Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0C001901.4ON44243022960.0
TDEL0C069801.4ON4263755131e-59
ZYRO0F18502g1.4ON4503864759e-54
Suva_3.1511.4ON4213824414e-49
NDAI0A001301.4ON4784404183e-45
YCL063W (VAC17)1.4ON4233694031e-43
Smik_3.131.4ON4253583995e-43
Skud_3.21.4ON4263853987e-43
SAKL0C00440g1.4ON4624053875e-41
NCAS0B091201.4ON4334133691e-38
Kpol_2002.71.4ON4744173491e-35
CAGL0B00308g1.4ON4304273443e-35
KAFR0D001201.4ON3994172932e-28
TBLA0A075801.4ON5133272795e-26
KLLA0C00462g1.4ON4604292698e-25
TPHA0E040201.4ON5404712406e-21
Kwal_33.130031.4ON4493651373e-08
KLTH0F00462g1.4ON4512721331e-07
NCAS0G024302.144ON847118732.0
Ecym_81291.149ON72993722.9
Ecym_60972.430ON70084696.0
NOTE: 2 genes in the same pillar as KNAG0C00190 were not hit in these BLAST results
LIST: AFR746C Ecym_1007

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0C00190
         (442 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0C00190 Chr3 (28746..30074) [1329 bp, 442 aa] {ON} Anc_1.4 Y...   889   0.0  
TDEL0C06980 Chr3 complement(1267077..1268357) [1281 bp, 426 aa] ...   202   1e-59
ZYRO0F18502g Chr6 complement(1527109..1528461) [1353 bp, 450 aa]...   187   9e-54
Suva_3.151 Chr3 (227186..228451) [1266 bp, 421 aa] {ON} YCL063W ...   174   4e-49
NDAI0A00130 Chr1 (6694..8130) [1437 bp, 478 aa] {ON} Anc_1.4 YCL...   165   3e-45
YCL063W Chr3 (17290..18561) [1272 bp, 423 aa] {ON}  VAC17Phospho...   159   1e-43
Smik_3.13 Chr3 (18714..19991) [1278 bp, 425 aa] {ON} YCL063W (REAL)   158   5e-43
Skud_3.2 Chr3 (5324..6604) [1281 bp, 426 aa] {ON} YCL063W (REAL)      157   7e-43
SAKL0C00440g Chr3 (39662..41050) [1389 bp, 462 aa] {ON} weakly s...   153   5e-41
NCAS0B09120 Chr2 complement(1749531..1750832) [1302 bp, 433 aa] ...   146   1e-38
Kpol_2002.7 s2002 (10372..11796) [1425 bp, 474 aa] {ON} (10372.....   139   1e-35
CAGL0B00308g Chr2 (16533..17825) [1293 bp, 430 aa] {ON} similar ...   137   3e-35
KAFR0D00120 Chr4 (9052..10251) [1200 bp, 399 aa] {ON} Anc_1.4 YC...   117   2e-28
TBLA0A07580 Chr1 complement(1878594..1880135) [1542 bp, 513 aa] ...   112   5e-26
KLLA0C00462g Chr3 (33948..35330) [1383 bp, 460 aa] {ON} weakly s...   108   8e-25
TPHA0E04020 Chr5 complement(842960..844582) [1623 bp, 540 aa] {O...    97   6e-21
Kwal_33.13003 s33 (35425..36774) [1350 bp, 449 aa] {ON} YCL063W ...    57   3e-08
KLTH0F00462g Chr6 (35640..36995) [1356 bp, 451 aa] {ON} weakly s...    56   1e-07
NCAS0G02430 Chr7 complement(430311..432854) [2544 bp, 847 aa] {O...    33   2.0  
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    32   2.9  
Ecym_6097 Chr6 complement(182675..184777) [2103 bp, 700 aa] {ON}...    31   6.0  

>KNAG0C00190 Chr3 (28746..30074) [1329 bp, 442 aa] {ON} Anc_1.4
           YCL063W
          Length = 442

 Score =  889 bits (2296), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/430 (100%), Positives = 430/430 (100%)

Query: 1   MDCLEDVTDRLLIRSQDAILQLELWVQQQEKLLLTDHASVDRKKFEAIAQQRNLHLSQLN 60
           MDCLEDVTDRLLIRSQDAILQLELWVQQQEKLLLTDHASVDRKKFEAIAQQRNLHLSQLN
Sbjct: 1   MDCLEDVTDRLLIRSQDAILQLELWVQQQEKLLLTDHASVDRKKFEAIAQQRNLHLSQLN 60

Query: 61  SLCLRSRYIKEKLASERNICSIRKGRRSYIENLVYEFQDIAMSLNELSETNRKNGSPVSQ 120
           SLCLRSRYIKEKLASERNICSIRKGRRSYIENLVYEFQDIAMSLNELSETNRKNGSPVSQ
Sbjct: 61  SLCLRSRYIKEKLASERNICSIRKGRRSYIENLVYEFQDIAMSLNELSETNRKNGSPVSQ 120

Query: 121 ATTNSSDSFEPKPLRILERQRTCNAKSPTKRNSNHIKIPRETEKSDFTENVADCLHSSLP 180
           ATTNSSDSFEPKPLRILERQRTCNAKSPTKRNSNHIKIPRETEKSDFTENVADCLHSSLP
Sbjct: 121 ATTNSSDSFEPKPLRILERQRTCNAKSPTKRNSNHIKIPRETEKSDFTENVADCLHSSLP 180

Query: 181 SSPLRGSNGSQQTIRLTKSYHESLNGQKPTSHSPLMNPFNAKNRLSLYLFDNIDEKELTP 240
           SSPLRGSNGSQQTIRLTKSYHESLNGQKPTSHSPLMNPFNAKNRLSLYLFDNIDEKELTP
Sbjct: 181 SSPLRGSNGSQQTIRLTKSYHESLNGQKPTSHSPLMNPFNAKNRLSLYLFDNIDEKELTP 240

Query: 241 CDDDNSDQETVMYNSPVVSKGAAFEPLRRYNSHESILSVAKKAPIHSSAQKLQFYPSATN 300
           CDDDNSDQETVMYNSPVVSKGAAFEPLRRYNSHESILSVAKKAPIHSSAQKLQFYPSATN
Sbjct: 241 CDDDNSDQETVMYNSPVVSKGAAFEPLRRYNSHESILSVAKKAPIHSSAQKLQFYPSATN 300

Query: 301 GTTSAQSVFVSSKPVYTKPLSVQSRSKDLLSSIAHAEASKDTKTTSVFNGWNLFGKSSTA 360
           GTTSAQSVFVSSKPVYTKPLSVQSRSKDLLSSIAHAEASKDTKTTSVFNGWNLFGKSSTA
Sbjct: 301 GTTSAQSVFVSSKPVYTKPLSVQSRSKDLLSSIAHAEASKDTKTTSVFNGWNLFGKSSTA 360

Query: 361 AITSEVGTCAISQKKHSAIKTNRRYITGDTLVISTSNRPRLSRSSVRQPHGYNRHTSPIT 420
           AITSEVGTCAISQKKHSAIKTNRRYITGDTLVISTSNRPRLSRSSVRQPHGYNRHTSPIT
Sbjct: 361 AITSEVGTCAISQKKHSAIKTNRRYITGDTLVISTSNRPRLSRSSVRQPHGYNRHTSPIT 420

Query: 421 PIVDHQVRQN 430
           PIVDHQVRQN
Sbjct: 421 PIVDHQVRQN 430

>TDEL0C06980 Chr3 complement(1267077..1268357) [1281 bp, 426 aa]
           {ON} Anc_1.4 YCL063W
          Length = 426

