL---- 198

Query: 184 PDLVTKMHPNASEEEVL-----NYRRS-CFKAYIGALILDRSHHELNDVVSWLSSLCETR 237
            +   +++ N S+   L     N R + C +AYIGAL++DR + E  DV  W+  L   +
Sbjct: 199 -NFDARLNSNISKSTKLVKGKSNKRYADCVEAYIGALVVDRFNTEFLDVKEWIEELAHEQ 257

Query: 238 VGILKAQNLRGLYAKNLKEQLVQFMEGNKSEKPLKFITTHIGASHSCKVVIGSTVLGTAR 297
           +   K+++ +    KN K +L   ++ NK    L +   +  +    +V +G   L TA 
Sbjct: 258 LEAFKSESNKIPINKNAKYELASLLQVNKLGASLNYKRLNNSSPFKIEVRLGDMALATAE 317

Query: 298 GVTAVEAERKAASIVLGNVELLTKYTVY-----------SDS-VPIYQKPLASNNSENSE 345
           G    E E++AA  VL + +LL KY+VY           +DS +P+  KP  +   E+ E
Sbjct: 318 GQNVKEGEQRAAMKVLADNKLLLKYSVYDFVDNPNYNTINDSNIPVISKPQGTRYMEDVE 377

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 48/92 (52%), Gaps = 4/92 (4%)

Query: 588 HAAEHPQSNASLTGASKLPLQ---HQFDKTAKAQVYGAVGRLNMFPEYVTVQLGVNDFYS 644
           H +  P++        KL  +      D  AK ++Y  + R ++FP YVT Q  ++ F S
Sbjct: 466 HGSRKPENTVGKNQKEKLKFETVPKTCDIKAKEKLYCMLSREHVFPTYVTEQRTLDTFSS 525

Query: 645 CCSIKGEPDSLMGEGRGFSKKIAEQVAAGAAL 676
            C I+G    ++GEG G SKKI+E  +A  AL
Sbjct: 526 KCIIQG-SGKVLGEGIGRSKKISEHRSASDAL 556

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 42/80 (52%)

Query: 736 VHTSCDKTAMGRLQALLGEAGFIPEYKTRMLAPSHFYSTCNVRGTSVLLAEGHGLTKLVS 795
           V  +CD  A  +L  +L      P Y T       F S C ++G+  +L EG G +K +S
Sbjct: 488 VPKTCDIKAKEKLYCMLSREHVFPTYVTEQRTLDTFSSKCIIQGSGKVLGEGIGRSKKIS 547

Query: 796 QQIAAENAMFNSSIDEFLED 815
           +  +A +A+  S++ +F+++
Sbjct: 548 EHRSASDALNGSALKKFMQE 567

>Kpol_455.11 s455 complement(14820..16496) [1677 bp, 558 aa] {ON}
           complement(14820..16496) [1677 nt, 559 aa]
          Length = 558

 Score =  153 bits (387), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 101/326 (30%), Positives = 164/326 (50%), Gaps = 13/326 (3%)

Query: 11  IALKKFTKIQNACTELRNSMEIIYENALTEDE--LTSLTTGSEIEKFIAFTPACMISTYL 68
           + +++F ++ NAC +L+ S+++IYEN L  D+  L   T  + I+  I  TP   ++  L
Sbjct: 18  LKVREFYRLHNACVKLKESIKLIYENPLVTDQNVLNLGTAENTIDYTILNTPTLNVAKTL 77

Query: 69  ANARSSVDIVKICDYYKFDENIWSSTALIKEPIITNPILEFLVLAHKKLQKSN------- 121
              R S+D++ +   + F ++       IK P++ +  LE L   HK     N       
Sbjct: 78  LGNRYSLDLIDLFQSHDFKDSNTDVDMFIKYPVVYDENLENLAFMHKSFPNMNAHLNDAQ 137

Query: 122 -TAKNNELLQFVGDSWLKSLIASILYKKFPHASAKALEKLKSDLLTNETLDLWSANNRLL 180
            T  +NE L+F+GDSWL +L++ I+Y +FP A+   L ++K  ++ N  L  WS      
Sbjct: 138 KTQLSNERLEFLGDSWLGALVSYIVYTRFPSANEGMLSQMKESIVNNNNLFDWSTKLNFT 197

Query: 181 KSLPDLVTKMHPNASEEEVLNYRRS-CFKAYIGALILDRSHHELNDVVSWLSSLCETRVG 239
           K L   +    P    ++ ++ R + C +AYIGAL++DR   E  D+  WL  L E ++ 
Sbjct: 198 KRLQGNIAT--PTRVVKDKMSKRYADCVEAYIGALVIDRFGTEFLDIKEWLEELSEKKLA 255

Query: 240 ILKAQNLRGLYAKNLKEQLVQFMEGNKSEKPLKFITTHIGASHSCKVVIGSTVLGTARGV 299
                 ++    KN K +L + ++ NK    L +           +V IG  +L  A G 
Sbjct: 256 KSSQMVIKEPLNKNAKNELAELLQINKLGHKLHYRKLTEMPPFRVEVKIGDILLDEAEGN 315

Query: 300 TAVEAERKAASIVLGNVELLTKYTVY 325
           +  EAE +AA  VL N ELL KY+VY
Sbjct: 316 SIREAEHRAAMKVLENDELLRKYSVY 341

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 46/79 (58%), Gaps = 3/79 (3%)

Query: 600 TGASKLPLQHQFDKTAKAQVYGAVGRLNMFPEYVTVQLGVNDFYSCCSIKGEPDSLMGEG 659
           T A K P+    D  AK  +Y  + R  +FP+Y  VQ  +++F + C IKG     +  G
Sbjct: 470 TSADKAPIT--CDPNAKQALYTLLSRSQVFPDYEMVQHSMDNFTANCIIKGS-GIFLASG 526

Query: 660 RGFSKKIAEQVAAGAALQS 678
           RG SKKIA+Q AA AAL+S
Sbjct: 527 RGRSKKIAQQNAASAALRS 545

 Score = 48.5 bits (114), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 41/77 (53%)

Query: 739 SCDKTAMGRLQALLGEAGFIPEYKTRMLAPSHFYSTCNVRGTSVLLAEGHGLTKLVSQQI 798
           +CD  A   L  LL  +   P+Y+    +  +F + C ++G+ + LA G G +K ++QQ 
Sbjct: 478 TCDPNAKQALYTLLSRSQVFPDYEMVQHSMDNFTANCIIKGSGIFLASGRGRSKKIAQQN 537

Query: 799 AAENAMFNSSIDEFLED 815
           AA  A+ +  +   LE+
Sbjct: 538 AASAALRSPILKSILEE 554

>KAFR0D00130 Chr4 complement(10547..12334) [1788 bp, 595 aa] {ON}
           possible pseudogene; NNN added to avoid internal stop
           codon
          Length = 595

 Score =  141 bits (356), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 98/351 (27%), Positives = 173/351 (49%), Gaps = 61/351 (17%)

Query: 63  MISTYLANARSSVDIVKICDYYKFDENIWSSTALIKEPIITNPILEFLVLAHKKLQKSNT 122
           MIS+Y +N R+S+D  +I  YY FD N+ +       PIIT+  LE ++  H+       
Sbjct: 1   MISSYFSNLRASIDFNQIFAYYNFDSNLHNPYNDF--PIITSTYLEAMIPLHR------- 51

Query: 123 AKNNELLQFVGDSWLKSLIASILYKKFPHASAKALEKLKSDLLTNETLDLWSANNRLLKS 182
               E L+FVG+ WL +L++ IL  +F  +    LEKL++ +L+NE L++  +  RL + 
Sbjct: 52  ----ENLEFVGEKWLSALLSRILCHRFSFSKQNTLEKLENAMLSNEALNVLLSKIRLPEK 107

Query: 183 LPDLVTKMHPNASEEEVLNYRRSCFKAYIGALILDRSHHELNDVVSWLSSLCETRVGILK 242
             ++                    FKAYIGAL+ D     +  +++WL+ + + ++  LK
Sbjct: 108 FNNI------------------EGFKAYIGALVQDEDGPAMKTIITWLAEVRDAQLTQLK 149

Query: 243 AQNLRGLYAKNLKEQLVQFMEGNKSEKPLKFITTHIGASHSCKVVIGSTVLGTAR-GVTA 301
             NL+ LY  + K+QL++ +E NKS   + FI+ +IG  +   V +G T+L       T 
Sbjct: 150 NANLKVLYPSDYKQQLIELLENNKSNHEVSFISKNIGGKYVSSVHLGDTILSIGDPSNTT 209

Query: 302 VEAERKAASIVLGNVELLTKYTVYSDSVPIYQKPLASNNSENSEEKAVIXXXXXXXXXXX 361
            E E   +  VL +  LL+K++++S      + P    ++ N+                 
Sbjct: 210 QETEHNVSKKVLNDQVLLSKHSIFSTVDSAEKTPNNLVSTANT----------------- 252

