Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0C001801.3ON35935918290.0
NCAS0B091301.3ON36734313620.0
Suva_3.1501.3ON36134013260.0
KAFR0D001101.3ON36535213021e-180
Skud_3.11.3ON36034012971e-180
Smik_3.121.3ON36034012951e-179
YCL064C (CHA1)1.3ON36033912951e-179
NDAI0A001201.3ON37734412841e-177
TPHA0E040401.3ON35733712381e-171
Kpol_2002.61.3ON35035012161e-167
TBLA0A049201.3ON36034611701e-160
KAFR0I00130singletonON34434311011e-150
KAFR0F04430singletonON34334310991e-150
CAGL0B00286g1.3ON36034710831e-147
NCAS0A15330singletonON34734110731e-146
ZYRO0F15774gsingletonON41033310611e-143
SAKL0C00418g1.3ON36434310521e-142
NDAI0K02950singletonON33433710081e-136
ZYRO0F18524g1.3ON3353309281e-124
KLTH0F00440g1.3ON3413319231e-123
KNAG0D05380singletonON3343359131e-122
AFR747W1.3ON4263419111e-120
SAKL0C13904gsingletonON3393248851e-117
KLLA0C00440g1.3ON3773268881e-117
Smik_9.2na 1ON3383238631e-114
Ecym_10061.3ON3643518621e-114
Scer_YGOB_SDL1 (SDL1)na 1ON3373318271e-109
Skud_9.2na 1ON3393268241e-108
TDEL0D06540singletonON3373247951e-104
KLLA0E01805gsingletonON3223217671e-100
KNAG0A01150singletonON2312316604e-85
YIL167W (SDL1)singletonOFF2102085664e-71
YIL168WsingletonOFF1271202721e-28
SAKL0F11858g7.367ON5622601801e-13
KAFR0K017007.367ON5792821674e-12
CAGL0I05126g7.367ON5712651641e-11
Ecym_47087.367ON5702881641e-11
NCAS0A142307.367ON5692641622e-11
KLLA0E19779g7.367ON5672641612e-11
YER086W (ILV1)7.367ON5762621585e-11
Skud_5.2057.367ON5762621577e-11
Smik_5.2257.367ON5762621561e-10
TBLA0C050707.367ON5752901561e-10
Suva_5.1997.367ON5762621561e-10
ACR232C7.367ON5602591542e-10
TDEL0C018007.367ON5692651523e-10
TPHA0F031307.367ON5682641497e-10
NDAI0A018107.367ON5702601452e-09
ZYRO0B02772g7.367ON5692601452e-09
Kpol_530.167.367ON5662591443e-09
Kwal_33.148227.367ON5622651363e-08
KNAG0C036907.367ON5772651355e-08
SAKL0A10626gsingletonON3202781282e-07
KLTH0B04884g7.367ON5732651241e-06
Skud_11.2na 2ON3261591078e-05
Kwal_26.75184.69ON4932121062e-04
YKL218C (SRY1)na 2ON3261601032e-04
KLTH0D04092g4.69ON493211980.001
Smik_6.2604.69ON507206970.002
YGR155W (CYS4)4.69ON507209960.002
Kpol_1025.274.148ON396338900.011
NDAI0K025904.148ON400320890.017
TBLA0A003108.81ON89371820.13
Kpol_1026.134.69ON495198820.13
TDEL0F028104.69ON497194800.20
AEL161Wna 3ON35657790.22
Kpol_1013.437.529ON20172770.28
TBLA0E015804.69ON506200790.31
KAFR0F034504.148ON386263760.61
NCAS0C056204.69ON502201760.65
Kwal_47.166964.370ON143075741.2
TPHA0F008904.148ON404343731.3
SAKL0H23364g4.69ON495215731.6
TBLA0B072402.343ON379108685.0
KAFR0H020908.359ON90793677.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0C00180
         (359 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0C00180 Chr3 complement(27151..28230) [1080 bp, 359 aa] {ON}...   709   0.0  
NCAS0B09130 Chr2 (1751219..1752322) [1104 bp, 367 aa] {ON} Anc_1.3    529   0.0  
Suva_3.150 Chr3 complement(225656..226741) [1086 bp, 361 aa] {ON...   515   0.0  
KAFR0D00110 Chr4 complement(7211..8308) [1098 bp, 365 aa] {ON} A...   506   e-180
Skud_3.1 Chr3 complement(3828..4910) [1083 bp, 360 aa] {ON} YCL0...   504   e-180
Smik_3.12 Chr3 complement(17223..18305) [1083 bp, 360 aa] {ON} Y...   503   e-179
YCL064C Chr3 complement(15798..16880) [1083 bp, 360 aa] {ON}  CH...   503   e-179
NDAI0A00120 Chr1 complement(4652..5785) [1134 bp, 377 aa] {ON} A...   499   e-177
TPHA0E04040 Chr5 (846219..847292) [1074 bp, 357 aa] {ON} Anc_1.3...   481   e-171
Kpol_2002.6 s2002 complement(7840..8892) [1053 bp, 350 aa] {ON} ...   473   e-167
TBLA0A04920 Chr1 complement(1214344..1215426) [1083 bp, 360 aa] ...   455   e-160
KAFR0I00130 Chr9 complement(26703..27737) [1035 bp, 344 aa] {ON}...   428   e-150
KAFR0F04430 Chr6 (868691..869722) [1032 bp, 343 aa] {ON}              427   e-150
CAGL0B00286g Chr2 complement(12803..13885) [1083 bp, 360 aa] {ON...   421   e-147
NCAS0A15330 Chr1 (3015596..3016639) [1044 bp, 347 aa] {ON}            417   e-146
ZYRO0F15774g Chr6 (1300486..1301718) [1233 bp, 410 aa] {ON} simi...   413   e-143
SAKL0C00418g Chr3 complement(37529..38623) [1095 bp, 364 aa] {ON...   409   e-142
NDAI0K02950 Chr11 (671102..672106) [1005 bp, 334 aa] {ON}             392   e-136
ZYRO0F18524g Chr6 (1528741..1529748) [1008 bp, 335 aa] {ON} simi...   362   e-124
KLTH0F00440g Chr6 complement(34215..35240) [1026 bp, 341 aa] {ON...   360   e-123
KNAG0D05380 Chr4 complement(986308..987312) [1005 bp, 334 aa] {O...   356   e-122