 Score =  202 bits (513), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 148/375 (39%), Positives = 214/375 (57%), Gaps = 37/375 (9%)

Query: 4   LEDVTDRLLIRSQDAILQLELWVQQQEKLLLTDHASVDRKKFEAIAQQRNLHLSQLNSLC 63
           LED+++RLL RSQ+AILQLELW+Q+Q+ L   + +S+D+     +  Q N++++QLNSLC
Sbjct: 3   LEDLSERLLTRSQEAILQLELWIQRQQHLRELEDSSIDK-----LGNQYNVYIAQLNSLC 57

Query: 64  LRSRYIKEKLASERNICSIRKGRRSYIENLVYEFQDIAMSLNELSETNRKNGSPVSQATT 123
           +RS Y+++KL  ER         R YIE+LV+EFQDI + LNEL+++   + +P S++T 
Sbjct: 58  VRSEYVRDKLNKERERRMSIINDRKYIEDLVFEFQDITVKLNELAQSQSIDSTPSSKSTR 117

Query: 124 NSSDSFEPKPLRILERQRTCNAK----SPTKRNSNHIKIPRETEKSDFTEN-VADCLHSS 178
           +S  SF+P+PL++ ER    N K    SP K N + IK  + +   D  E  V+ CL  S
Sbjct: 118 SSLGSFQPRPLKLTERH-GPNVKALRESPLK-NKSVIKSVKFSGLHDSKEEAVSKCL--S 173

Query: 179 LPSSPLRGSNGSQQTIRLTKSYHESLNGQ-----KPTSHSPLMNPFNAKNRLSLYLFDNI 233
           LP SP+R + G  ++IR+ KSY   LN +     K +    + + F    RLS+ +FD+ 
Sbjct: 174 LPGSPVRVT-GPTRSIRMAKSYDTGLNSKNTKKSKGSRDYDVPSIFRENQRLSITVFDDF 232

Query: 234 DEKELTPCDDDNSDQETVMYNSPVVSKGAAFEPLRRYNSHESILSVAKKAPIHSSAQKLQ 293
           DE       D  SDQ+TV+   P    G    PLRR+NSHESILS  K  PI S      
Sbjct: 233 DEDA-----DSTSDQDTVISLVP-ADDGKGL-PLRRFNSHESILST-KVQPISSLPLFSS 284

Query: 294 FYPSATNGTTSAQSVFVSSKPVYTKPLSVQSRSKDLLSSI-------AHAEASKDTKTTS 346
           F   ++N   S +SV VSS PV++K  S  + S+DLLS+        ++A   K      
Sbjct: 285 FLLPSSN-RPSMKSVRVSSAPVFSK-TSAPASSRDLLSTFVTRPGKASNATGIKQENKLG 342

Query: 347 VFNGWNLFGKSSTAA 361
            F  WN F   S+A+
Sbjct: 343 FFANWNFFKGPSSAS 357

>ZYRO0F18502g Chr6 complement(1527109..1528461) [1353 bp, 450 aa]
           {ON} similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 450

 Score =  187 bits (475), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 145/386 (37%), Positives = 211/386 (54%), Gaps = 42/386 (10%)

Query: 1   MDCLEDVTDRLLIRSQDAILQLELWVQQQEKLLLTDHASVDRKKFEAIAQQRNLHLSQLN 60
           M  L+D+++RL IRSQ+A+LQLELW+++Q+ L   +H     K    IA Q NL+++QLN
Sbjct: 1   MPSLDDISERLFIRSQEAVLQLELWIRRQQHLSEIEHEHARDK----IADQYNLYMAQLN 56

Query: 61  SLCLRSRYIKEKL-ASERNICSIRKGRRSYIENLVYEFQDIAMSLNELSETNRKNGSPVS 119
           SLC+RS Y+++KL A  +N        ++YIE+LVYEFQDI + LNEL++  ++  +P S
Sbjct: 57  SLCVRSEYVRDKLNAGYQNRKPPIVNEQNYIEDLVYEFQDITVKLNELAQNQKEQVTPSS 116

Query: 120 QATTNSSDSFEPKPLRILERQRT---CNAKSPTKRNSNHIKIPRETEKSDFTENVADCLH 176
           + +  S +SF+P+PL+I ER RT      +SPT+ N   +K     E+S   E       
Sbjct: 117 KHSNGSVNSFQPRPLKITERYRTDIGATRQSPTRING-KLKNVNFVEES-LPELFCPSKC 174

Query: 177 SSLPSSPLRGSNGSQ---QTIRLTKSYHESLNGQ-----KPTSHSPLMNPFNAKNRLSLY 228
           +SLP SPL+  +  +   + +R+ KSY   LN       K      +++ F    RLS+ 
Sbjct: 175 TSLPGSPLKMRSPDRLPDRPLRVAKSYDTGLNPNSRAKLKKQKEEEMLSVFKENQRLSIT 234

Query: 229 LFDNIDEKELTPCDDDNSDQETVMYNSPV-VSKGAAFE------PLRRYNSHESILSVAK 281
             D+IDE       D  SDQ TV+  SP+  S    ++      PLRRYNSH+S+LS  K
Sbjct: 235 FCDDIDEGS-----DSASDQNTVISTSPIPPSHPIQYDVQSEKPPLRRYNSHDSVLS-TK 288

Query: 282 KAPIHSSAQKLQFYPSATNGTTSAQSVFVSSKPVYTKPLSVQSRSKDLLSSIA------H 335
             PI SSA+   F    T    S +SV VSS P+ +     ++ SKDLLSS         
Sbjct: 289 VQPI-SSAKCPTFLTIPTANRPSMKSVTVSSAPIISS-TGGKASSKDLLSSFISNTQDYD 346

Query: 336 AEASKDTKTTSVFNG---WNLFGKSS 358
            +A  D    + F+    WNLF + S
Sbjct: 347 KKARNDNGNNNRFSSNLIWNLFKQKS 372

>Suva_3.151 Chr3 (227186..228451) [1266 bp, 421 aa] {ON} YCL063W
           (REAL)
          Length = 421

 Score =  174 bits (441), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 143/382 (37%), Positives = 207/382 (54%), Gaps = 55/382 (14%)

Query: 3   CLEDVTDRLLIRSQDAILQLELWVQQQEKLLLTDHASVDRKKFEAIAQQRNLHLSQLNSL 62
            LED+T+RLL RS++AILQL+LW+Q+Q++  + + +  DR   + ++QQ N ++SQLNSL
Sbjct: 5   ALEDITERLLTRSEEAILQLDLWIQRQQRSSVCEPS--DRDSLDKLSQQYNQYMSQLNSL 62

Query: 63  CLRSRYIKEKLASER-NICSIRKGRRSYIENLVYEFQDIAMSLNELSETNRK--NGSPVS 119
            +RS  +++KL+ E+    +  +     IE+LV+EFQDI + LN+L+    K  N SP S
Sbjct: 63  YVRSESVRDKLSKEQWRRLNTEENEHKRIEDLVHEFQDITVRLNDLATVPNKASNDSPQS 122

Query: 120 QATTNSSDSFEPKPLRILERQRTC--NAKSPTKRNS-----NHIKIPRETEKSDFTENVA 172
           Q+T +S DSF+P+PL+I+ERQR C      P K++      N ++ P +T          
Sbjct: 123 QSTRSSLDSFQPRPLKIIERQRLCVVTPSKPPKKSVVFNPINDVECPSKT---------- 172

Query: 173 DCLHSSLPSSPLRGSNGSQQTIRLTKSYHESLN-GQKPTSHSPLMNPFNAKNRLSLYLFD 231
               +SLP SP +   G   T+R  KS+   LN  +KP+S     + F  K RLSL  FD
Sbjct: 173 ----NSLPCSP-KKQPGKAHTLRAAKSHDTGLNKSKKPSSTDAYESFFKNKQRLSLTFFD 227