Query: 362 XXXXRAKIFSPIDDEKLTEHILSKLSERLESMVSEITLKILQEKNISSPDN 412
                       D E LT  I+  ++E++ S+VS+IT ++L +  I++ ++
Sbjct: 253 ------------DPELLTRKIMESVNEKVASIVSQITAEMLHKSPITAKND 291

 Score = 86.7 bits (213), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 54/78 (69%)

Query: 605 LPLQHQFDKTAKAQVYGAVGRLNMFPEYVTVQLGVNDFYSCCSIKGEPDSLMGEGRGFSK 664
           +P++   DK AK  +Y  +G  N FPEYVT+QLG+NDF+S  ++K  PD  +G GR  +K
Sbjct: 470 IPIKSVCDKLAKFNLYKELGVRNHFPEYVTIQLGLNDFFSTVTVKHVPDLTLGRGRRTNK 529

Query: 665 KIAEQVAAGAALQSDKWR 682
           KI EQVAA  ALQ+ K++
Sbjct: 530 KIDEQVAASDALQNKKYK 547

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 35/72 (48%), Gaps = 1/72 (1%)

Query: 736 VHTSCDKTAMGRLQALLGEAGFIPEYKTRMLAPSHFYSTCNVRGTSVL-LAEGHGLTKLV 794
           + + CDK A   L   LG     PEY T  L  + F+ST  V+    L L  G    K +
Sbjct: 472 IKSVCDKLAKFNLYKELGVRNHFPEYVTIQLGLNDFFSTVTVKHVPDLTLGRGRRTNKKI 531

Query: 795 SQQIAAENAMFN 806
            +Q+AA +A+ N
Sbjct: 532 DEQVAASDALQN 543

>KAFR0A03050 Chr1 complement(623884..625452) [1569 bp, 522 aa] {ON} 
          Length = 522

 Score =  121 bits (303), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 81/283 (28%), Positives = 148/283 (52%), Gaps = 22/283 (7%)

Query: 63  MISTYLANARSSVDIVKICDYYKFDENIWSSTALIKEPIITNPILEFLVLAHKKLQKSNT 122
           + + ++ NARS  D+ +I   Y+FDEN       I+ P++T+  LE L   HK    SN 
Sbjct: 27  LAANHVKNARSVFDMGEIFKKYEFDENSSPLGGHIEYPVVTDAPLEVLAFIHKSFINSNV 86

Query: 123 --------AKNNELLQFVGDSWLKSLIASILYKKFPHASAKALEKLKSDLLTNETLD-LW 173
                   A  NE LQFVG++WL +L++ +LY+K+P+ +   L ++K  ++ N  L+ L+
Sbjct: 87  NLTEEQRIAMCNERLQFVGENWLNALVSYVLYRKYPYTNEATLTRMKQCIINNSNLERLY 146

Query: 174 SA---NNRLLKSLPDLVTKMHPNASEEEVLNYRRSCFKAYIGALILDRSHHELNDVVSWL 230
                  +LL+++P        N  E++   Y   C +AYIGAL +DR   +  ++ +W+
Sbjct: 147 EKLGFKEKLLENIPPAAL----NKKEKKEKQY-AGCMEAYIGALAVDRFGVDFEELANWI 201

Query: 231 SSLCETRVGILKAQNLRGLYAKNLKEQLVQFMEGNKSEKPLKFITTHIGASHSCKVVIGS 290
             L    + + +   L+ +  KN K +L + ++ N  +K + +      + ++ +V +G 
Sbjct: 202 EELSNEHL-VDETSQLQSV-NKNAKNELAKILQFNVLQKKISYRILSKNSPYNVRVELGE 259

Query: 291 TVLGTARGVTAVEAERKAASIVLGNVEL---LTKYTVYSDSVP 330
            +LG   G+   +AE++AA   L N EL   L+ + + ++S P
Sbjct: 260 YILGEGTGIDIKDAEQRAAMDALSNFELLEQLSSHEISNESTP 302

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 47/77 (61%), Gaps = 2/77 (2%)

Query: 602 ASKLPLQHQFDKTAKAQVYGAVGRLNMFPEYVTVQLGVNDFYSCCSIKGEPDSLMGEGRG 661
           +SK   QH +DK A ++++  + + + +PEY+  +    +F++ C I G   + + EG G
Sbjct: 438 SSKKGAQH-YDKEASSKLHTLLAKCDCYPEYLVEETDSGEFHTTCRIMG-VGTFLSEGTG 495

Query: 662 FSKKIAEQVAAGAALQS 678
            SKKIA+  AA +ALQS
Sbjct: 496 RSKKIAQHNAAASALQS 512

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 38/73 (52%)

Query: 741 DKTAMGRLQALLGEAGFIPEYKTRMLAPSHFYSTCNVRGTSVLLAEGHGLTKLVSQQIAA 800
           DK A  +L  LL +    PEY         F++TC + G    L+EG G +K ++Q  AA
Sbjct: 447 DKEASSKLHTLLAKCDCYPEYLVEETDSGEFHTTCRIMGVGTFLSEGTGRSKKIAQHNAA 506

Query: 801 ENAMFNSSIDEFL 813
            +A+ + ++ + L
Sbjct: 507 ASALQSKNLKKIL 519

>KLLA0F24816g Chr6 (2308342..2309778) [1437 bp, 478 aa] {ON} similar
           to uniprot|Q02555 Saccharomyces cerevisiae YMR239C RNT1
           RNAase III cleaves a stem-loop structure at the 3' end
           of U2 snRNA to ensure formation of the correct U2 3' end
          Length = 478

 Score = 89.7 bits (221), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 78/269 (28%), Positives = 117/269 (43%), Gaps = 25/269 (9%)

Query: 98  KEPIITNPILEFLVLAHKKL--------QKSNTAKNNELLQFVGDSWLKSLIASILYKKF 149
           K P I NP++   V  HK +         +     +NE L+F+GDS L + + +I+Y KF
Sbjct: 194 KLPKIKNPVIRARVFIHKSMINDKLYLTDQEIIRSHNERLEFLGDSILNTTMTTIIYNKF 253

Query: 150 PHASAKALEKLKSDLLTNETLDLWSANNRLLKSLPDLVTKMH---PNASEEEVLNYRRSC 206
           PH     L +L+  L+ NE L  WS     L   PD + K H   P+ +++         
Sbjct: 254 PHFDEGQLSQLRMRLINNELLKEWS----FLYKFPDEL-KTHNVKPDDNKDGKQKLYADV 308

Query: 207 FKAYIGALILDRSHHELNDVVSWLSSLCETRVG-------ILKAQNLRGLYAKNLKEQLV 259
           F+AYIG L+ D     L  +  WL+ L E  +         L+      + AK     L+
Sbjct: 309 FEAYIGGLVEDNGKKNLPKIRKWLAKLAEPVISKGLNSDITLENTTEVDVNAKKTLYSLI 368

Query: 260 QFMEGNKSEKPL-KFITTHIGASHSCKVVIGSTVLGTARGVTAVEAERKAASIVLGNVEL 318
            +   N    P+ K  +T   A   C++  G  VLG   G     A  +AA  VL N EL
Sbjct: 369 GYAALNLHYYPVHKPTSTDPNAIVECRIT-GGKVLGRGVGKNIKIAGMRAAEDVLNNKEL 427

Query: 319 LTKYTVYSDSVPIYQKPLASNNSENSEEK 347
           + KY     S+P  +  + +NN    + K
Sbjct: 428 IEKYVSLRASLPKSESVIKANNDNTKKRK 456

>TPHA0I00710 Chr9 (143903..145363) [1461 bp, 486 aa] {ON} Anc_8.779
           YMR239C
          Length = 486

 Score = 89.0 bits (219), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 83/262 (31%), Positives = 117/262 (44%), Gaps = 42/262 (16%)

Query: 98  KEPIITNPILEFLVLAHKKLQKSN--------TAKNNELLQFVGDSWLKSLIASILYKKF 149
           K P I NP +   V  HK + K             +NE L+F+GDS L ++I  ILY KF
Sbjct: 199 KIPEIKNPAIRAKVFTHKSIVKDKLYLKETEMVNTHNERLEFLGDSILNTVITMILYNKF 258

Query: 150 PHASAKALEKLKSDLLTNETLDLWSANNRLLKSLP-DLVTKMHPNASEEEVLNYRRS--- 205
           P  S   L  L+  L++NE +  WS     L  LP +L T +    +E++ LN+      
Sbjct: 259 PTFSEGQLSSLRRHLVSNECIKKWS----YLYDLPGNLKTNLE---TEQDKLNFHYGHKK 311

Query: 206 ----CFKAYIGALILDRSHHELNDVVSWLSSLCETRVGILKAQNLR-------GLYAKNL 254
                F+AYIG LI D   H +  V  WLS L +  +  L  +++         L AK  
Sbjct: 312 IHADVFEAYIGGLIEDDPKHNMPKVRKWLSKLAKPIIDELTKKDISLQQPDNLNLNAKKE 371