AFR747W Chr6 (1808016..1809296) [1281 bp, 426 aa] {ON} Syntenic ...   355   e-120
SAKL0C13904g Chr3 (1223973..1224992) [1020 bp, 339 aa] {ON} simi...   345   e-117
KLLA0C00440g Chr3 complement(32008..33141) [1134 bp, 377 aa] {ON...   346   e-117
Smik_9.2 Chr9 (6779..7795) [1017 bp, 338 aa] {ON} YCL064C (REAL)      337   e-114
Ecym_1006 Chr1 complement(9635..10729) [1095 bp, 364 aa] {ON} si...   336   e-114
Scer_YGOB_SDL1 Chr9 (29032..29411,29415..30048) [1014 bp, 337 aa...   323   e-109
Skud_9.2 Chr9 (5919..6938) [1020 bp, 339 aa] {ON} YCL064C (REAL)      322   e-108
TDEL0D06540 Chr4 (1175562..1176575) [1014 bp, 337 aa] {ON}            310   e-104
KLLA0E01805g Chr5 complement(173125..174093) [969 bp, 322 aa] {O...   300   e-100
KNAG0A01150 Chr1 (6346..7041) [696 bp, 231 aa] {ON}                   258   4e-85
YIL167W Chr9 (29416..30048) [633 bp, 210 aa] {OFF}  SDL1Open rea...   222   4e-71
YIL168W Chr9 (29032..29415) [384 bp, 127 aa] {OFF} Open reading ...   109   1e-28
SAKL0F11858g Chr6 (920767..922455) [1689 bp, 562 aa] {ON} highly...    74   1e-13
KAFR0K01700 Chr11 (352943..354682) [1740 bp, 579 aa] {ON} Anc_7....    69   4e-12
CAGL0I05126g Chr9 complement(481145..482860) [1716 bp, 571 aa] {...    68   1e-11
Ecym_4708 Chr4 (1386138..1387850) [1713 bp, 570 aa] {ON} similar...    68   1e-11
NCAS0A14230 Chr1 (2801647..2803356) [1710 bp, 569 aa] {ON} Anc_7...    67   2e-11
KLLA0E19779g Chr5 complement(1760800..1762503) [1704 bp, 567 aa]...    67   2e-11
YER086W Chr5 (328477..330207) [1731 bp, 576 aa] {ON}  ILV1Threon...    65   5e-11
Skud_5.205 Chr5 (322688..324418) [1731 bp, 576 aa] {ON} YER086W ...    65   7e-11
Smik_5.225 Chr5 (337064..338794) [1731 bp, 576 aa] {ON} YER086W ...    65   1e-10
TBLA0C05070 Chr3 (1230732..1232459) [1728 bp, 575 aa] {ON} Anc_7...    65   1e-10
Suva_5.199 Chr5 (303073..304803) [1731 bp, 576 aa] {ON} YER086W ...    65   1e-10
ACR232C Chr3 complement(767330..769012) [1683 bp, 560 aa] {ON} S...    64   2e-10
TDEL0C01800 Chr3 complement(313699..315408) [1710 bp, 569 aa] {O...    63   3e-10
TPHA0F03130 Chr6 complement(685292..686998) [1707 bp, 568 aa] {O...    62   7e-10
NDAI0A01810 Chr1 complement(400890..402602) [1713 bp, 570 aa] {O...    60   2e-09
ZYRO0B02772g Chr2 (224426..226135) [1710 bp, 569 aa] {ON} highly...    60   2e-09
Kpol_530.16 s530 complement(41170..42870) [1701 bp, 566 aa] {ON}...    60   3e-09
Kwal_33.14822 s33 complement(830029..831717) [1689 bp, 562 aa] {...    57   3e-08
KNAG0C03690 Chr3 complement(722238..723971) [1734 bp, 577 aa] {O...    57   5e-08
SAKL0A10626g Chr1 complement(932879..933841) [963 bp, 320 aa] {O...    54   2e-07
KLTH0B04884g Chr2 (400193..401914) [1722 bp, 573 aa] {ON} highly...    52   1e-06
Skud_11.2 Chr11 complement(1812..2792) [981 bp, 326 aa] {ON} YKL...    46   8e-05
Kwal_26.7518 s26 (398913..400394) [1482 bp, 493 aa] {ON} YGR155W...    45   2e-04
YKL218C Chr11 complement(17359..18339) [981 bp, 326 aa] {ON}  SR...    44   2e-04
KLTH0D04092g Chr4 (391381..392862) [1482 bp, 493 aa] {ON} highly...    42   0.001
Smik_6.260 Chr6 (417812..419335) [1524 bp, 507 aa] {ON} YGR155W ...    42   0.002
YGR155W Chr7 (798543..800066) [1524 bp, 507 aa] {ON}  CYS4Cystat...    42   0.002
Kpol_1025.27 s1025 complement(63047..64237) [1191 bp, 396 aa] {O...    39   0.011
NDAI0K02590 Chr11 complement(579163..580365) [1203 bp, 400 aa] {...    39   0.017
TBLA0A00310 Chr1 complement(52232..54913) [2682 bp, 893 aa] {ON}...    36   0.13 
Kpol_1026.13 s1026 (30466..31953) [1488 bp, 495 aa] {ON} (30466....    36   0.13 
TDEL0F02810 Chr6 (511257..512750) [1494 bp, 497 aa] {ON} Anc_4.6...    35   0.20 
AEL161W Chr5 (329283..330353) [1071 bp, 356 aa] {ON} Non-synteni...    35   0.22 
Kpol_1013.43 s1013 complement(97761..98366) [606 bp, 201 aa] {ON...    34   0.28 
TBLA0E01580 Chr5 (373152..374672) [1521 bp, 506 aa] {ON} Anc_4.6...    35   0.31 
KAFR0F03450 Chr6 (686311..687471) [1161 bp, 386 aa] {ON}               34   0.61 
NCAS0C05620 Chr3 (1144950..1146458) [1509 bp, 502 aa] {ON} Anc_4...    34   0.65 
Kwal_47.16696 s47 complement(67984..72276) [4293 bp, 1430 aa] {O...    33   1.2  
TPHA0F00890 Chr6 (206111..207325) [1215 bp, 404 aa] {ON} Anc_4.1...    33   1.3  
SAKL0H23364g Chr8 complement(2023937..2025424) [1488 bp, 495 aa]...    33   1.6  
TBLA0B07240 Chr2 complement(1716738..1717877) [1140 bp, 379 aa] ...    31   5.0  
KAFR0H02090 Chr8 complement(397562..400285) [2724 bp, 907 aa] {O...    30   7.8  