Query: 232 NIDEKELTPCDDDNSDQETVMYN--SP----VVSKGAAFEPLRRYNSHESILSVAKKAPI 285
                E+   D D+     ++ N  +P    + +KGA FEPLRRYNSHESILS  K AP 
Sbjct: 228 -----EMDDEDLDSDQDTIILPNISTPSHMDMATKGAEFEPLRRYNSHESILS-NKPAPA 281

Query: 286 HS-SAQKLQFY-PSATNGTTSAQSVFVSSKPVYTKPL------SVQSRSKDLLSS----- 332
            S S     F+ PS     TS  +V V+ +P     +      S    SK LLSS     
Sbjct: 282 MSLSLGSFPFFKPSNPTFGTSVSNVQVNYRPKMAASMIPKRNGSRAPTSKALLSSFIAQP 341

Query: 333 --IAHAEASKDTKTTSVFNGWN 352
             I   + S + K TS  + +N
Sbjct: 342 DRIVVKQKSTNLKHTSFLDKFN 363

>NDAI0A00130 Chr1 (6694..8130) [1437 bp, 478 aa] {ON} Anc_1.4
           YCL063W
          Length = 478

 Score =  165 bits (418), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 146/440 (33%), Positives = 214/440 (48%), Gaps = 91/440 (20%)

Query: 3   CLEDVTDRLLIRSQDAILQLELWVQ----QQEKLLLTDHASVDRKKFEAIAQQRNLHLSQ 58
            L+D+T+RLLIRSQ+AILQL+LW+Q    QQE   L +  ++     +   QQ N++L+Q
Sbjct: 4   TLQDITERLLIRSQEAILQLDLWIQREKKQQELSTLNNSNNITYDHVDN--QQYNVYLAQ 61

Query: 59  LNSLCLRSRYIKEKLASERNICSIRKGRRSYIENLVYEFQDIAMSLNELSETNRKNGSPV 118
           LNSL +R +YI++K     N     +  + YIENLVYEF+ I + LN+LS+ N+   S  
Sbjct: 62  LNSLIVRVQYIRDKFLHNINQLDSTQDEQKYIENLVYEFKQITLKLNDLSKKNKTTSSSE 121

Query: 119 SQATTNSS----DSFEPKPLRILERQRTCNAKSPTKRNSNHIKIPRETEKSDFTENVADC 174
           + + T SS    +SFEPKPL+I++R +     S T  N++H  I ++       EN+   
Sbjct: 122 NSSKTASSKSSMESFEPKPLKIIKRTKNDQKVSNTI-NNDHDLIMQD-------ENLQRP 173

Query: 175 LHSSLPSSPLRGS-----NGSQQTIRLTKSYHESLNGQKPTSHSPLMNP----------- 218
             +SLPSSP+  S     + ++Q +RL KS  +  + +K TS +   N            
Sbjct: 174 --NSLPSSPIEKSSYVTISQNEQNLRLMKS--QDFSTKKNTSRNTNYNTIRKFENDTINQ 229

Query: 219 -FNAKNRLSLYLFDNIDEKELTP------------CDDDNSDQETVMYNSPVVSKGAAFE 265
            F ++ RLS+ +FDN D+   +               D+NSDQ TV+    +      F 
Sbjct: 230 FFKSQQRLSIGIFDNDDDNIYSTNMGTATRITGEYLTDNNSDQATVISQGTIKRNDDDFT 289

Query: 266 PLRRYNSHESILSVA-KKAPIHSSAQKLQF------YPSATNGTTSAQSVFVSSKPVYTK 318
           PLRRYNSHESILS      P+  +   L F      Y S      S QS+ V+S P++ +
Sbjct: 290 PLRRYNSHESILSQKISSTPLIDNNNNLTFNSKLPLYSSI--RRPSMQSIHVTSNPIFAR 347

Query: 319 PLSVQSRSKDLLSSIAHAEASKD----------------------------TKTTSVFNG 350
             S    SKDLLSS   +   ++                            T T+S F  
Sbjct: 348 S-SQGKTSKDLLSSFVTSSIPRNNNRNIQTRTKTRTQSRRNNQLRDHTINQTSTSSFFGN 406

Query: 351 WNLFGKSSTAAITSEVGTCA 370
           WN   + +   ITSE  T  
Sbjct: 407 WNFLNRFN--MITSETNTTT 424

>YCL063W Chr3 (17290..18561) [1272 bp, 423 aa] {ON}
           VAC17Phosphoprotein involved in vacuole inheritance;
           degraded in late M phase of the cell cycle; acts as a
           vacuole-specific receptor for myosin Myo2p
          Length = 423

 Score =  159 bits (403), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 145/369 (39%), Positives = 204/369 (55%), Gaps = 53/369 (14%)

Query: 3   CLEDVTDRLLIRSQDAILQLELWVQQQEKLLLTDHASVDRKKFEAIAQQRNLHLSQLNSL 62
            LED+T+RLLIRSQ+AILQL+LW+Q+Q++  +    + D++  + ++QQ N ++SQLNSL
Sbjct: 5   ALEDITERLLIRSQEAILQLDLWIQRQQRSSICQ--TTDQESLDKLSQQYNQYMSQLNSL 62

Query: 63  CLRSRYIKEKLASE---RNICSIRKGRRSYIENLVYEFQDIAMSLNELSETNRK--NGSP 117
            +RS  +++KL+ E   R I    + +R  IE+LV EFQDI + LNEL+    +  N SP
Sbjct: 63  YVRSESVRDKLSKEQQRRLITEDNEHQR--IEDLVREFQDITLRLNELATVPNEAPNDSP 120

Query: 118 VSQATTNSSDSFEPKPLRILERQRTC--NAKSPTKRNSNHIKIPRETEKSDFTENVADCL 175
            SQ+T +S  SF+P+PL+I+ERQR C      P K++     I           N  DC 
Sbjct: 121 QSQSTRSSLGSFQPRPLKIIERQRLCMVTPSKPPKKSVGFNPI-----------NEVDCP 169

Query: 176 H--SSLPSSPLRGSNGSQQTIRLTKSYHESLN-GQKPTSHSPLMNPFNAKNRLSLYLFDN 232
              +SLP SP +      +T+R  KS+   LN  +KP+S     + F  + RLSL  FD 
Sbjct: 170 SKTNSLPCSP-KKQPARNRTLRAAKSHDTGLNKSKKPSSSDTYESFFKNRQRLSLTFFDE 228

Query: 233 IDEKELTPCDDDNSDQETVMY---NSP----VVSKGAAFEPLRRYNSHESILSVAKKAPI 285
           +D+++        SDQ+T++    ++P    V +KGA FEPLRRYNSHESILS  K AP 
Sbjct: 229 MDDEDFD------SDQDTIILPNISTPPHVGVTAKGAEFEPLRRYNSHESILS-NKPAPS 281

Query: 286 HS----SAQKLQFYPSATNGTTSAQSVFVSSKPVYTKPLSVQ------SRSKDLLSSIAH 335
            S    S     F PS     TS  +V V+  P     ++        S SK LLSS   
Sbjct: 282 KSLNLGSFSASFFRPSNPTFGTSISNVQVNCHPTVAATMAPSRNGPRISSSKALLSSFI- 340

Query: 336 AEASKDTKT 344
             A  DT T
Sbjct: 341 --ARSDTHT 347

>Smik_3.13 Chr3 (18714..19991) [1278 bp, 425 aa] {ON} YCL063W (REAL)
          Length = 425

 Score =  158 bits (399), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 139/358 (38%), Positives = 203/358 (56%), Gaps = 50/358 (13%)