Query: 255 KEQLVQFMEGNKSEKPLKFITTHIGASHSCKVVI------GSTVLGTARGVTAVEAERKA 308
              L+ +   N     L + TT   AS+   + I        TVLGT +G  A  A   A
Sbjct: 372 LYSLIGYASLN-----LHYETTK-KASYDSPICIVQCITGDGTVLGTGKGRNAKMAGINA 425

Query: 309 ASIVLGNVELLTKYTVYSDSVP 330
           A  VL N EL+ +Y     ++P
Sbjct: 426 AQNVLDNRELVEEYAKRRAAIP 447

>SAKL0B05566g Chr2 complement(482433..483950) [1518 bp, 505 aa] {ON}
           similar to uniprot|Q02555 Saccharomyces cerevisiae
           YMR239C RNT1 RNAase III cleaves a stem-loop structure at
           the 3' end of U2 snRNA to ensure formation of the
           correct U2 3' end
          Length = 505

 Score = 85.5 bits (210), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 81/259 (31%), Positives = 118/259 (45%), Gaps = 24/259 (9%)

Query: 92  SSTALIKEPIITNPILEFLVLAHKK-------LQKSNTAK-NNELLQFVGDSWLKSLIAS 143
           SST   K P I N  +   V  HK        L +S+  K +NE L+F+GDS L + I  
Sbjct: 186 SSTWPPKLPEIKNSAIRARVFIHKSMINDKLYLSESDMIKAHNERLEFLGDSILNTTITM 245

Query: 144 ILYKKFPHASAKALEKLKSDLLTNETLDLWS----ANNRLLKSLPDLVTKMHPNASEEEV 199
           ILY +FPH S   L +L+  L++NE L  WS     N +L  +L +    +     ++++
Sbjct: 246 ILYNRFPHFSEGQLSQLRMKLISNERLKKWSFMYRFNEKLKTNLDNKPENVEFQLGKQKL 305

Query: 200 LNYRRSCFKAYIGALILDRSHHELNDVVSWLSSLCETRVGILKAQNLR-------GLYAK 252
                  F+AYIG LI D     L  V  WLS L +  +  +  + +         + AK
Sbjct: 306 F---ADVFEAYIGGLIEDDPKSNLRRVRKWLSKLADPVIEEVMKKEIALAPTDEVDVNAK 362

Query: 253 NLKEQLVQFMEGNKSEKPLKFITTHI-GASHSCKVVIGSTVLGTARGVTAVEAERKAASI 311
                L+ +   N   KP+K  T+    A   C+V  G TVLG  +G     A  +AA  
Sbjct: 363 KTLYSLIGYAALNLHYKPVKKPTSDDPNAIVECRVKDG-TVLGVGKGKNIKIAGMRAAQD 421

Query: 312 VLGNVELLTKYTVYSDSVP 330
           VL N  L+ KY     ++P
Sbjct: 422 VLRNKSLVEKYANMRAAIP 440

>KLTH0H15180g Chr8 complement(1317079..1318563) [1485 bp, 494 aa]
           {ON} similar to uniprot|Q02555 Saccharomyces cerevisiae
           YMR239C RNT1 RNAase III cleaves a stem-loop structure at
           the 3' end of U2 snRNA to ensure formation of the
           correct U2 3' end
          Length = 494

 Score = 84.0 bits (206), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 79/252 (31%), Positives = 111/252 (44%), Gaps = 23/252 (9%)

Query: 98  KEPIITNPILEFLVLAHKKL--------QKSNTAKNNELLQFVGDSWLKSLIASILYKKF 149
           K P I N  ++  V  HK +        +      +NE L+F+GDS L + I  ILY KF
Sbjct: 188 KLPEIKNSAIKARVFIHKSMINDKLYLSEHDMIKAHNERLEFLGDSILNTTITMILYNKF 247

Query: 150 PHASAKALEKLKSDLLTNETLDLWSANNRLLKSLPDLVTKMHPNASEEEVLNYRR----S 205
           PH S   L KL+  L++NE L  WS    L K    L T +       +  + ++     
Sbjct: 248 PHLSEGQLSKLRMKLISNERLKKWSF---LYKFNEKLRTNLDKTCENNDFKHGKQKLYAD 304

Query: 206 CFKAYIGALILDRSHHELNDVVSWLSSLCETRV--GILKAQNLR----GLYAKNLKEQLV 259
            F+AYIG LI D   H L  V  WLS L    +     K  +L      + AK     L+
Sbjct: 305 VFEAYIGGLIEDDPKHNLPKVRKWLSKLASPVIEEEFKKDDDLDVNEVDINAKKTLYSLI 364

Query: 260 QFMEGNKSEKPLKFITTH-IGASHSCKVVIGSTVLGTARGVTAVEAERKAASIVLGNVEL 318
            +   N   KP++  ++    A   C++  G TVLG  +G     A  +AA  VL N  L
Sbjct: 365 GYAALNLHYKPIQKPSSEDSNALVECRIKDG-TVLGVGKGRNIKIAGMRAAQQVLQNKPL 423

Query: 319 LTKYTVYSDSVP 330
           + KY     +VP
Sbjct: 424 IEKYANLRAAVP 435

>Kwal_34.15922 s34 (115736..117226) [1491 bp, 496 aa] {ON} YMR239C
           (RNT1) - Ribonuclease III [contig 272] FULL
          Length = 496

 Score = 83.6 bits (205), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 80/254 (31%), Positives = 111/254 (43%), Gaps = 27/254 (10%)

Query: 98  KEPIITNPILEFLVLAHKKL--------QKSNTAKNNELLQFVGDSWLKSLIASILYKKF 149
           K P I N  +   V  HK +        +      +NE L+F+GDS L + I  ILY +F
Sbjct: 188 KLPEIKNSAIRARVFIHKSMINDKLYLSEHDMIKAHNERLEFLGDSILNTTITMILYNQF 247

Query: 150 PHASAKALEKLKSDLLTNETLDLWSANNRLLKSLPDLVTKMHPNASEEEVLNYRR----S 205
           PH +   L KL+  L++NE L  WS    L K    L T +       +    ++     
Sbjct: 248 PHLTEGQLSKLRMKLISNERLKKWSF---LYKFNEKLRTNLDKTCENSDFRQGKQKLYAD 304

Query: 206 CFKAYIGALILDRSHHELNDVVSWLSSLC------ETRVGILKAQNLRGLYAKNLKEQLV 259
            F+AYIG LI D   H L  V  WLS L       E R       N   + AK     L+
Sbjct: 305 VFEAYIGGLIEDDPKHNLPKVRKWLSKLARPVIEEEFRKDDDLELNEVDINAKKTLYSLI 364

Query: 260 QFMEGNKSEKPLKFITTHIGASHS---CKVVIGSTVLGTARGVTAVEAERKAASIVLGNV 316
            +   N   KP++  ++  G S++   C++  G TVLG  RG     A  +AA  VL N 
Sbjct: 365 GYAALNLHYKPVQKPSS--GDSNALVECRIKDG-TVLGVGRGRNIKIAGMRAAQQVLLNK 421

Query: 317 ELLTKYTVYSDSVP 330
            L+ KY     +VP
Sbjct: 422 PLIEKYANLRAAVP 435

>ZYRO0F12342g Chr6 complement(1005809..1007179) [1371 bp, 456 aa]
           {ON} similar to uniprot|Q02555 Saccharomyces cerevisiae
           YMR239C RNT1 RNAase III cleaves a stem-loop structure at
           the 3' end of U2 snRNA to ensure formation of the
           correct U2 3' end
          Length = 456

 Score = 82.8 bits (203), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 82/256 (32%), Positives = 114/256 (44%), Gaps = 30/256 (11%)

Query: 98  KEPIITNPILEFLVLAHKK-------LQKSNTAK-NNELLQFVGDSWLKSLIASILYKKF 149
           K P I +P +   V  HK        L +S   K +NE L+F+GDS L ++I  I+Y KF
Sbjct: 182 KLPEIKDPAVRARVFIHKSTIKDKLYLTESEMIKAHNERLEFLGDSVLNTVITMIIYNKF 241

Query: 150 PHASAKALEKLKSDLLTNETLDLWSANNRLLKSLPDLVTKMHPNAS-EEEVLNYRRSCFK 208
           P  +   L KL+  L++NE L  W+    L K L         NA+ ++         F+
Sbjct: 242 PRYTEGQLSKLRMTLVSNERLKEWTFMYGLEKKLRTNFDMTKENANFQQGKRKLYADVFE 301

Query: 209 AYIGALILDRSHHELNDVVSWLSSLCE--------TRVGILKAQNLRGLYAKNLKEQLVQ 260
           AYIG LI D   H +  V  WLS L +          VG+   ++L  L AK     L+ 
Sbjct: 302 AYIGGLIEDDPKHNMPRVRKWLSKLAKPVMDEVTVKDVGLESTEDL-DLNAKRQLYSLIG 360