>KNAG0C00180 Chr3 complement(27151..28230) [1080 bp, 359 aa] {ON}
           Anc_1.3 YCL064C
          Length = 359

 Score =  709 bits (1829), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/359 (95%), Positives = 344/359 (95%)

Query: 1   MSLVYNKTPLLRQFFPGKNLPQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRA 60
           MSLVYNKTPLLRQFFPGKNLPQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRA
Sbjct: 1   MSLVYNKTPLLRQFFPGKNLPQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRA 60

Query: 61  HVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQ 120
           HV               CQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQ
Sbjct: 61  HVFASSGGNAGFAAATACQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQ 120

Query: 121 HLKKTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKGIVCSV 180
           HLKKTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKGIVCSV
Sbjct: 121 HLKKTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKGIVCSV 180

Query: 181 GGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTA 240
           GGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTA
Sbjct: 181 GGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTA 240

Query: 241 SISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNVDILEKA 300
           SISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNVDILEKA
Sbjct: 241 SISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNVDILEKA 300

Query: 301 LGHSLTPNDVILVIACGGSSNTLKDLEDTLVTLNSKSIPSPPEYWIPSQVLKKTHIKQL 359
           LGHSLTPNDVILVIACGGSSNTLKDLEDTLVTLNSKSIPSPPEYWIPSQVLKKTHIKQL
Sbjct: 301 LGHSLTPNDVILVIACGGSSNTLKDLEDTLVTLNSKSIPSPPEYWIPSQVLKKTHIKQL 359

>NCAS0B09130 Chr2 (1751219..1752322) [1104 bp, 367 aa] {ON} Anc_1.3
          Length = 367

 Score =  529 bits (1362), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/343 (73%), Positives = 285/343 (83%), Gaps = 6/343 (1%)

Query: 1   MSLVYNKTPLLRQFFPG------KNLPQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQK 54
           MS+VYNKTPLLRQFFP        ++PQ FLKYECLQPSGSFKSRGIGNLI+KNA+RI+K
Sbjct: 1   MSIVYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKK 60

Query: 55  IGERRAHVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAH 114
            G +   V                QRLSLPCTVVVPTATK RMVEKIR TGA VI+NGAH
Sbjct: 61  SGNKSPQVFSSSGGNAGFAAATASQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAH 120

Query: 115 WKEADQHLKKTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVK 174
           WKEAD +LK +VM+ IDL TTEPIYVHPFDNPDIWEGH+T+VDEI++TLN Q I    +K
Sbjct: 121 WKEADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIK 180