Query: 3   CLEDVTDRLLIRSQDAILQLELWVQQQEKLLLTDHASVDRKKFEAIAQQRNLHLSQLNSL 62
            LED+T+RLLIRSQ+AILQL+LW+Q+Q++  +    + D++  + +++Q N ++SQLNSL
Sbjct: 5   ALEDITERLLIRSQEAILQLDLWIQRQQRSSVCQ--TTDQELLDKVSKQYNQYMSQLNSL 62

Query: 63  CLRSRYIKEKLASE---RNICSIRKGRRSYIENLVYEFQDIAMSLNELSETNRK--NGSP 117
            +RS  +++KL+ E   R I    + +R  IE+LV EFQDI + LNEL+    +  N SP
Sbjct: 63  YVRSESVRDKLSKEQQRRLITEDNEHQR--IEDLVREFQDITLRLNELATAPNEVANDSP 120

Query: 118 VSQATTNSSDSFEPKPLRILERQRTC--NAKSPTKRNSNHIKIPRETEKSDFTENVADCL 175
            SQ+T +S +SF+P+PL+I+ERQR C      P K++     I           N  DC 
Sbjct: 121 QSQSTRSSLESFQPRPLKIIERQRLCMVTPSKPPKKSVGFNPI-----------NDVDCP 169

Query: 176 H--SSLPSSPLRGSNGSQQTIRLTKSYHESLN-GQKPTSHSPLMNPFNAKNRLSLYLFDN 232
              +SLP SP +       T+R  KS+   LN  +KP+S     + F  + RLSL  FD 
Sbjct: 170 SKTNSLPCSP-KKQPAKNHTLRAAKSHDTGLNKSKKPSSADAYESFFKNRQRLSLTFFDE 228

Query: 233 IDEKELTPCDDDNSDQETVMY---NSP----VVSKGAAFEPLRRYNSHESILSVAKKAPI 285
           +D+++        SDQ+TV+    ++P    V +KGA FEPLRRYNSHESILS  K AP+
Sbjct: 229 MDDEDFD------SDQDTVILPNISTPPHVNVTAKGAEFEPLRRYNSHESILS-NKPAPL 281

Query: 286 HS---SAQKLQFY-PSATNGTTSAQSVFVSSKPVYTKPLSVQSR------SKDLLSSI 333
            S    +  + F+ PS     TS  +V  +  P  T  ++ +        SK LLSS 
Sbjct: 282 MSHSLGSFPVSFFKPSNPTFGTSISNVQANCHPTITATMAPRRNGVHAPSSKALLSSF 339

>Skud_3.2 Chr3 (5324..6604) [1281 bp, 426 aa] {ON} YCL063W (REAL)
          Length = 426

 Score =  157 bits (398), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 151/385 (39%), Positives = 205/385 (53%), Gaps = 59/385 (15%)

Query: 3   CLEDVTDRLLIRSQDAILQLELWVQQQEKLLLTDHASVDRKKFEAIAQQRNLHLSQLNSL 62
            LED+T+RLLIRSQ+AILQL+LW+Q+Q++  +    + D++  + ++QQ N ++SQLNSL
Sbjct: 5   ALEDITERLLIRSQEAILQLDLWIQRQQRSSVCQ--TSDQESLDKLSQQYNQYMSQLNSL 62

Query: 63  CLRSRYIKEKLASE---RNICSIRKGRRSYIENLVYEFQDIAMSLNELSET--NRKNGSP 117
            +RS  +++KL+ E   R I    + +R  IE+LV+EFQDI   LNEL+       N SP
Sbjct: 63  YVRSESVRDKLSKEQQRRLITEDNEHQR--IEDLVHEFQDITSRLNELATVPHGVSNDSP 120

Query: 118 VSQATTNSSDSFEPKPLRILERQRTC--NAKSPTKRNSNHIKIPRETEKSDFTENVADCL 175
            SQ+T +SS SF+P+PL+I+ERQR C      P K++     I           N  DC 
Sbjct: 121 QSQSTRSSSGSFQPRPLKIIERQRVCMVTPSKPPKKSVGFNPI-----------NDVDCP 169

Query: 176 H--SSLPSSPLRGSNGSQQTIRLTKSYHESLNGQKPTSHSPLMNP-FNAKNRLSLYLFDN 232
              +SLP SP +      +T+R  KS+   LN  K  S +      F  K RLSL  FD 
Sbjct: 170 SKTNSLPCSP-KKPPAKNRTLRAAKSHDTGLNKSKKMSSTDAYESFFKNKQRLSLTFFD- 227

Query: 233 IDEKELTPCDDDNSDQETVMYN--SP----VVSKGAAFEPLRRYNSHESILSVAKKAPIH 286
               E+   D D+     ++ N  +P    V +KGA FEPLRRYNSHESILS  K API 
Sbjct: 228 ----EMDDEDLDSDQDTIILPNISTPPHMNVTAKGAEFEPLRRYNSHESILS-NKPAPIM 282

Query: 287 S---SAQKLQFY-PSATNGTTSAQSVFVSSKPVYTKPLSVQSR--------SKDLLSS-- 332
           S         FY PS     TS  +V V   P  T  +S+ SR        SK LLSS  
Sbjct: 283 SLSLGGFPGSFYKPSHPTFGTSTSNVQVDCHPTIT--VSMASRRNGCYAPSSKALLSSFI 340

Query: 333 -----IAHAEASKDTKTTSVFNGWN 352
                IA  +   + K TS  + +N
Sbjct: 341 ARPDRIAAKQDPTNLKHTSFLDKFN 365

>SAKL0C00440g Chr3 (39662..41050) [1389 bp, 462 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 462

 Score =  153 bits (387), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 143/405 (35%), Positives = 212/405 (52%), Gaps = 54/405 (13%)

Query: 1   MDCLEDVTDRLLIRSQDAILQLELWVQQQEKLLLTDHASVDRKKFEAIA--QQRNLHLSQ 58
           M+ L +++ +LL+RSQ+AILQL+L++Q+Q++L   ++ ++D+     +   Q+    L+Q
Sbjct: 1   MEGLHEISQKLLVRSQEAILQLDLYIQRQQRLY--EYETLDQPDNGLLTKLQEYQTCLAQ 58

Query: 59  LNSLCLRSRYIKEKLASERNICSIRKGRRSYIENLVYEFQDIAMSLNELSET-NRKNGSP 117
           LNSL +RS ++++++AS  +  S + G    I +LV EFQ I   LNEL+ T +R   SP
Sbjct: 59  LNSLHIRSEHLRDRIASTDHRAS-QDG--DSIGHLVTEFQKITTKLNELAATQDRAYQSP 115

Query: 118 VSQATTNSSDSFEPKPLRILERQRTCNAKSPTKRNSNHI-KIPRETEKSDFTENVADCLH 176
            SQ +T S  SFEPKPL+ILER +  +  SPTKR +    KI    +   F + V    H
Sbjct: 116 GSQ-STKSVSSFEPKPLKILERTKLQHPTSPTKRVATPPKKIAPLRKNPPFDKKVMFSGH 174

Query: 177 S---SLPSSPLRGSNG-----SQQTIRLTKSYHESLNGQKPTSHSP--LMNPFNAKNRLS 226
           S   SLP SP   ++       ++  R  KS    LN Q+         +N F    RLS
Sbjct: 175 SKSTSLPGSPSMAASSPVSIQQERFPRHAKSCDAGLNKQQRRRQDSDNRLNFFKENQRLS 234