Query: 261 FMEGNKSEKPLKFIT------THIGASHSCKVVIGSTVLGTARGVTAVEAERKAASIVLG 314
           F   N     L ++T      T       C+V  G TVLG+  G     A  KAA  VL 
Sbjct: 361 FAALN-----LHYVTVKRPTNTDPNTVVECRVGDG-TVLGSGEGRNIKIAGLKAAQNVLK 414

Query: 315 NVELLTKYTVYSDSVP 330
           +  +L KY+    S+P
Sbjct: 415 DKAVLEKYSRMRASMP 430

>Ecym_1482 Chr1 complement(995669..997192) [1524 bp, 507 aa] {ON}
           similar to Ashbya gossypii AFR538C
          Length = 507

 Score = 82.8 bits (203), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 76/252 (30%), Positives = 116/252 (46%), Gaps = 26/252 (10%)

Query: 100 PIITNPILEFLVLAHK-----KLQKSNTA---KNNELLQFVGDSWLKSLIASILYKKFPH 151
           P I NP ++  V  H+     KL  S  A    +NE L+F+GDS L + +  I+Y KFP 
Sbjct: 240 PEIKNPAIKARVFTHRSMINDKLYLSEAAMIKAHNERLEFLGDSILNTTMTMIIYNKFPS 299

Query: 152 ASAKALEKLKSDLLTNETLDLWSANNRLLKSLPDLV-TKMHPNASEEEVLNYR----RSC 206
            +   L +L+  L+ NE L  WS     +  LP ++ T +    +  + LN +       
Sbjct: 300 FNEGRLSQLRMKLINNERLKEWS----FMYRLPSMLKTNVETINNTPDFLNGKLKLYADV 355

Query: 207 FKAYIGALILDRSHHELNDVVSWLSSLCETRVG-------ILKAQNLRGLYAKNLKEQLV 259
           F+AYIG LI D     L  V  WL++L E  +        IL+  +   + AK     L+
Sbjct: 356 FEAYIGGLIEDDPKKNLPKVRKWLAALSEPVIQTEMENDVILENTDEVDVNAKKTLYSLI 415

Query: 260 QFMEGNKSEKPLKFITTHIG-ASHSCKVVIGSTVLGTARGVTAVEAERKAASIVLGNVEL 318
            +   N    P+   TT+   A   C+V  G  VLG+ +G     A  +AA +VL +  L
Sbjct: 416 GYAALNLHYHPVHRPTTNAPYAIVECRVKNG-VVLGSGKGKNVKIAGMRAAQVVLSDKAL 474

Query: 319 LTKYTVYSDSVP 330
           + KY     ++P
Sbjct: 475 VDKYAAERAAIP 486

>Kpol_1045.6 s1045 (8627..10063) [1437 bp, 478 aa] {ON}
           (8627..10063) [1437 nt, 479 aa]
          Length = 478

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 78/273 (28%), Positives = 126/273 (46%), Gaps = 26/273 (9%)

Query: 98  KEPIITNPILEFLVLAHKKLQKSN--------TAKNNELLQFVGDSWLKSLIASILYKKF 149
           K P I +P +   V  HK   K             +NE L+F+GDS L +++  I+Y KF
Sbjct: 189 KLPEIKDPSIRAKVFIHKSTIKDKLYLKESEMINAHNERLEFLGDSVLNTIMTMIIYNKF 248

Query: 150 PHASAKALEKLKSDLLTNETLDLWSA---NNRLLKSLPDLVT-KMHPNASEEEVLNYRRS 205
           P  +   L KL+ +L++NE +  W+     ++ LK+  DL   K H    ++++      
Sbjct: 249 PTFTEGQLSKLRMNLVSNERIKSWTYLYNFDKKLKTNFDLGNDKSHFQNGKQKLY---AD 305

Query: 206 CFKAYIGALILDRSHHELNDVVSWLSSLC--------ETRVGILKAQNLRGLYAKNLKEQ 257
            F+AYIG LI D   H +  V  WL+ L         +  V +   +N+  L AK     
Sbjct: 306 VFEAYIGGLIEDDPKHNMPKVRKWLTKLSKPIINEVMQKDVSLETTENI-DLNAKRQLYS 364

Query: 258 LVQFMEGNKSEKPLKFITTHIGAS-HSCKVVIGSTVLGTARGVTAVEAERKAASIVLGNV 316
           ++ +   N   +P+K  T     S   C++  G TVLG  +G     A   AA  VL N 
Sbjct: 365 IIGYAALNLHYEPVKRPTRDDPISIVECRIDDG-TVLGVGKGRNVKIAGLCAAQNVLRNK 423

Query: 317 ELLTKYTVYSDSVPIYQKPLASNNSENSEEKAV 349
            L+ KY+    S+P  +  L S+ S+  +++ +
Sbjct: 424 SLIEKYSQLRASIPRKESVLKSDTSQPKKKRKI 456

>TBLA0B02870 Chr2 (660516..661961) [1446 bp, 481 aa] {ON} Anc_8.779
           YMR239C
          Length = 481

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 73/251 (29%), Positives = 117/251 (46%), Gaps = 27/251 (10%)

Query: 100 PIITNPILEFLVLAHKKLQKSNT--------AKNNELLQFVGDSWLKSLIASILYKKFPH 151
           P I NP ++  V  HK + K             +NE L+++GDS L + I++I+Y KFP+
Sbjct: 210 PEIENPAIKAKVFIHKSIVKDKLFLLESQMLNAHNERLEWLGDSILNTTISTIIYNKFPN 269

Query: 152 ASAKALEKLKSDLLTNETLDLWSANNRLLKSLPDLVTKMHPNASEEEVLNYR--RSCFKA 209
            S   L KL+  L+ NE L  W+    L K +    +    N S    L+ +     F+A
Sbjct: 270 YSEGKLSKLRIMLINNENLREWTYLYGLEKGIKAAKSGEQKNGS----LSAKAYADVFEA 325

Query: 210 YIGALILDRSHHELNDVVSWLSSLCETRVGILKAQNLRGLYAKNL----KEQLVQFMEGN 265
           YIG L+ D +   L  +  WL+ L +  +  +   ++      NL    K++L   + G 
Sbjct: 326 YIGGLMEDDAQKNLPKIRKWLAKLSKPLIEKVSKTDIELENTDNLNPNAKKELYSLI-GY 384

Query: 266 KSEKPLKFITTHIGASHS------CKVVIGSTVLGTARGVTAVEAERKAASIVLGNVELL 319
            + K L+++ T + +         C++  G TVLG   G     A  KAA  VL N EL+
Sbjct: 385 AALK-LQYVATKMPSQSQPYSVVECRIGDG-TVLGVGVGRNVKLAGIKAAMSVLDNSELI 442

Query: 320 TKYTVYSDSVP 330
            KY+    ++P
Sbjct: 443 EKYSQLRAAIP 453

>AFR538C Chr6 complement(1404410..1405708) [1299 bp, 432 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR239C
           (RNT1)
          Length = 432

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 72/263 (27%), Positives = 113/263 (42%), Gaps = 23/263 (8%)

Query: 100 PIITNPILEFLVLAHKKL--------QKSNTAKNNELLQFVGDSWLKSLIASILYKKFPH 151
           P I +P +   V  H+ L        +      +NE L+F+GDS L + +  I+Y KFP 
Sbjct: 171 PEIKDPAIRARVFTHRSLTNDKLYLDEAQMINSHNERLEFLGDSILNTTMTMIIYNKFPG 230

Query: 152 ASAKALEKLKSDLLTNETLDLWSANNRLLKSLPDLVTKMHPNASEEEVLNYR----RSCF 207
            +   L +L++ L+ N+ L  WS   +L   L   +     N +  EV N +       F
Sbjct: 231 FNEGRLSQLRTKLINNDRLKEWSFMYQLPSKLRTNIEMF--NGTTHEVSNGKLKLYADVF 288

Query: 208 KAYIGALILDRSHHELNDVVSWLSSLCETRVG-------ILKAQNLRGLYAKNLKEQLVQ 260
           +AYIG L+ +     L  +  WL+ L E  +        +L+  +   + AK     L+ 
Sbjct: 289 EAYIGGLVEEDGKKNLPRIRKWLAKLAEPVIQEEIENDVVLENTDEVDVNAKKTLYSLIG 348

Query: 261 FMEGNKSEKPLKFITTH-IGASHSCKVVIGSTVLGTARGVTAVEAERKAASIVLGNVELL 319
           +   N    P+   T +   A   C+V  G T LGT RG     A  +AA  VL N +LL
Sbjct: 349 YAALNLHYYPVHRPTNNEPYAIVECRVKDGLT-LGTGRGKNVKIAGMRAAQEVLKNKKLL 407

Query: 320 TKYTVYSDSVPIYQKPLASNNSE 342
             Y     ++P     +  NN +
Sbjct: 408 DHYAAERAAIPRSSSVVKENNDQ 430

>KNAG0G03660 Chr7 complement(770911..771510) [600 bp, 199 aa] {ON} 
          Length = 199