Query: 175 GIVCSVGGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIA 234
           GIVCSVGGGGLYNGI+QGLEKH LA+KIPIVGVET+GCHV NTSL L KQIEF KITSIA
Sbjct: 181 GIVCSVGGGGLYNGIIQGLEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIA 240

Query: 235 TSLGTASISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNV 294
           TSLGTASIS QTFE AKKY+TRSVVV+D+ VIETCLKYT+DFNMVAEPACGA+LHLAYN 
Sbjct: 241 TSLGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYNT 300

Query: 295 DILEKALGHSLTPNDVILVIACGGSSNTLKDLEDTLVTLNSKS 337
           +ILE ALGH L+ +D+ILVIACGGSSNT++DLE+TLV L  K+
Sbjct: 301 NILENALGHKLSSDDIILVIACGGSSNTVQDLEETLVRLREKA 343

>Suva_3.150 Chr3 complement(225656..226741) [1086 bp, 361 aa] {ON}
           YCL064C (REAL)
          Length = 361

 Score =  515 bits (1326), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 239/340 (70%), Positives = 282/340 (82%)

Query: 1   MSLVYNKTPLLRQFFPGKNLPQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRA 60
           MS+VYNKTPLLRQFFPGK+L Q +LKYECLQPSGSFKSRGIGNLILKNA+RIQK G+R  
Sbjct: 1   MSIVYNKTPLLRQFFPGKSLAQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSP 60

Query: 61  HVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQ 120
            V               CQRLSLPCTVVVPTATK RMVEKIRNTGA+VIVNGA WKEAD 
Sbjct: 61  QVFASSGGNAGFAAATACQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADT 120

Query: 121 HLKKTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKGIVCSV 180
           +LK  VM+ ID +  EPIYVHPFDNPDIWEGH+++VDEI++ L SQ++  E VKGIVCSV
Sbjct: 121 YLKTNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSV 180

Query: 181 GGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTA 240
           GGGGLYNGI+QGLE+HGLA+KIPIVGVET+GCHV NTSL + + ++F+KITSIATSLGTA
Sbjct: 181 GGGGLYNGIIQGLERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240

Query: 241 SISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNVDILEKA 300
           +IS QTFE A+KYNT+SVVV+D  VIETCLKY+  FNMV EPACGAALHL Y+ DILE A
Sbjct: 241 NISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHTDILETA 300

Query: 301 LGHSLTPNDVILVIACGGSSNTLKDLEDTLVTLNSKSIPS 340
           L   L  +D++L+IACGGSSNT++DLE+TL ++  + +P+
Sbjct: 301 LDTKLAADDIVLIIACGGSSNTVQDLEETLASMKKEGVPA 340

>KAFR0D00110 Chr4 complement(7211..8308) [1098 bp, 365 aa] {ON}
           Anc_1.3 YCL064C
          Length = 365

 Score =  506 bits (1302), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 240/352 (68%), Positives = 285/352 (80%), Gaps = 11/352 (3%)

Query: 1   MSLVYNKTPLLRQFFPG------KNLPQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQK 54
           MS+VYNKTPLLRQFFPG       +LPQ FLKYECLQPSGSFKSRGIGNLILK AM+I K
Sbjct: 1   MSVVYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHK 60

Query: 55  IGERRAHVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAH 114
            G +R  V               CQRLSLPCTVVVPTATK RM+EKI++TGA VI++GA 
Sbjct: 61  KGTKRPEVFASSGGNAGYAAAVACQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAF 120

Query: 115 WKEADQHLKKTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVK 174
           WKEADQ+LKK+VM++I+    +PIYVHPFDNP IWEGH+++VDEIM+TL  QK+Q  N+K
Sbjct: 121 WKEADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIK 180

Query: 175 GIVCSVGGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIA 234
           GIVCSVGGGGLYNGI+QGLE+H L +KIP+VGVET GCHV NTSL L KQ+EFEKITSIA
Sbjct: 181 GIVCSVGGGGLYNGIIQGLERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEKITSIA 240

Query: 235 TSLGTASISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNV 294
           TSL TASIS +TFE A KY TRSV+V D+ VIETCLKYT+D+NMV EPACGA++HLAYN+
Sbjct: 241 TSLATASISAKTFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYNI 300

Query: 295 DILEKALGHSLTPNDVILVIACGGSSNTLKDLEDTLVTLNSK-----SIPSP 341
           DILE ALG  LT +D ++VIACGGSSNTL+D+E+TL+ L S+     ++P+P
Sbjct: 301 DILENALGTKLTKDDTVVVIACGGSSNTLQDMEETLLRLRSEENAAMTLPNP 352

>Skud_3.1 Chr3 complement(3828..4910) [1083 bp, 360 aa] {ON} YCL064C
           (REAL)
          Length = 360

 Score =  504 bits (1297), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 237/340 (69%), Positives = 276/340 (81%)

Query: 1   MSLVYNKTPLLRQFFPGKNLPQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRA 60
           MS+VYNKTPLLRQFFP K+  Q FLKYECLQPSGSFKSRGIGNLILKNA+RIQK G R  
Sbjct: 1   MSIVYNKTPLLRQFFPSKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSP 60