Query: 227 LYLFDNIDEKELTPCDDDNSDQETVMYNSPVVS---KG-AAFEPLRRYNSHESILSVAKK 282
           +  FD+    E+    D +SD++TV+  SP  +   KG    EPLRRYNSHES+LS  + 
Sbjct: 235 ISFFDD----EI----DYSSDEDTVISVSPPETTSFKGFPKAEPLRRYNSHESVLSRKEV 286

Query: 283 APIHSSAQKLQFYPSATNGTTS---AQSVFVSSKPVYTKPLSVQSR------SKDLLSSI 333
            P    A+   F   A         A+SV ++ KPVY+    ++S       SKDLL+  
Sbjct: 287 LPAALPARAGWFSLWAGRNNKPKPMAESVSINDKPVYSTAALLRSHSKTTETSKDLLAQF 346

Query: 334 AHAEASKDTKTT-----------SVFNGWNLFGKSSTAAITSEVG 367
             A   +  +TT           S+F+GW LF  S    +TSE G
Sbjct: 347 VSAAPKQKKQTTSWFGPAEEPKRSIFSGWKLFNNS--VLVTSETG 389

>NCAS0B09120 Chr2 complement(1749531..1750832) [1302 bp, 433 aa]
           {ON} Anc_1.4 YCL063W
          Length = 433

 Score =  146 bits (369), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 136/413 (32%), Positives = 214/413 (51%), Gaps = 72/413 (17%)

Query: 1   MDCLEDVTDRLLIRSQDAILQLELWVQQQEKLLLTD------------HASVD-RKKFEA 47
           M  L+D+++RLL+RSQ+AILQL++W+Q+Q +L                + ++D R     
Sbjct: 1   MSLLQDISERLLVRSQEAILQLDVWIQRQRRLQELMEGEEEQEQGGDTNTNMDIRGTLPQ 60

Query: 48  IAQQRNLHLSQLNSLCLRSRYIKEKLASERNICSIRKGR---------RSYIENLVYEFQ 98
             +Q N +++QLNSL +R  +I++ L +++N   IR  +         + YI++LV+EFQ
Sbjct: 61  FLEQYNTYMAQLNSLQVRVEFIRDTLVNKKN-TGIRNQQLESNNSVDEQKYIQDLVHEFQ 119

Query: 99  DIAMSLNELSET-NRKNGSPVSQATTNSSDSFEPKPLRILERQRTCNAKSPTKRNSNHIK 157
           DI   L+ELS   N    S  S +T +S +SF+PKPLRI+ R  T            H  
Sbjct: 120 DITQKLSELSTVRNPSTASSRSTSTKSSIESFKPKPLRIISRSNT------------HSH 167

Query: 158 IPRET---EKSDFTENVADCLHSSLPSSPLRGSNGSQQTIRLTKSYHESLNGQKPTSHSP 214
           + ++T   +K  F E+  +   S   S  +   + + +++R TKS  + L      +HS 
Sbjct: 168 LHQQTSLDKKVSFNED--ESNSSISHSRSMESLHENSKSLRNTKSM-DVLKRSTFKNHSD 224

Query: 215 LMNPFNAKNRLSLYLFDNIDEKELTPCDDDN--------SDQETVM-YNSPVVSKGAAFE 265
                N++ RLS+ +FD+    +L   +D N        SDQ TV+ + +P+  +GA   
Sbjct: 225 FSKLLNSRQRLSINIFDD----DLIANEDGNEFYNQYSDSDQATVISHGTPI--RGADTP 278

Query: 266 PLRRYNSHESILSVAKKAPIHSSAQKLQFYPSATNGTTSAQSVFVSSKPVYTKPLSVQSR 325
            LRRYNSHESILS  K      S Q  Q  P ++    S QSV V+S P++++ +   + 
Sbjct: 279 LLRRYNSHESILSFRKPT---QSRQPNQILPYSSVRQPSMQSVAVNSNPIFSR-MRPNAT 334

Query: 326 SKDLLSSIA--------HAEASKDTKTTSVFNGWNLFGKSSTAAITSEVGTCA 370
           SKDLLSS          H +  K   + S+F  WN F K +  ++TSE+GT  
Sbjct: 335 SKDLLSSFINKPQPNRLHQQKPK-PNSNSLFGKWNFFNKFN--SVTSEIGTTT 384

>Kpol_2002.7 s2002 (10372..11796) [1425 bp, 474 aa] {ON}
           (10372..11796) [1425 nt, 475 aa]
          Length = 474

 Score =  139 bits (349), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 141/417 (33%), Positives = 217/417 (52%), Gaps = 71/417 (17%)

Query: 4   LEDVTDRLLIRSQDAILQLELWVQQQEKLLLTDHASVDRKKFEAIAQQRNLHLSQLNSLC 63
           ++D+++RLL+RSQ+AILQL+LW+Q+Q++   +D    D    E +    NL++SQLNSL 
Sbjct: 6   IDDLSERLLVRSQEAILQLDLWIQRQQQWAESDDNH-DENDLEKVTDTYNLYMSQLNSLY 64

Query: 64  LRSRYIKEKLASER----------NICSIRKGRRSYIENLVYEFQDIAMSLNELSETNRK 113
           +RS+ +++KL +++          +   +    +S IE+L++EFQDI   LN L+ + R+
Sbjct: 65  IRSQNVRDKLNTKKKSRTNTIKYVSPSKVNMNGQSDIEDLIFEFQDITRKLNVLASSRRR 124

Query: 114 NGSPVSQATTNSS-DSFEPKPLRI-LERQRTCNAKSPTKRNSNHIKIPRETEKSDFTENV 171
             S  S ++ +SS  SF+PKPL+I L+R      KS  ++N   +    E E +D   N+
Sbjct: 125 CSSSKSSSSRSSSIGSFQPKPLKISLKRN-----KSLKEQNKKTVTFDVE-EVTDL--NI 176

Query: 172 ADCLHSSLPSSPLRGSNGS---QQTIRLTKSYHESLNGQ---KPTS---HSPLMNPFNAK 222
              +  SLP SPLR    S      +R  KSY   LN +   KP      S   + F   
Sbjct: 177 NSVI--SLPGSPLRNEQSSPPMNHHLRQAKSYDTGLNSKRSIKPKKSKIDSVYDSTFKNT 234

Query: 223 NRLSLYLFD-NIDEKELTPCDDDNSDQETVMYNSPVV---------SKGAAFEPLRRYNS 272
            RLS+ LFD + +E ++T      SDQETV+ +S +           +    +PLRRYNS
Sbjct: 235 QRLSISLFDIDTNENDITNI----SDQETVISSSSLTMDEPLEIIDDQKNNLKPLRRYNS 290

Query: 273 HESILSVAKKAPIHSSAQKLQFYP--------SATNGTTSAQSVFVSSKPVYTKPLSVQS 324
           HESILS  K  PI S +++ Q  P        ++TN  T+A +  V +   Y   LS  +
Sbjct: 291 HESILS-TKIRPI-SISKRFQIGPFRSVSTTTTSTNYDTTASNTDVKADDFYKPNLSNST 348

Query: 325 RSKDLLSSIAHAEASKDTK-------------TTSVFNGWNLFGKSSTAAITSEVGT 368
            SKD+LS  +     +++              +TS FN WN+F     A+  SEVG+
Sbjct: 349 TSKDILSMYSIKNDVQNSNRGNIINNKKESNSSTSFFNKWNIFNFPLIAS--SEVGS 403

>CAGL0B00308g Chr2 (16533..17825) [1293 bp, 430 aa] {ON} similar to
           uniprot|P25591 Saccharomyces cerevisiae YCL063w
          Length = 430

 Score =  137 bits (344), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 137/427 (32%), Positives = 210/427 (49%), Gaps = 66/427 (15%)