 Score = 69.7 bits (169), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 64/111 (57%), Gaps = 15/111 (13%)

Query: 5   MTPKENIALKKFTKIQNACTELRNSMEIIYENALTEDELTSLTTGS-EIEKFIAFTPACM 63
           M+P +   +K F K+Q AC +L +SM++IYE  +  D L  +  GS + E+ IA +PA  
Sbjct: 1   MSPTDQ-KIKDFCKLQYACQQLNDSMKVIYELGMDRDVLQEMANGSNKAEQAIAMSPAMA 59

Query: 64  ISTYLANARSSVDIVKICDYYKFDENIWSSTALIKEPIITNPILEFLVLAH 114
           +++Y+ + + S+DI ++  +Y+FD +             + P+ E++ LAH
Sbjct: 60  VASYMKSVQPSLDISQVFKHYQFDAD-------------STPVDEYITLAH 97

>TDEL0B03300 Chr2 (588444..589889) [1446 bp, 481 aa] {ON} 
          Length = 481

 Score = 73.2 bits (178), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 73/256 (28%), Positives = 106/256 (41%), Gaps = 30/256 (11%)

Query: 98  KEPIITNPILEFLVLAHKKLQKSN--------TAKNNELLQFVGDSWLKSLIASILYKKF 149
           K P I +P +   V  HK   K             +NE L+F+GDS L +++  I+Y KF
Sbjct: 192 KLPQIKDPAIRARVFIHKSTIKDKLYLTEPEMINAHNERLEFLGDSVLNTVMTMIIYNKF 251

Query: 150 PHASAKALEKLKSDLLTNETLDLWSANNRLLKSLPDLVTKMHPNAS-EEEVLNYRRSCFK 208
           P  +   L KL+  L++NE +  WS      K L         NA  ++         F+
Sbjct: 252 PRFTEGQLSKLRMGLVSNERIKTWSFLYDFDKHLKTNFDVTKDNACFQQGKRKLYADVFE 311

Query: 209 AYIGALILDRSHHELNDVVSWLSSLC--------ETRVGILKAQNLRGLYAKNLKEQLVQ 260
           AYIG LI D   H +  V  WLS L         ++ V +    N+  L AK     L+ 
Sbjct: 312 AYIGGLIEDDPKHNMPKVRKWLSKLAKPIIEEATQSDVDLESTINV-DLNAKRQLYSLIG 370

Query: 261 FMEGNKSEKPLKFITTHIGASH------SCKVVIGSTVLGTARGVTAVEAERKAASIVLG 314
           +   N     L ++T     +        C+V  G+T LG   G     A  +AA  VL 
Sbjct: 371 YAALN-----LHYVTVKRPTADEPNTVVECRVGDGTT-LGAGAGRNVKIAGLRAAQNVLQ 424

Query: 315 NVELLTKYTVYSDSVP 330
           N  +L KY     ++P
Sbjct: 425 NKPVLEKYASLRAAIP 440

>KAFR0B03510 Chr2 complement(729872..731743) [1872 bp, 623 aa] {ON}
           Anc_8.779 YMR239C
          Length = 623

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 75/286 (26%), Positives = 126/286 (44%), Gaps = 38/286 (13%)

Query: 87  DENIWSSTALIKEPIITNPILEFLVLAHK-----KL---QKSNTAKNNELLQFVGDSWLK 138
           D+++W        P I NP L+  V  HK     KL   ++     +NE L+F+GDS L 
Sbjct: 281 DKSVWPPQI----PEIKNPALKARVFIHKSTINDKLFLTEEEMLHAHNERLEFMGDSVLN 336

Query: 139 SLIASILYKKFPHASAKALEKLKSDLLTNETLDLWSANNRLLKSLPDLVTKMHPNASEEE 198
           +L+ +I+Y +FP      L KL+ +L+ NE L  W++   L K    L  K     +  +
Sbjct: 337 ALVTNIIYNQFPQYGDGQLSKLRIELVNNERLKEWASMYGLDKK---LRFKELSERARSK 393

Query: 199 VLNYRR----SCFKAYIGALILDRSHHELNDVVSWLSSLCETRVG-------ILKAQNLR 247
            LN ++      F+AYIGAL+ +     L ++  WL  L +  +         L+  N  
Sbjct: 394 FLNGKQKLHADVFEAYIGALMEEDPKGNLLNIREWLRKLVQPTINDVTKKEVSLEETNEL 453

Query: 248 GLYAKNLKEQLVQFMEGNKSEKPLKFITTHIGASHS------CKVVIGSTVLGTARGVTA 301
            + AK     L+ +     +   L+++T      +       C++  G T+LG       
Sbjct: 454 DINAKRRLYSLIGY-----AALKLQYVTVQKPTKNDPNCIVECRIGDG-TILGKGIARNM 507

Query: 302 VEAERKAASIVLGNVELLTKYTVYSDSVPIYQKPLASNNSENSEEK 347
             A  KAA  VL   +++ KY     S+P  +  +++N+  N   K
Sbjct: 508 KLAGIKAAEDVLSKKDIVEKYANIRASIPRSESVVSNNSFPNKRRK 553

>NDAI0K00820 Chr11 (183793..185346) [1554 bp, 517 aa] {ON} Anc_8.779
           YMR239C
          Length = 517

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 73/251 (29%), Positives = 112/251 (44%), Gaps = 26/251 (10%)

Query: 100 PIITNPILEFLVLAHKKLQKSNTA--------KNNELLQFVGDSWLKSLIASILYKKFPH 151
           P I NP +   V  H  +   N+          +NE L+F+GDS L +++ +I+Y KFP 
Sbjct: 222 PEIKNPAIRAKVFMHSSVVNKNSFLSPIELVHNSNERLEFLGDSILNTIMTTIIYDKFPD 281

Query: 152 ASAKALEKLKSDLLTNETLDLWS---ANNRLLKSLPDLVTKMHPNASEEEVLNYRRSCFK 208
            +   L  L+++L+ N+ L  WS     ++ LK+  + +       +++    Y    F+
Sbjct: 282 YNEGQLSYLRTELVRNKCLKEWSYLYGFDKKLKADINFLLAHDDKGAKK----YIADIFE 337

Query: 209 AYIGALILDRSHHELNDVVSWLSSLCE--------TRVGILKAQNLRGLYAKNLKEQLVQ 260
           AYIG L+ D     L  +  WL  L E        T+VG+  A+  + + AK     L+ 
Sbjct: 338 AYIGGLMEDDPVRNLPRIRKWLKKLAEPVIAEVTKTKVGVT-AKETKDVNAKRELYSLIG 396

Query: 261 FMEGNKSEKPLKFITT-HIGASHSCKVVIGSTVLGTARGVTAVEAERKAASIVLGNVELL 319
           +   N    P+K  T     A   C+V  G TVLG         A  KAA   L N EL+
Sbjct: 397 YAALNLHYVPIKTPTNIESEAIVECRVGDG-TVLGRGVAKNTKIAGAKAAEAALANKELI 455

Query: 320 TKYTVYSDSVP 330
            KY     S+P
Sbjct: 456 EKYAKIRASIP 466

>KAFR0C03740 Chr3 (763425..765614) [2190 bp, 729 aa] {ON} 
          Length = 729

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 76/319 (23%), Positives = 145/319 (45%), Gaps = 25/319 (7%)

Query: 15  KFTKIQNACTELRNSMEIIYENALTEDELTSLTTGSE--IEKFIAFTPACMISTYLANAR 72
           K+ +++ A + LR S+++I + +    +L+ ++   +  + K I   P   +S  + N+ 
Sbjct: 21  KYWQLKRALSSLRESLDVISKQSFALADLSKISVYDDDSVYKMITDDPVLKVSRSIKNSD 80

Query: 73  SSVDIVKICDYYKFDENIWS-STALIKEPIITNPILEFLVLAHK--KLQKSNTAK--NNE 127
           S + + +I      +E I + S   +  P+IT+P L+ + LA K  K    NTA    + 
Sbjct: 81  SFIYLQQILK----EEGISTMSYGKVACPVITDPQLKNM-LAQKFSKQHAQNTAGLCQDI 135

Query: 128 LLQFVGDSWLKSLIASILYKKFPHASAKALEKLKSDLLTNETLDLWSANNRLLKSLPDLV 187
            L+F+G  +LK  I+ +L +KFP+++   L   +  + T++ L  W  +    KS     
Sbjct: 136 RLEFIGSFFLKLFISILLLRKFPNSTNDVLLSTEQKIFTSDNLLSWYTSAGFDKS----- 190

Query: 188 TKMHPNASEEEVLNYRRSCFKAYIGALILDRSHHELNDVVSWLSSLCETRVGILK-AQNL 246
               P  S E  + Y    FK YIG L+LD        V+ WL +L E  + I++   + 
Sbjct: 191 --GSPFHSNEAKIAY----FKKYIGGLVLDNIACGYLHVIDWLGALLENDLKIVEPTMSY 244