Query: 61  HVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQ 120
            V               CQRLSLPCTVVVPTATK RMVEKIRNTGA+VIVNGA+WKEAD 
Sbjct: 61  QVFASSGGNAGLAAATTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADT 120

Query: 121 HLKKTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKGIVCSV 180
            LK  +M+QID +  EPIYVHPFDNPDIWEGH+++VDEI++ L SQ+I    VKGIVCSV
Sbjct: 121 FLKANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSV 180

Query: 181 GGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTA 240
           GGGGLYNGI+QGLE++ LA+KIPIVGVET GCHV NTSL + + ++F+KITSIATSLGTA
Sbjct: 181 GGGGLYNGIIQGLERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240

Query: 241 SISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNVDILEKA 300
            IS QTFE A KYNT+SVV++D  VIETCLKYT   NMVAEPACGAALHL Y+ +ILEKA
Sbjct: 241 VISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHTEILEKA 300

Query: 301 LGHSLTPNDVILVIACGGSSNTLKDLEDTLVTLNSKSIPS 340
           LG  L  +D++++IACGGSSNT++DLE+TL  L  + +P+
Sbjct: 301 LGSKLAADDIVIIIACGGSSNTVQDLEETLEDLKKQGLPA 340

>Smik_3.12 Chr3 complement(17223..18305) [1083 bp, 360 aa] {ON}
           YCL064C (REAL)
          Length = 360

 Score =  503 bits (1295), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 231/340 (67%), Positives = 277/340 (81%)

Query: 1   MSLVYNKTPLLRQFFPGKNLPQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRA 60
           MS+VYNKTPLLRQFFPGK+  Q FLKYECLQPSGSFKSRGIGNLI+K+A+RIQK G++  
Sbjct: 1   MSIVYNKTPLLRQFFPGKSPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSP 60

Query: 61  HVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQ 120
            +               CQRLSLPCTVVVPTATK RMVEKIRNTGA+VIV+GA+WKEAD 
Sbjct: 61  QIFASSGGNAGFAAATACQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADT 120

Query: 121 HLKKTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKGIVCSV 180
            LK  VM +ID +  EPIYVHPFDNPDIWEGH+++VDE+++ L  Q+I    VKGIVCSV
Sbjct: 121 FLKADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSV 180

Query: 181 GGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTA 240
           GGGGLYNGI+QGLE++GLA+KIPIVGVET GCHV NTSL + + ++F+KITSIATSLGTA
Sbjct: 181 GGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240

Query: 241 SISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNVDILEKA 300
            IS QTF+ A+KYNTRSVV++D  VI+TCLKYT  FNMV EPACGAALHL YN +ILE+A
Sbjct: 241 VISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNTEILERA 300

Query: 301 LGHSLTPNDVILVIACGGSSNTLKDLEDTLVTLNSKSIPS 340
           LG  L  +D++++IACGGSSNT++DLE+ L   N +S P+
Sbjct: 301 LGSKLAADDIVIIIACGGSSNTIQDLEEALDHFNKRSAPA 340

>YCL064C Chr3 complement(15798..16880) [1083 bp, 360 aa] {ON}
           CHA1Catabolic L-serine (L-threonine) deaminase,
           catalyzes the degradation of both L-serine and
           L-threonine; required to use serine or threonine as the
           sole nitrogen source, transcriptionally induced by
           serine and threonine
          Length = 360

 Score =  503 bits (1295), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 234/339 (69%), Positives = 274/339 (80%)

Query: 1   MSLVYNKTPLLRQFFPGKNLPQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRA 60
           MS+VYNKTPLLRQFFPGK   Q FLKYECLQPSGSFKSRGIGNLI+K+A+RIQK G+R  
Sbjct: 1   MSIVYNKTPLLRQFFPGKASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSP 60

Query: 61  HVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQ 120
            V               CQRLSLPCTVVVPTATK RMV+KIRNTGA+VIV+GA+WKEAD 
Sbjct: 61  QVFASSGGNAGFAAATACQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADT 120

Query: 121 HLKKTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKGIVCSV 180
            LK  VM++ID +  EPIYVHPFDNPDIWEGH++++DEI++ L SQ I    VKGIVCSV
Sbjct: 121 FLKTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSV 180

Query: 181 GGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTA 240
           GGGGLYNGI+QGLE++GLA++IPIVGVET GCHV NTSL + + ++F+KITSIATSLGTA
Sbjct: 181 GGGGLYNGIIQGLERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTA 240

Query: 241 SISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNVDILEKA 300
            IS QTFE A+KYNTRSVV++D  VIETCLKYT  FNMV EPACGAALHL YN  ILE A
Sbjct: 241 VISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNTKILENA 300

Query: 301 LGHSLTPNDVILVIACGGSSNTLKDLEDTLVTLNSKSIP 339
           LG  L  +D++++IACGGSSNT+KDLE+ L ++  K  P
Sbjct: 301 LGSKLAADDIVIIIACGGSSNTIKDLEEALDSMRKKDTP 339

>NDAI0A00120 Chr1 complement(4652..5785) [1134 bp, 377 aa] {ON}
           Anc_1.3
          Length = 377

 Score =  499 bits (1284), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 238/344 (69%), Positives = 273/344 (79%), Gaps = 11/344 (3%)