Query: 1   MDCLEDVTDRLLIRSQDAILQLELWVQQQEKLLLTDHASVDRKKFEAIAQQRNLH---LS 57
           M  LE++T+RLL RS +AI QL+ W+  Q K     H S ++   ++I +  + +   L 
Sbjct: 1   MASLEEITERLLERSNEAIEQLDEWILLQNK---NRHISENKSGLDSIERLDDKYTEFLE 57

Query: 58  QLNSLCLRSRYIKEKLASERNICSIRKGRR---SYIENLVYEFQDIAMSLNELS----ET 110
           +LNSL +RS+YIK+K+ +E+N  + ++      S I+ L+ EF++I +SLNE++    ET
Sbjct: 58  KLNSLYIRSQYIKDKIRTEKNAKATKRKSELNTSRIQELMLEFKEITLSLNEIAQQDDET 117

Query: 111 NRKNGSPVSQATTNSSDSFEPKPLRILERQ---RTCNAKSPTKRNSNHIKIPRETEKSDF 167
           N K  SP S +T +S +SF PKPL+IL R    R+     P KRN +   I         
Sbjct: 118 NSKQLSPASTSTKSSLESFTPKPLKILNRASMIRSPINSPPKKRNISFCPI--------- 168

Query: 168 TENVADCLHSSLPSSPLRGS--NGSQQTIRLTKSYHESLNGQKPT--SHSPLMNPFNAKN 223
            EN++   + SLPSSP R +     +Q +   +S+   L  +K      + L   F  K 
Sbjct: 169 HENLSVTEYESLPSSPNRSNLLEEQEQVLHPARSFQTGLRTEKARKPDKNQLDKYFKDKQ 228

Query: 224 RLSLYLFDNIDEKELTPC-DDDNSDQETVMYNSPVVSKGAA----FEPLRRYNSHESILS 278
           RLSL LF + D  +     ++D SD+ETV++ S    +  A     +P+RR NSHES+LS
Sbjct: 229 RLSLTLFGSADADDGESLNNNDYSDEETVIFTSSSNIETDAITDDMKPIRRCNSHESVLS 288

Query: 279 VAKKAPIHSSAQKLQF---------YPSATNGTT----SAQSVFVSSKPVYTKPLSVQSR 325
           V  K  +  +   LQF         Y + +N       S Q++ VS     ++    Q R
Sbjct: 289 VHNKF-VPKNNNNLQFQNRLEPFGRYLATSNNRNFTIPSIQNIQVSGTSTLSRFSREQDR 347

Query: 326 ---------SKDLLSSIAHAEASKDTKTTSVFNGWNLFGKSSTAAITSEVGTCAISQKKH 376
                    SKDLL+S+  A       TT   N    F K       S      IS+++ 
Sbjct: 348 EMTQLGSKTSKDLLTSVMTATPI----TTQRNNKLTFFDK-----FNSMFNFSTISEEQK 398

Query: 377 SAIKTNR 383
           + ++ NR
Sbjct: 399 TTVEKNR 405

>KAFR0D00120 Chr4 (9052..10251) [1200 bp, 399 aa] {ON} Anc_1.4
           YCL063W
          Length = 399

 Score =  117 bits (293), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 130/417 (31%), Positives = 201/417 (48%), Gaps = 72/417 (17%)

Query: 7   VTDRLLIRSQDAILQLELWVQQQEKLLLTDHASVDRKKFEAIAQQRNLHLSQLNSLCLRS 66
           V+D LL RS++A+ QLE W++QQE+L                  Q      QLNSLC +S
Sbjct: 5   VSDTLLQRSEEAVSQLESWLKQQEQL-----------------HQTTAEYKQLNSLCAKS 47

Query: 67  RYIKEKLASERNICS---IRKGRRSYI-ENLVYEFQDIAMSLNELSETNRKNGSPVSQAT 122
           +YI   L  + +      + +  RS+I E+L++EF +I+  LNE+      + SP  Q+T
Sbjct: 48  KYISNLLKDDSSSIPHDLMEQKERSFIVESLIHEFNEISTKLNEIV----THTSP--QST 101

Query: 123 TNSSDSFEPKPLRILERQRTCNA---KSPTKRNSNHIKIPRETEKSDF-TENVADCLHSS 178
               DSFEPKPL +L + +   +    SP  R     ++ R+   + F       C  +S
Sbjct: 102 I---DSFEPKPLNLLRKNKILESPTRSSPVTRG----RLERKISINLFPMHTTTKC--NS 152

Query: 179 LPSSPLRGSNGS--QQTIRLTKSYHESLNGQKPTSHSPLMNPFNAKNRLSLYLF--DNID 234
           +P+SP   S  +  Q+T+R  KSYH  LNG         +NPF   NRLS+  F  DN  
Sbjct: 153 VPTSPKCKSTSTLNQRTLRNIKSYHYGLNGD-------YINPFKENNRLSISFFNGDNTF 205

Query: 235 EKELTPCDDDNSDQETVMYNSPVVSKGAAFEPLRRYNSHESILSVAKKAPIHSSAQKLQF 294
               +  + D  D +TV+  SP ++     + L+R NS +S+          S  ++L  
Sbjct: 206 NDNNSDSESDIDDDDTVLVTSPFLTNPK--QKLKRSNSQDSVFWNENYLRKPSFQKQLNL 263

Query: 295 YPSATNGTTSAQSVFVSSKPVYTKPLS-VQSRSKDLLSSIA--HAEASKDTKTTSVFNGW 351
           +PS     T+     +SS  V+ K    + S SK LL+S    + +  + T   S FN  
Sbjct: 264 FPSTLTKPTAE----LSSTQVFLKNTGRLGSSSKALLTSFVKDNLQQQQRTHNASSFN-- 317

Query: 352 NLFGKSSTAAITSEVGTCAISQKKHSAIKTNRRYITGDTLVIS---TSNRPRLSRSS 405
           N+F      ++TSE+G   +   K   I T RR ++ +++VIS   TS + R +R S
Sbjct: 318 NIFN-----SVTSEIGKSKLD--KSQIIHTERRVLSDNSIVISTLITSKKSRFNRFS 367

>TBLA0A07580 Chr1 complement(1878594..1880135) [1542 bp, 513 aa]
           {ON} Anc_1.4 YCL063W
          Length = 513

 Score =  112 bits (279), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 99/327 (30%), Positives = 169/327 (51%), Gaps = 62/327 (18%)

Query: 1   MDCLEDVTDRLLIRSQDAILQLELWVQQQEKLLLTDHASVD-RKKFEAIAQQRNLHLSQL 59
           M   E+V+ RLL ++Q+A+LQL+LW++ Q+     D       +  E   +  N ++ QL
Sbjct: 1   MALQEEVSIRLLTKAQEAVLQLDLWIKDQQGFQNRDGLRASTSESLEQAERDYNRYMFQL 60

Query: 60  NSLCLRSRYIKEKLA-------SERNICSIRKGRRSYIENLVYEFQDIAMSLNELS--ET 110
           NSL LR++YI++K+        ++ ++        +Y++ LV EF  +++ +NELS  + 
Sbjct: 61  NSLYLRAQYIRDKIEKQNAYNLADSDVAGNDTNSHAYVQQLVTEFYSLSIKMNELSAIQE 120

Query: 111 NRKNG-SPVSQATTNSSDS-------FEPKPLRILERQRTCN---------AKSP--TKR 151
           N  NG SP+S  +++S+DS       F+P+PL+IL+RQ+  N          +SP   K 
Sbjct: 121 NVTNGSSPLSNKSSHSNDSLSKITDGFQPRPLKILQRQKHNNNQNTHPQPDLESPLKLKH 180