Query: 247 RGLYAKNLKEQLVQFMEGNKSEKPLKFITTHIGASHSCKVVIGSTVLGTARGVTAVEAER 306
              + K+ K +L+ +++    E  +  I      +   +V +G   L   +  +   AE 
Sbjct: 245 ESSFVKH-KRKLIDYVKSKFPEHTIASIERVNDDAFDIEVKVGGITLARCKNNSRDLAEE 303

Query: 307 KAASIVLGNVELLTKYTVY 325
            A+   +  +    +Y  Y
Sbjct: 304 NASMKAIQEIAYSNEYAEY 322

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 38/64 (59%)

Query: 741 DKTAMGRLQALLGEAGFIPEYKTRMLAPSHFYSTCNVRGTSVLLAEGHGLTKLVSQQIAA 800
           DK++  +L +LLG+    P Y+T     +HF S C   G ++LL  G G +K +++Q AA
Sbjct: 640 DKSSKQKLHSLLGKLKDHPRYETAHHTKTHFISRCFTVGGNMLLGTGAGKSKQIAEQKAA 699

Query: 801 ENAM 804
            +A+
Sbjct: 700 SDAL 703

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 611 FDKTAKAQVYGAVGRLNMFPEYVTVQLGVNDFYSCCSIKGEPDSLMGEGRGFSKKIAEQV 670
           FDK++K +++  +G+L   P Y T       F S C   G  + L+G G G SK+IAEQ 
Sbjct: 639 FDKSSKQKLHSLLGKLKDHPRYETAHHTKTHFISRCFTVG-GNMLLGTGAGKSKQIAEQK 697

Query: 671 AAGAALQ 677
           AA  AL 
Sbjct: 698 AASDALH 704

>NDAI0K02960 Chr11 complement(672616..674001) [1386 bp, 461 aa] {ON}
           
          Length = 461

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 59/225 (26%), Positives = 106/225 (47%), Gaps = 25/225 (11%)

Query: 18  KIQNACTELRNSMEIIYENALTEDELTSLTTG--SEIEKFIAFTPACMISTYLANARSSV 75
           +I+ A  +L  S++++ EN+++E++L  +     SE+ K I    A     Y +N ++ +
Sbjct: 24  QIRRAVRKLHESIKVLSENSISEEDLNRINAAGDSEVGKIITNDNAIR---YFSNNKNLM 80

Query: 76  DIVKICDYYKFDENIWSSTALIKEPIITNPILEFLVLAHKKLQKSNTAKNNELLQF---- 131
           ++ K+    K +  +  S AL   P I N  L+   L    L ++ +    + L F    
Sbjct: 81  ELKKLDTQIKCNLQLPLSLALSCSPPIINGQLK---LNFAGLGEATSTPEKQHLYFDRLT 137

Query: 132 -VGDSWLKSLIASILYKKFPHASAKALEKLKSDLLTNETLDLWSANNRLLKSLPDLVTKM 190
            +G+ WL S++ ++L+K+FP   +K+L    +++L N+    W      LK      T  
Sbjct: 138 ALGEVWLTSILTNVLFKQFPLIDSKSLTSKVNEILKNKNTRFWINGVNSLKFFELGTTTN 197

Query: 191 HPNASEEEVLNYRRSCFKAYIGALILDRSHHELNDVVSWLSSLCE 235
           +P              FK YIG+LI+D +     DV  W+ SL E
Sbjct: 198 YP------------LVFKQYIGSLIIDNNGSPPPDVTEWIESLYE 230

 Score = 35.4 bits (80), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%)

Query: 739 SCDKTAMGRLQALLGEAGFIPEYKTRMLAPSHFYSTCNVRG 779
           + DK+    L ALLG+  + P Y+TR      F+S C V+G
Sbjct: 416 TLDKSFKEELYALLGKRYYKPHYRTRKTKSGLFHSICYVKG 456

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 7/69 (10%)

Query: 590 AEHPQSNAS----LTGASKLPLQHQFDKTAKAQVYGAVGRLNMFPEYVTVQLGVNDFYSC 645
           A HP + +S      G SK   Q   DK+ K ++Y  +G+    P Y T +     F+S 
Sbjct: 395 ANHPINESSSKLETNGESK---QGTLDKSFKEELYALLGKRYYKPHYRTRKTKSGLFHSI 451

Query: 646 CSIKGEPDS 654
           C +KG+ ++
Sbjct: 452 CYVKGKKNT 460

>CAGL0M05159g Chr13 complement(556347..557696) [1350 bp, 449 aa]
           {ON} similar to uniprot|Q02555 Saccharomyces cerevisiae
           YMR239c RNT1 double-stranded ribonuclease
          Length = 449

 Score = 68.2 bits (165), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 69/261 (26%), Positives = 112/261 (42%), Gaps = 43/261 (16%)

Query: 100 PIITNPILEFLVLAHKKL-------QKSNTAK-NNELLQFVGDSWLKSLIASILYKKFPH 151
           P I + ++   V  HK L        +S+  K NNE L+F+GDS L +++  I+Y KFP 
Sbjct: 180 PEIKDHVIRARVFMHKSLVNDKVYLNESDIIKSNNERLEFLGDSILNTVMTMIIYNKFPS 239

Query: 152 ASAKALEKLKSDLLTNETLDLWSANNRLLKSLPDLVTKMHPNASEEEVLNYRRS---CFK 208
            +   L +L+  L+ NETL  WS        L +L  ++  N S +  L+  ++    F+
Sbjct: 240 LNEGNLTELRKKLVKNETLREWS-------ELYELPKQLKSNLSPDVDLSTSKTSADIFE 292

Query: 209 AYIGALILDRSHHELNDVVSWLSSLCETRVG-------ILKAQNLRGLYAKNLKEQLVQF 261
           AYIG L+ D     L  +  WL  L + ++         L+  N   + AK     L+ +
Sbjct: 293 AYIGGLMEDDPKTNLVKIRKWLKKLAKPKIEEAMKTSIQLEPTNNLDMNAKRKLYSLIGY 352

Query: 262 ---------MEGNKSEKPLKFITTHIGASHSCKVVIGSTVLGTARGVTAVEAERKAASIV 312
                    ++   +E P+  +    G           T+LG  +      A  KAA  V
Sbjct: 353 AALKLHYHTVQRPTNENPVTIVQCRTG---------DGTILGVGKARNIKLAGVKAAEDV 403

Query: 313 LGNVELLTKYTVYSDSVPIYQ 333
           L   +++ KY     S+P  Q
Sbjct: 404 LRKEDVIEKYAKLRASIPREQ 424

>KNAG0J00680 Chr10 (115634..117043) [1410 bp, 469 aa] {ON} Anc_8.779
           YMR239C
          Length = 469

 Score = 67.4 bits (163), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 68/251 (27%), Positives = 106/251 (42%), Gaps = 24/251 (9%)

Query: 100 PIITNPILEFLVLAHKKLQKSNT--------AKNNELLQFVGDSWLKSLIASILYKKFPH 151
           P I NP +   V  HK + K             +NE L+F+GDS +  ++  I+YK+FP 
Sbjct: 180 PEIKNPAIRARVFLHKSVIKDKVFLDEQHKIESHNERLEFLGDSVMNFVVTKIIYKRFPS 239

Query: 152 ASAKALEKLKSDLLTNETL----DLWSANNRLLKSLPDLVTKMHPNASEEEVLNYRRSCF 207
                L  L+  L+ N  +    +L+  +N +L+S  +L  K     + ++ +      F
Sbjct: 240 YDDGQLTILRQKLINNNQIREFSELYGLSN-MLRSNINLFGKFSDYQTGKKKV--EADVF 296

Query: 208 KAYIGALILDRSHHELNDVVSWLSSL-------CETRVGILKAQNLRGLYAKNLKEQLVQ 260
           ++YIG L+ D   + L  V  WL  L          R   L+  +     AK     L+ 
Sbjct: 297 ESYIGGLVEDDPENHLETVYRWLDVLMGPTIERVTKRQISLQENDSTNFDAKRELYSLIG 356

Query: 261 FMEGNKSEKPLKFIT-THIGASHSCKVVIGSTVLGTARGVTAVEAERKAASIVLGNVELL 319
           +       K ++  T T    +  C VV   TVLG   G     A  +AA  VL N EL+
Sbjct: 357 YAALGLKYKTVRHATPTDSTVTVQC-VVGDGTVLGAGTGKNIKVAGARAAENVLQNKELV 415

Query: 320 TKYTVYSDSVP 330
            KY     ++P
Sbjct: 416 EKYANLRAAIP 426

>CAGL0I09636g Chr9 complement(921232..923436) [2205 bp, 734 aa] {ON}
           some similarities with uniprot|Q02555 Saccharomyces
           cerevisiae YMR239c double-stranded ribonuclease
          Length = 734

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 71/248 (28%), Positives = 112/248 (45%), Gaps = 35/248 (14%)