Query: 1   MSLVYNKTPLLRQFFPGK-----------NLPQLFLKYECLQPSGSFKSRGIGNLILKNA 49
           MS+VYNKTPLLRQFF                PQ F+KYECLQPSGSFKSRGIGNLILK+A
Sbjct: 1   MSVVYNKTPLLRQFFQNSVAKSSATASVTATPQFFVKYECLQPSGSFKSRGIGNLILKSA 60

Query: 50  MRIQKIGERRAHVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKTRMVEKIRNTGAKVI 109
           M I KIG++   V               CQRLSLPCTVVVPTATK RMVEKI++TGA VI
Sbjct: 61  MNINKIGQKTPQVFASSGGNAGFAAATACQRLSLPCTVVVPTATKQRMVEKIKSTGANVI 120

Query: 110 VNGAHWKEADQHLKKTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQ 169
           +NGAHWKEAD  LK ++M++ID    EPIYVHPFDNP IWEGHAT+VDEIM++LN Q I 
Sbjct: 121 INGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNIP 180

Query: 170 TENVKGIVCSVGGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEK 229
              VKGIVCSVGGGGLYNGI+QGL+K+ LA+KIPIVGVET+GCHV NTSL LNKQIEF K
Sbjct: 181 INKVKGIVCSVGGGGLYNGIIQGLQKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFSK 240

Query: 230 ITSIATSLGTASISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALH 289
           ITSIATSLGTA+ISK+TFE A+KY TRSVV++D  VIETCLKYT+D+NMV EPACGA++H
Sbjct: 241 ITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASIH 300

Query: 290 LAYNVDILEKALGHSLTPNDVILVIACGGSSNTLKDLEDTLVTL 333
           LAY+ DILEK+LGH L  +D+ILVIACGGSSNT  DLE  L+ +
Sbjct: 301 LAYHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDLESLLLNM 344

>TPHA0E04040 Chr5 (846219..847292) [1074 bp, 357 aa] {ON} Anc_1.3
           YCL064C
          Length = 357

 Score =  481 bits (1238), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 230/337 (68%), Positives = 264/337 (78%)

Query: 1   MSLVYNKTPLLRQFFPGKNLPQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRA 60
           MS VYNKTPLLR  FPGKNLPQ+FLKYEC QPSGSFKSRGIGNLI   ++ IQK  ++  
Sbjct: 1   MSQVYNKTPLLRHLFPGKNLPQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSP 60

Query: 61  HVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQ 120
            V                + LSLPCTVVVPTATK RMVEKI+ TGA VIV G HWKEAD 
Sbjct: 61  EVFSSSGGNAGLAAATASKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADT 120

Query: 121 HLKKTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKGIVCSV 180
           +LK  V+S ID K  EPIYVHPFDN  IWEGHAT++DEI+ET   Q I  E VK IVCSV
Sbjct: 121 YLKTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSV 180

Query: 181 GGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTA 240
           GGGGLYNGI+QGLEKH LA KIP+VGVET GCHV NTSL + K I+FEKI +IATSLGTA
Sbjct: 181 GGGGLYNGIIQGLEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTA 240

Query: 241 SISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNVDILEKA 300
           +IS QTFE AKKYNT+S+VVDD KV+ETCLK+TRD NMVAEPACGAALH+ YN+DILEK+
Sbjct: 241 NISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNMDILEKS 300

Query: 301 LGHSLTPNDVILVIACGGSSNTLKDLEDTLVTLNSKS 337
           LG  L  +D++L+IACGGSSNT+++LE +L  L +KS
Sbjct: 301 LGKKLATDDIVLIIACGGSSNTVQELEASLTELKNKS 337

>Kpol_2002.6 s2002 complement(7840..8892) [1053 bp, 350 aa] {ON}
           complement(7840..8892) [1053 nt, 351 aa]
          Length = 350

 Score =  473 bits (1216), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 233/350 (66%), Positives = 278/350 (79%), Gaps = 2/350 (0%)

Query: 1   MSLVYNKTPLLRQFFPGKNLPQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRA 60
           MSLVYNKTPLL+ FFPGKNLPQ +LKYE LQPSGSFKSRGIGNLILKNA+RI+KI  ++ 
Sbjct: 1   MSLVYNKTPLLKHFFPGKNLPQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKP 60

Query: 61  HVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQ 120
           +V                QRLSLPCTVVVPTATK RMV+KIR TGA VI+ G HWKEAD 
Sbjct: 61  YVFSSSGGNAGLAAATASQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHWKEADN 120

Query: 121 HLKKTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKGIVCSV 180
            LK+ +M++I+    EPIYVHPFDNP IWEGH+T+VDEIMET + QK   +N+K IVCSV
Sbjct: 121 FLKQNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSV 180

Query: 181 GGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTA 240
           GGGGLYNGI+QGLEK+ LA+KIP+VGVET+GCHV NTSL LNK +EF KI++IATSLGTA
Sbjct: 181 GGGGLYNGIIQGLEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTA 240

Query: 241 SISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNVDILEKA 300
           +IS Q F+ AKKYNT+SVVV+D  V+ETCLK+T D NMV EPACGAA+HL Y+ D+LE A
Sbjct: 241 NISNQMFDYAKKYNTKSVVVEDKDVVETCLKFTHDHNMVIEPACGAAIHLGYHTDLLETA 300