Query: 152 NSNHIKI---------PRE---TEKSDFTENVADCLHSSLPSSPLRGSNGSQQTIRLTKS 199
            S++ K+         P +   ++KS   E ++D        SP++  +  + T  +  +
Sbjct: 181 RSSYNKLLSSNKKESKPYKNFNSKKSKNNELLSDI-------SPVKIQSFEEPTFSVANT 233

Query: 200 YHESLNGQKPTSHSPLMNPFNAKNRLSLYL---FDNIDEKELTPCDDDNSDQETVMYNSP 256
            ++  N   P  +S     F   NRLS+     +DN DE +   C    SDQ+T+  ++P
Sbjct: 234 RNK--NSMDPLHYS----LFKTNNRLSIQFPDGYDNDDEYDDPTCI---SDQDTIFVSTP 284

Query: 257 VVSKGA--AFEPLRRYNSHESILSVAK 281
            ++       EPLR++NSHESILSV K
Sbjct: 285 KIASSIKNTSEPLRKFNSHESILSVEK 311

>KLLA0C00462g Chr3 (33948..35330) [1383 bp, 460 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 460

 Score =  108 bits (269), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 127/429 (29%), Positives = 198/429 (46%), Gaps = 98/429 (22%)

Query: 1   MDCLEDVTDRLLIRSQDAILQLELWVQQQEKLLLTD----HASVDRKKFEAIAQQRNLHL 56
           M+ +  V +RL+IR  +A++QLEL +Q+  K+   D    H  +  +++ +        L
Sbjct: 1   MEDMRYVAERLVIRCNEAVMQLELSIQR--KMCEFDPNNSHCFIQVQEYYSF-------L 51

Query: 57  SQLNSLCLRSRYIKEKLASER----NICSIRKGRRSYIENLVYEFQDIAMSLNELSETNR 112
           ++L+SL LR+ +++E L  +R    ++C         +E L+YEFQDI MSLNE++   R
Sbjct: 52  ARLSSLKLRAEHVQESLRHQRKDPNDVCI----EYETLEKLIYEFQDITMSLNEVA---R 104

Query: 113 KNGSPVSQATTNSS--DSFEP-KPLRILERQR-TCNAKSPTKRNSNHIKIPRETE----- 163
              SP   A + SS   S  P K L+I+ER R +    SP K++ + +K     +     
Sbjct: 105 AYQSPTKSARSGSSKESSVIPLKTLKIIERNRDSLIGTSPMKKSLSQLKKEEHNQSLPAK 164

Query: 164 -KSDFTENVADCLH--------SSLPSSPLRGS-------NGSQQTIRLTKSYHESLNGQ 207
               F E+  D LH        +SLP SP+  +       +   +T+R+ KSY   LNG+
Sbjct: 165 RNVRFQEDDLDILHHLHSVKRANSLPGSPMPDTLLESQMFSREHKTLRMAKSYDVGLNGR 224

Query: 208 KPTSHSPLMNPFNAKNRLSLYLFDNIDEKELTPCDDDNSDQETVMYNSP-----VVSKGA 262
              +       F  KNRLSL +FD++        + D SD+ETV+  SP      +S+  
Sbjct: 225 AKKNAD--WEFFKNKNRLSLSVFDDV--------NTDASDEETVISVSPPNISYYLSQNE 274

Query: 263 AFEP---LRRYNSHESILSVAKKAPIHSSAQKLQFYPS----------ATNGTTSAQSVF 309
              P   +RR NSHESILS    +P  S+   L   P+           T  T S  +  
Sbjct: 275 DQYPSKQVRRCNSHESILSRKILSP--STPANLIMRPTYQSVWQKKAIVTKPTISCSTSN 332

Query: 310 VSSKPVYTKPLSVQSRSKDLLSSIAHAEASKDTK-----------TTSVFNGWNLFGKSS 358
            ++ P    P      SKD+LS    A  SK  +            +S+F  W     +S
Sbjct: 333 STASPTIGSP----HLSKDMLSQFVTAPPSKKYRGWFSSSNSTPFASSIFQKW----FNS 384

Query: 359 TAAITSEVG 367
            + +T E+G
Sbjct: 385 DSLVTKEIG 393

>TPHA0E04020 Chr5 complement(842960..844582) [1623 bp, 540 aa] {ON}
           Anc_1.4 YCL063W
          Length = 540

 Score = 97.1 bits (240), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 126/471 (26%), Positives = 206/471 (43%), Gaps = 109/471 (23%)

Query: 4   LEDVTDRLLIRSQDAILQLELWVQQQEKL-------LLTDHASVDRKKFEAIAQQR---N 53
           LE+++++LLIRSQ+AILQL+LW+ +Q++          TD  +  +   EA+   R   +
Sbjct: 8   LEELSEKLLIRSQEAILQLDLWILRQQQQHNDHRFGTATDTGNKTKDSNEALNALRSTYD 67

Query: 54  LHLSQLNSLCLRSRYIKEKLASERNICSIRKGRRSYIENLVYEFQDIAMSLNELSETNR- 112
           L++SQLNSL +RS +I++KL SE+N  +        IE LV+EFQ+I   LN+L+ +++ 
Sbjct: 68  LYMSQLNSLYVRSEFIRDKLNSEKNNVNKFNLDHRNIEELVFEFQNIREKLNQLAASSKL 127

Query: 113 -KNGSPVSQATTNSSDSFEPKPLRILERQRTCNAKSPTKRNSNH-IKIPRETEKSDFTEN 170
            K+  P +   ++S +S   KPL+++ +     +K    +N    +   +ET  S  T  
Sbjct: 128 DKHSPPKTSTRSSSMESMNLKPLKVVAKHEKRMSKELELKNKEKSVTFGKETRISLTTNG 187

Query: 171 VADCL--HSSLPSSPLRGSNGSQQTIRLTKSYHESLNGQ-----------KPTSHSPLMN 217
           +   L       +SP +  +   + +R   SY   LN +           +  + +   +
Sbjct: 188 IGGKLMIKDDSDASP-QLIDKKYKVLRNAISYDTGLNSKSKSNKRSNREYRKKNDAAYDS 246

Query: 218 PFNAKNRLSLYLFD-------NIDEKELTPCDD---------DNSDQETV--------MY 253
            F  K R S+ LF+       N +  E  P  D         +NSDQETV        + 
Sbjct: 247 LFKNKQRFSISLFEDYVDTTTNTNYNEFNPTVDASINTELIENNSDQETVISSSHLPCIT 306

Query: 254 NSP----VVSKGAAFEP-------------LRRYNSHESILSVAKKAPIHSSAQKLQFY- 295
           N P    ++S     +              LRR NSHESILS   +   + +     FY 
Sbjct: 307 NEPLDDYILSNSIQLDKNNNSGNNEGKKSHLRRCNSHESILSTKLENTFYKNVGS-NFYD 365

Query: 296 ---------PSATNGTTSAQSV--FVSSKPVYTK------PLSVQSR---SKDLLSSIAH 335
                    P+  + +T++ ++  F+S     +       PL+  +R   S++LLS  A 
Sbjct: 366 RFIFSSFYRPTVASVSTTSTNIEPFLSDGKNESPNKNLQLPLTSSTRGVTSRELLSKFAD 425

Query: 336 AEASKDTKTTS-------VFNGWNLF------------GKSSTAAITSEVG 367
                   TTS        F  W LF              S +  I+SEVG
Sbjct: 426 KPEQLKAPTTSNSNSSKYFFENWGLFSSMSSSSTFHRKNTSGSNIISSEVG 476

>Kwal_33.13003 s33 (35425..36774) [1350 bp, 449 aa] {ON} YCL063W -
           Hypothetical ORF [contig 123] FULL
          Length = 449

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 87/365 (23%), Positives = 154/365 (42%), Gaps = 55/365 (15%)