Query: 100 PIITNPILEFLVLAHKK-------LQKSNTAKNN-ELLQFVGDSWLKSLIASILYKKFPH 151
           P I N  ++  V  H+        L +    KN+ E L+F+GDS + S++ +I+YK FP+
Sbjct: 422 PEIKNEAIKARVFIHQSALSGQSYLTEEEKIKNSYERLEFLGDSVINSIMTTIIYKSFPN 481

Query: 152 ASAKALEKLKSDLLTNETLDLWSANNRLLKSLPDLVTKMHPNA---SEEEVLNYRRSCFK 208
             A  + +L+  L++N  L+ W+    L K L  L+ K   N    S  +V       F+
Sbjct: 482 YDAGQMTRLRVLLVSNRRLEKWAYLYGLQKHL--LIRKSILNEMLNSGSKVYKIYADLFE 539

Query: 209 AYIGALILDRSHHELNDVVSWLSSLCETRVGILKAQN-LRG------LYAKNLKEQLV-- 259
           AY+G L+ D     +  +  WLS+L E  +  +  +N L G      + AK   E+L+  
Sbjct: 540 AYVGGLVEDDPTGNMPKIRDWLSTLAEEAIKTISDKNALPGTDNNINMNAKTQLEKLLAP 599

Query: 260 -----QFMEGN-KSEKPLKFITTHIGASHSCKVVIGSTVLGTARGVTAVEAERKAASIVL 313
                Q++  N +S K   F          C+V  G  V G  +G     AE+ AA  +L
Sbjct: 600 VGLEAQYVITNRRSSKKSPFTVIE------CRVANGQ-VTGIGKGRNYKIAEQIAAGNIL 652

Query: 314 GNVELLTK 321
               LL K
Sbjct: 653 EKKWLLDK 660

>Suva_13.424 Chr13 complement(729834..731243) [1410 bp, 469 aa] {ON}
           YMR239C (REAL)
          Length = 469

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 65/237 (27%), Positives = 108/237 (45%), Gaps = 20/237 (8%)

Query: 125 NNELLQFVGDSWLKSLIASILYKKFPHASAKALEKLKSDLLTNETLDLWSANNRLLKSLP 184
           +NE L+F+GDS L S++  I+Y KFP  S   L  L+ +L++NE +  W+   +  + L 
Sbjct: 234 HNERLEFLGDSILNSVMTLIIYNKFPDYSEGQLSTLRMNLVSNEQIKQWAIMYKFHEKLK 293

Query: 185 DLVTKMHPNAS-EEEVLNYRRSCFKAYIGALILDRSHHELNDVVSWLSSLCE-------- 235
                   N++ +   L      F+AYIG L+ D   + L  +  WL  L +        
Sbjct: 294 TNFDLKDENSNFQNGKLKLYADVFEAYIGGLMEDDPRNNLPKIRKWLRKLAKPVIEEATH 353

Query: 236 TRVGILKAQNLRGLYAKNLKEQLVQFMEGNKSEKPLKFIT----THIGASHSCKVVIG-S 290
           ++V + K   L      N K QL   + G  S + L ++T    T I  +   +  +G  
Sbjct: 354 SQVALEKTDKL----DMNAKRQLYSLI-GYASLR-LHYVTVKKPTAIDPNSIVECRVGDG 407

Query: 291 TVLGTARGVTAVEAERKAASIVLGNVELLTKYTVYSDSVPIYQKPLASNNSENSEEK 347
           TVLGT  G     A  +AA   L + ++L  Y     ++P  +  L   +++N + K
Sbjct: 408 TVLGTGVGRNIKIAGIRAAESALRDKKVLDFYAKQRAAIPRSESVLKDPSNKNKKRK 464

>NCAS0C00790 Chr3 (137927..139954) [2028 bp, 675 aa] {ON} Anc_8.779
           YMR239C
          Length = 675

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 69/259 (26%), Positives = 108/259 (41%), Gaps = 31/259 (11%)

Query: 98  KEPIITNPILEFLVLAHKKLQKSN--------TAKNNELLQFVGDSWLKSLIASILYKKF 149
           K P I +P +   V  H  +  S             NE L+F+GDS L +++  I+Y KF
Sbjct: 346 KMPEIKDPAIRARVFLHSSMLNSKNFLTIRDKVGGTNERLEFLGDSILNTVMTMIIYNKF 405

Query: 150 PHASAKALEKLKSDLLTNETLDLWSANNRLLKSLPDLVTKMHPNASEEEVLNYRRSCFKA 209
           PH +   L +L+ +L+ N+ +  WS      K L    T  + +A  ++ L      F+A
Sbjct: 406 PHYNEGELSRLRVELVRNDCIKKWSFMYGFDKRLKIGNTFTYDSAHTDKKL--IADTFEA 463

Query: 210 YIGALILDRSHHELNDVVSWLSSLCETRVGIL----------KAQNLRGLYAKNLKEQLV 259
           YIG L+ +     L  +  WL  L E  +  L          +AQ+   + AK L   L+
Sbjct: 464 YIGGLMEEDPKKNLPKIRKWLQKLAEPVIEKLNKSFEIANATQAQS-EDVNAKRLLYSLI 522

Query: 260 QFMEGNKSEKPLKFITTHIG------ASHSCKVVIGSTVLGTARGVTAVEAERKAASIVL 313
            +   N      K + + IG      A   C++  G TVLG         A  KAA   L
Sbjct: 523 GYAALNLH---YKTVQSPIGKPSGTTAIVECRIGDG-TVLGRGEAQNVKLAGTKAAEDAL 578

Query: 314 GNVELLTKYTVYSDSVPIY 332
              E++  Y     ++P +
Sbjct: 579 SKKEMIEFYAQKRAAIPRW 597

>Skud_13.410 Chr13 complement(723047..724471) [1425 bp, 474 aa] {ON}
           YMR239C (REAL)
          Length = 474

 Score = 64.3 bits (155), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 64/238 (26%), Positives = 105/238 (44%), Gaps = 22/238 (9%)

Query: 125 NNELLQFVGDSWLKSLIASILYKKFPHASAKALEKLKSDLLTNETLDLWSANNRLLKSLP 184
           +NE L+F+GDS L S++  I+Y KFP  S   L  L+ +L++NE +  WS      + L 
Sbjct: 239 HNERLEFLGDSILNSVMTLIIYNKFPDYSEGQLSTLRMNLVSNEQIKQWSIMYHFHERLK 298

Query: 185 DLVTKMHPNAS-EEEVLNYRRSCFKAYIGALILDRSHHELNDVVSWLSSLCE-------- 235
                   N++ +   L      F+AYIG L+ D   + L  +  WL  L +        
Sbjct: 299 TNFDLKDENSNFQNGKLKLYADVFEAYIGGLMEDDPRNNLPKIRKWLRKLAKPVIEEATH 358

Query: 236 TRVGILKAQNLRGLYAKNLKEQLVQFMEGNKSEKPLKFITTHIGASHS------CKVVIG 289
           +++ + K   L      N K QL   + G  S + L ++T     S        C+V  G
Sbjct: 359 SQIALEKTDKL----DMNAKRQLYSLI-GYASLR-LHYVTVKKPTSVDPNSIVECRVGDG 412

Query: 290 STVLGTARGVTAVEAERKAASIVLGNVELLTKYTVYSDSVPIYQKPLASNNSENSEEK 347
            T+LGT  G     A  +AA   L + ++L  +     ++P  +  L   + +N + K
Sbjct: 413 -TILGTGVGRNIKIAGIRAAESALRDKKMLDFFAKQRAAIPRSESVLKDPSQKNKKRK 469

 Score = 33.9 bits (76), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 37/75 (49%), Gaps = 7/75 (9%)

Query: 610 QFDKTAKAQVYGAVGRLNMFPEYVTVQ----LGVNDFYSCCSIKGEPDSLMGEGRGFSKK 665
           + D  AK Q+Y  +G  ++   YVTV+    +  N    C    G   +++G G G + K
Sbjct: 368 KLDMNAKRQLYSLIGYASLRLHYVTVKKPTSVDPNSIVECRVGDG---TILGTGVGRNIK 424

Query: 666 IAEQVAAGAALQSDK 680
           IA   AA +AL+  K
Sbjct: 425 IAGIRAAESALRDKK 439

>Smik_13.451 Chr13 complement(732656..734074) [1419 bp, 472 aa] {ON}
           YMR239C (REAL)
          Length = 472

 Score = 63.9 bits (154), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 98/219 (44%), Gaps = 20/219 (9%)

Query: 126 NELLQFVGDSWLKSLIASILYKKFPHASAKALEKLKSDLLTNETLDLWSANNRLLKSLPD 185
           NE L+F+GDS L S++  I+Y KFP  S   L  L+ +L++NE +  WS      + L  
Sbjct: 238 NERLEFLGDSILNSVMTLIIYNKFPDYSEGQLSTLRMNLVSNEQIKQWSIMYNFHEKLKT 297