Query: 301 LGHSLTPNDVILVIACGGSSNTLKDLEDTLVTLNSKSIPSPPEYWIPSQV 350
           LG  LT +D +L++ACGGSSNT+K+LE  L+ LN KS  + P   IPS +
Sbjct: 301 LGTKLTCDDAVLIVACGGSSNTVKELETALLELNLKSQKASPT--IPSFI 348

>TBLA0A04920 Chr1 complement(1214344..1215426) [1083 bp, 360 aa]
           {ON} Anc_1.3 YCL064C
          Length = 360

 Score =  455 bits (1170), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 218/346 (63%), Positives = 266/346 (76%), Gaps = 2/346 (0%)

Query: 1   MSLVYNKTPLLRQFFPGKNLPQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIG-ERR 59
           MS+VYNKTPLLRQFF G  +PQ FLKYEC+QPSGSFKSRGIGNLILK+  +I      +R
Sbjct: 1   MSIVYNKTPLLRQFFRGSPIPQFFLKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKR 60

Query: 60  AHVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEAD 119
             V                +RLS+PCTVVVPTATK RMV KI++TGAKVIVNG HW EAD
Sbjct: 61  PQVFSSSGGNAGLAAATASRRLSIPCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEAD 120

Query: 120 QHLKKTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKGIVCS 179
            +L+  V+++IDL   EPIYVHPFDNP IWEGH+T++DEI+E+LN Q I   NVK I CS
Sbjct: 121 DYLQNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCS 180

Query: 180 VGGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGT 239
           +GGGGLYNG+++GLEK+ LA KIPI+GVET GC V NTSL L K ++F KI +IATSLGT
Sbjct: 181 IGGGGLYNGLIRGLEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGT 240

Query: 240 ASISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNVDILEK 299
           ++IS +TFE A KYNT+SVVVD+  VI+TCL+YT DFN VAEPACGAALHLAYN  ++E 
Sbjct: 241 STISAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYNTGLIEN 300

Query: 300 ALGHSLTPNDVILVIACGGSSNTLKDLEDTLVTLN-SKSIPSPPEY 344
           AL  +LT +D+I+VIACGGSSNT+++LE+ L+      S+P  PEY
Sbjct: 301 ALDTTLTKDDIIIVIACGGSSNTVQELEEALLKYKLDYSLPQTPEY 346

>KAFR0I00130 Chr9 complement(26703..27737) [1035 bp, 344 aa] {ON}
           Anc_1.3 YCL064C
          Length = 344

 Score =  428 bits (1101), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 203/343 (59%), Positives = 261/343 (76%), Gaps = 6/343 (1%)

Query: 1   MSLVYNKTPLLRQFFPG------KNLPQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQK 54
           M +VYNKTPL+ Q FPG       +LPQ+ +KYE LQPSGSFKSRGIGNL+ + A++IQK
Sbjct: 1   MPIVYNKTPLVPQSFPGTEIRSSDSLPQVLIKYEYLQPSGSFKSRGIGNLVYQKALQIQK 60

Query: 55  IGERRAHVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAH 114
              +   V                Q+LSLPCTVVVP ATK RM+EKIR+TGAKV ++G  
Sbjct: 61  NSTKNPEVFSSSGGNAGYAAAVVAQKLSLPCTVVVPAATKQRMIEKIRSTGAKVTIHGTF 120

Query: 115 WKEADQHLKKTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVK 174
           WK AD+++K +V+++I+ +  EPIYVHP D+P IWEG++ +VDE+ME+L  QKI    VK
Sbjct: 121 WKGADKYMKNSVLNEINTEKVEPIYVHPSDDPLIWEGNSMIVDELMESLQEQKIDPSKVK 180

Query: 175 GIVCSVGGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIA 234
            IVCSVGGGGLYNG+MQGLE++ LA+KIPIVGVET G HV NT L   K IEFEKI+++A
Sbjct: 181 AIVCSVGGGGLYNGLMQGLERYKLADKIPIVGVETDGSHVFNTCLKSGKHIEFEKISTVA 240

Query: 235 TSLGTASISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNV 294
           TSLG+ASI+K+TFE A KY  R V+V D +V+ETCL+YT+D+NM+ EPACGAA+HLAY+V
Sbjct: 241 TSLGSASITKKTFEYAMKYRPRGVIVKDIEVLETCLRYTQDYNMITEPACGAAIHLAYHV 300

Query: 295 DILEKALGHSLTPNDVILVIACGGSSNTLKDLEDTLVTLNSKS 337
           DILEKAL   L  +DV+++IACGGSSN+L D+E+TL  + S+S
Sbjct: 301 DILEKALDTRLDGDDVVIIIACGGSSNSLHDMEETLKKMKSES 343

>KAFR0F04430 Chr6 (868691..869722) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score =  427 bits (1099), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 196/343 (57%), Positives = 261/343 (76%), Gaps = 6/343 (1%)