Query: 1   MDCLEDVTDRLLIRSQDAILQLELWVQQQEKLLLTDHA--SVDRKKFEAIAQQRNLHLSQ 58
           M+ L  +    L RS++A+++LE  V +Q +L  ++ +   +  +    I Q  + +L Q
Sbjct: 1   MEQLAKIAQCALERSEEALVRLEKCVGKQRRLYESERSDQCLSEESSSTIVQYYS-YLGQ 59

Query: 59  LNSLCLRSRYIKEKLASERNICS-IRKGRRSYIENLVYEFQDIAMSLNELSETNRKNGSP 117
           LN L ++++ +K+ +    N C  +    +  IE L ++++ +    NEL    +     
Sbjct: 60  LNCLYIKAQSLKDMMG---NRCGHLPNSTQEAIERLEHDYKALCNHANELGIREKNLEDS 116

Query: 118 VSQATTNSSDSFEPKPLRILERQ---------RTCNA--------KSPTKRNSNHIKIPR 160
            S  +  S  SF+PKPL+I+ER+         + C A        +S T +NS++  IP 
Sbjct: 117 PSCLSPASVSSFQPKPLKIIERRLAQTNTSPTKVCTATVMAKSFCRSGTDKNSDY--IPD 174

Query: 161 ETEKSDFTENVADCLHSSLPSSPLRGSNGSQQTIRLTKSYHESLNGQKPTSHSPLMNPFN 220
           E  K++     + C +          +    + IR+ KS    LN +    H   ++ F 
Sbjct: 175 EIGKTNSCNTNSPCTNE---------AKKEPKFIRVVKSCGTGLN-KHSNPHENRLSFFR 224

Query: 221 AKNRLSLYLFDNIDEKELTPCDDDNSDQETVMYNSPVVSKGAAFEPLRRYNSHESILSVA 280
            + RLS+   ++         D+  SD+ET+   SP+    A+F              VA
Sbjct: 225 DRQRLSISFIED---------DEYLSDEETITSGSPL---NASF-------LLNDFAKVA 265

Query: 281 KKAPIHSSAQKLQFYPSATNGTTSAQSVFVSSKPVYTKPLSVQSRSKDLLSSIAHAEASK 340
           K  P  + A       +     T+A S FVS  P  T    +   S D+        + K
Sbjct: 266 KGRPNQTLASSRHVENNERGAQTAAVSPFVSLVPKKTCTAQIGLTSIDIRPDFGPCFSPK 325

Query: 341 DTKTT 345
             +TT
Sbjct: 326 KFETT 330

>KLTH0F00462g Chr6 (35640..36995) [1356 bp, 451 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 451

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 76/272 (27%), Positives = 138/272 (50%), Gaps = 44/272 (16%)

Query: 1   MDCLEDVTDRLLIRSQDAILQLELWVQQQEKLL--------LTDHASVDRKKFEAIAQQR 52
           M+ L+++    L  SQ A+ +L+  +++Q +L         L+D +S +  ++       
Sbjct: 1   MEQLQEIAQESLALSQSALARLDSCLERQRRLYESGFPDQCLSDKSSTNMAQYYE----- 55

Query: 53  NLHLSQLNSLCLRSRYIKEK--LASERNICSIRKGRRSYIENLVYEFQDIAMS-LNELSE 109
             ++ QL SL  +++ + +   L+  +++ S+++     IENL+ EFQ+IA +  N +S 
Sbjct: 56  --YIGQLYSLYTKAQKLSDTVILSDSKSLSSVQQ---RAIENLIQEFQEIAKNDENFISY 110

Query: 110 TNRKNGSPVSQATTNSSDSFEPKPLRILERQRTCNAKSPTKRN---SNHIKIPR--ETEK 164
           + R++ + +S     S  SF+PKPL+IL+R R    +SPTKR+   S  +   R  ET  
Sbjct: 111 SMRESPNSMS---VQSICSFQPKPLKILQR-RQAQLESPTKRSFRPSMSLLDNRGDETNL 166

Query: 165 SDFTENVADCLHSSLPSSP--LRGSNGSQQT--IRLTKSYHESLNGQKPTSHSPLMNPFN 220
           +  ++   + L  S PSS    R S+ +  T  IR  KS    LN ++   H   +N F 
Sbjct: 167 ATASDRSQERLLGSSPSSIHFFRPSHTNADTLFIRSAKSCDAGLN-RRSNPHENRLNFFK 225

Query: 221 AKNRLSLYLFDNIDEKELTPCDDDNSDQETVM 252
            + RLS+   ++         ++D SD+ TV+
Sbjct: 226 DRQRLSISFIED---------EEDVSDEATVI 248

>NCAS0G02430 Chr7 complement(430311..432854) [2544 bp, 847 aa] {ON}
           Anc_2.144 YNL126W
          Length = 847

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 52/118 (44%), Gaps = 3/118 (2%)

Query: 257 VVSKGAAFEPLRR-YNSHESI-LSVAKKAPIHSSAQKLQFYPSATNGTTSAQSVFVSSKP 314
           +   G  ++ L    N H+S  +S  KKA I   +++L+ Y +  N  T + ++  S K 
Sbjct: 225 IFEAGLLYQSLNLIVNQHKSSNISPIKKALIIHLSKELRKYTAFINNLTISNNL-TSLKA 283

Query: 315 VYTKPLSVQSRSKDLLSSIAHAEASKDTKTTSVFNGWNLFGKSSTAAITSEVGTCAIS 372
           +Y +     S  +     + H EA+      S F+ W   G    + + +E+  C +S
Sbjct: 284 LYIELFEYVSVLRIYFQFMEHFEATSGDMYLSEFHSWKSHGDLLVSRVATELFDCLLS 341

>Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar to
           Ashbya gossypii AEL149C
          Length = 729

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 43/93 (46%), Gaps = 12/93 (12%)

Query: 117 PVSQATTNSSDSFEPKPLRILERQRTCNAKSPTKRNSNHIKIPRETEKSDFTENVADCLH 176
           P S +  NSS +    PLR+   QR C+A+    +     K+ + TE ++  +   D L 
Sbjct: 273 PPSMSPINSSPT---HPLRL---QRPCSARDHHMQRKKRSKVIKNTELANKLQQFTDDLF 326

Query: 177 SS------LPSSPLRGSNGSQQTIRLTKSYHES 203
            +        SSPL GS   +  +   KSYH+S
Sbjct: 327 GNSDEDPLFNSSPLEGSKKPEVLLNAMKSYHQS 359

>Ecym_6097 Chr6 complement(182675..184777) [2103 bp, 700 aa] {ON}
           similar to Ashbya gossypii AFR200W
          Length = 700

 Score = 31.2 bits (69), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 40/84 (47%), Gaps = 16/84 (19%)

Query: 277 LSVAKKAPIHSSAQKLQFYPSATNGTTSAQSVFVSSKPVYTKPLS-----------VQSR 325
           LS AK  P+ S+    QF P   +      S   S   +Y KPLS           VQ +
Sbjct: 560 LSNAKLPPLTSTLD--QFSPELLHSLLQELSTLSS---IYYKPLSQFKRRTVQHSSVQGK 614

Query: 326 SKDLLSSIAHAEASKDTKTTSVFN 349
           + D L+S+AHAE +K+  + ++ +
Sbjct: 615 ALDELTSMAHAEIAKNLNSETLLD 638

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.125    0.350 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,303,660
Number of extensions: 1999546
Number of successful extensions: 7722
Number of sequences better than 10.0: 236
Number of HSP's gapped: 8003
Number of HSP's successfully gapped: 260
Length of query: 442
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 329
Effective length of database: 40,524,141
Effective search space: 13332442389
Effective search space used: 13332442389
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)