Query: 186 LVTKMHPNAS-EEEVLNYRRSCFKAYIGALILDRSHHELNDVVSWLSSLCE--------T 236
                  N++ +   L      F+AYIG L+ D   + L  +  WL  L +        +
Sbjct: 298 NFDLKDENSNFQNGKLKLYADVFEAYIGGLMEDDPRNNLPKIRKWLRKLAKPVIEEATHS 357

Query: 237 RVGILKAQNLRGLYAKNLKEQLVQFMEGNKSEKPLKFIT----THIGASHSCKVVIG-ST 291
           +V + K   L      N K QL   + G  S + L ++T    T +  +   +  +G  T
Sbjct: 358 QVALEKTDKL----DMNAKRQLYSLI-GYASLR-LHYVTVKKPTAVDPNSIVECRVGDGT 411

Query: 292 VLGTARGVTAVEAERKAASIVLGNVELLTKYTVYSDSVP 330
           VLGT  G     A  +AA   L + ++L  Y     ++P
Sbjct: 412 VLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIP 450

>YMR239C Chr13 complement(748262..749677) [1416 bp, 471 aa] {ON}
           RNT1RNAase III; involved in rDNA transcription and rRNA
           processing; also cleaves a stem-loop structure at the 3'
           end of U2 snRNA to ensure formation of the correct U2 3'
           end; involved in polyadenylation-independent
           transcription termination
          Length = 471

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 68/238 (28%), Positives = 106/238 (44%), Gaps = 24/238 (10%)

Query: 126 NELLQFVGDSWLKSLIASILYKKFPHASAKALEKLKSDLLTNETLDLWSANNRL---LKS 182
           NE L+F+GDS L S++  I+Y KFP  S   L  L+ +L++NE +  WS        LK+
Sbjct: 237 NERLEFLGDSILNSVMTLIIYNKFPDYSEGQLSTLRMNLVSNEQIKQWSIMYNFHEKLKT 296

Query: 183 LPDLVTKMHPNASEEEVLNYRRSCFKAYIGALILDRSHHELNDVVSWLSSLCE------- 235
             DL  K   +  +   L      F+AYIG L+ D   + L  +  WL  L +       
Sbjct: 297 NFDL--KDENSNFQNGKLKLYADVFEAYIGGLMEDDPRNNLPKIRKWLRKLAKPVIEEAT 354

Query: 236 -TRVGILKAQNLRGLYAKNLKEQLVQFMEGNKSEKPLKFIT----THIGASHSCKVVIG- 289
             +V + K   L      N K QL   + G  S + L ++T    T +  +   +  +G 
Sbjct: 355 RNQVALEKTDKL----DMNAKRQLYSLI-GYASLR-LHYVTVKKPTAVDPNSIVECRVGD 408

Query: 290 STVLGTARGVTAVEAERKAASIVLGNVELLTKYTVYSDSVPIYQKPLASNNSENSEEK 347
            TVLGT  G     A  +AA   L + ++L  Y     ++P  +  L   + +N + K
Sbjct: 409 GTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIPRSESVLKDPSQKNKKRK 466

>Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W
           (REAL)
          Length = 1066

 Score = 35.0 bits (79), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 8/66 (12%)

Query: 521 PDRKLSTPPMDEPVNNSNPHQHIAIPPLPAMIE--------RKATDAAHVKEEVVAQKSA 572
           P +  +TP   + VNN+ P  H+ IPP  AM E        RK++D  H + E     + 
Sbjct: 557 PRKDTATPLTPKNVNNAEPVLHVMIPPKLAMPEQAHTSPTSRKSSDNQHHEVEYALSPTP 616

Query: 573 ETNDHQ 578
           + ND+Q
Sbjct: 617 QGNDYQ 622

>Skud_8.262 Chr8 (460838..462565) [1728 bp, 575 aa] {ON} YHR196W
           (REAL)
          Length = 575

 Score = 33.1 bits (74), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 53/118 (44%), Gaps = 18/118 (15%)

Query: 23  CTELRNSMEIIYENALTEDELTSLTTGSEIEK-FIAFTPACMISTYLANARSSVDIVK-- 79
           C++L ++  +  +  L EDE  + +TG   E  F+   P   I  Y AN R  V+I+K  
Sbjct: 69  CSDLVDTQSLNIKRKLDEDEENTESTGQRYENFFVNGFPDGRIVVYSANGRDIVNIIKSK 128

Query: 80  --ICDYYKFDENIW--SSTALIKEPIITN--PILEFLVLAHKKLQKSNTAKNNELLQF 131
             I      + NIW   S  ++K+    N  PI  F ++           K++E++ F
Sbjct: 129 KEILGADTDESNIWILDSDKVVKKLQYNNSKPIKTFTLV---------DGKDDEIIHF 177

>TBLA0A05840 Chr1 complement(1440357..1446428) [6072 bp, 2023 aa] {ON}
            Anc_1.127 YJL207C
          Length = 2023

 Score = 33.1 bits (74), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 36/67 (53%), Gaps = 1/67 (1%)

Query: 267  SEKPLKFITTHIGASHSCKVVIGSTVLGTARGVTAVEAERKAASIVLGNVELLTKYTVYS 326
            S + LK I   +    +CK ++ + +   ++   ++EAE K A I+L  V L TK T+ S
Sbjct: 1876 SIQSLKAIINKLDTHIACKRIMKNILQKFSQIYISIEAE-KQARIILEIVTLFTKKTIES 1934

Query: 327  DSVPIYQ 333
            DS  I Q
Sbjct: 1935 DSSKILQ 1941

>ABR092C Chr2 complement(551739..554744) [3006 bp, 1001 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL064W
           (MNR2)
          Length = 1001

 Score = 32.3 bits (72), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 23/44 (52%)

Query: 406 NISSPDNNENSTKPVPDAPIATVSTENTENGSVSELHAEQKEPV 449
           N+ +P NNENST+  P+ P    +  N   GS + +  +   PV
Sbjct: 493 NLGAPANNENSTQHAPNHPSVAAAGMNAGTGSGTPVETQASTPV 536

>KLTH0F03388g Chr6 complement(290517..296435) [5919 bp, 1972 aa]
           {ON} similar to uniprot|P39526 Saccharomyces cerevisiae
           YJL207C Hypothetical ORF
          Length = 1972

 Score = 32.0 bits (71), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 1/47 (2%)

Query: 1   MGSCMTPKENIALKKFTKIQNACTELRNSMEIIYENAL-TEDELTSL 46
           M SC+  K+ ++L+      N CT +  ++ I  E+AL  ED + SL
Sbjct: 852 MNSCIFSKKTVSLRSIAIAINCCTAIHGALSIAQEHALAVEDSVASL 898

>NDAI0D01700 Chr4 complement(399539..401275) [1737 bp, 578 aa] {ON}
           Anc_5.287 YHR045W
          Length = 578

 Score = 32.0 bits (71), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 56/119 (47%), Gaps = 5/119 (4%)

Query: 93  STALIKEPIITNPILEFLVLAHKKLQKSNTAKNNELLQFVGDSWLKSLIASILYKKFPHA 152
           +T L+ +  I N  L +L    K+     + +   L   +  SW K+LI+  ++ K   +
Sbjct: 349 TTLLLTDKDIINQQLSYLSQTEKQ-----STRLCSLFHKIKSSWAKTLISEGIFTKCGTS 403

Query: 153 SAKALEKLKSDLLTNETLDLWSANNRLLKSLPDLVTKMHPNASEEEVLNYRRSCFKAYI 211
             + + +L+   L++    + + ++  + SLP L    + ++   + LNY +S F A I
Sbjct: 404 PNQQIPRLRCIFLSDSLHSIENISSFKMYSLPKLTYGSYMDSFTTKQLNYMKSIFGARI 462

>ZYRO0G17380g Chr7 (1429164..1430375) [1212 bp, 403 aa] {ON} highly
           similar to uniprot|P38431 Saccharomyces cerevisiae
           YPR041W TIF5 eIF5 mediates hydrolysis of eIF2- GTP (SUI2
           SUI3 GCD11) at start codons Translation initiation
           factor eIF-5
          Length = 403

 Score = 31.6 bits (70), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 13/57 (22%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 178 RLLKSLPDLVTKMHPN--ASEEEVLNYRRSCFKAYIGALILDRSHHELNDVVSWLSS 232
           +L+ +LP ++ +++ N   SEEE++ +   C K Y+   +  +        ++WL +
Sbjct: 334 KLIPTLPKILVQLYNNDIVSEEEIIKFGTKCSKKYVPKDVSKKVRKAAKPFITWLQT 390

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.128    0.360 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 83,639,352
Number of extensions: 3577691
Number of successful extensions: 11608
Number of sequences better than 10.0: 165
Number of HSP's gapped: 12143
Number of HSP's successfully gapped: 200
Length of query: 815
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 697
Effective length of database: 39,950,811
Effective search space: 27845715267
Effective search space used: 27845715267
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 70 (31.6 bits)