Query: 1   MSLVYNKTPLLRQFFPGKNL------PQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQK 54
           M  VYNKTPLLR +F   N       PQ+F KYE  QP  SFKSRGIGNLILKNA ++++
Sbjct: 1   MPTVYNKTPLLRPYFLEANRGTSDSSPQVFFKYESFQPGCSFKSRGIGNLILKNAKKVEE 60

Query: 55  IGERRAHVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAH 114
            G +   V               C+ LS+PCTVVVP++TK RMVEKIR+TGA+VIV+G  
Sbjct: 61  EGIKTLEVFSSSGGNAGYAAAVACRELSIPCTVVVPSSTKVRMVEKIRSTGAQVIVSGNF 120

Query: 115 WKEADQHLKKTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVK 174
           WKEAD++L+ +V++++D    EP+YVHPFD+P IWEGH+T++DEI+E+LN + + T  VK
Sbjct: 121 WKEADEYLRNSVINKVDSSKVEPLYVHPFDDPLIWEGHSTIIDEIVESLNDENVHTSKVK 180

Query: 175 GIVCSVGGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIA 234
           G+VCS+GGGGLYNGI++GLE+H LA+KIP++ VET GCHV NT L L K +EFEKI+SIA
Sbjct: 181 GVVCSIGGGGLYNGIIEGLERHALADKIPVIAVETEGCHVFNTCLELGKHVEFEKISSIA 240

Query: 235 TSLGTASISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNV 294
           TSLG+ SIS +TFE A+KY+++ VV+ D  V+ETCL+Y+ D NM+ EPAC A++HLAYNV
Sbjct: 241 TSLGSPSISTKTFEYAQKYHSKGVVLQDIDVLETCLRYSEDSNMIIEPACAASVHLAYNV 300

Query: 295 DILEKALGHSLTPNDVILVIACGGSSNTLKDLEDTLVTLNSKS 337
           DILE+AL   L+ +DVI++IACGGS+ TL+D++D+L  L  K+
Sbjct: 301 DILEEALNKKLSKDDVIIIIACGGSATTLQDIKDSLAKLKIKN 343

>CAGL0B00286g Chr2 complement(12803..13885) [1083 bp, 360 aa] {ON}
           highly similar to uniprot|P25379 Saccharomyces
           cerevisiae YCL064c CHA1 L-serine/L-threonine deaminase
          Length = 360

 Score =  421 bits (1083), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 206/347 (59%), Positives = 261/347 (75%), Gaps = 9/347 (2%)

Query: 4   VYNKTPLLRQFFPGKNLPQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIG-ERRAHV 62
           VYNKTPL+RQ FP  ++PQ++LK+EC QPSGSFKSRGIG+LI K + RI   G  ++  V
Sbjct: 3   VYNKTPLIRQIFP--SIPQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGKKPMV 60

Query: 63  XXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQHL 122
                           + L+LPCTVV+PTATK RM +KIR TGA VIV+G  WKEAD +L
Sbjct: 61  FASSGGNAGLAAATAAKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYL 120

Query: 123 KKTVMSQID--LKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKGIVCSV 180
           K  ++S+++   K  EPIYVHPFDNPDIWEGHA++VDEI+E   ++ I    +K IVCSV
Sbjct: 121 KDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSV 180

Query: 181 GGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTA 240
           GGGGLYNGI+QGLEK+ LA+KIPIVGVET+GCHV NTSL +NK + F+KITSIATSLGTA
Sbjct: 181 GGGGLYNGIIQGLEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTA 240

Query: 241 SISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNVDILEKA 300
            IS + F+ AK+Y T+SVV+ D  V++TCL+YT DFNMV EPACGAA+HLAY+ +ILEK 
Sbjct: 241 DISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHTEILEKE 300

Query: 301 LGHSLTPNDVILVIACGGSSNTLKDLEDTLVTL----NSKSIPSPPE 343
           LG  L  +D++LV+ACGGSSNT++D+E  L  L    N+ +IP+  E
Sbjct: 301 LGTKLNADDIVLVVACGGSSNTVEDMESILQRLSTEENNINIPNVAE 347

>NCAS0A15330 Chr1 (3015596..3016639) [1044 bp, 347 aa] {ON} 
          Length = 347

 Score =  417 bits (1073), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 191/341 (56%), Positives = 254/341 (74%), Gaps = 5/341 (1%)

Query: 1   MSLVYNKTPLLRQFFPG----KNLPQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIG 56
           MSLVYNKTPLLR+ FP      + PQL++KYE LQPSGSFKSRGIG+LI+KNA+R+Q++G
Sbjct: 1   MSLVYNKTPLLRRVFPTGLKVPSAPQLYVKYESLQPSGSFKSRGIGHLIMKNALRVQQLG 60

Query: 57  ERRAHVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWK 116
            +  HV                Q L LPCTVVVPT+TK+RMVEKIRN G +VIV G+HWK
Sbjct: 61  GKSLHVFSSSGGNAGLAAATASQSLKLPCTVVVPTSTKSRMVEKIRNVGTEVIVKGSHWK 120

Query: 117 EADQHLKKTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKGI 176
           EAD  LK +V+  +D +  EPIYVHPFD+PD+WEGH+T+VDEI++T  SQ +    VK I
Sbjct: 121 EADSFLKNSVIPSVD-RIEEPIYVHPFDHPDVWEGHSTMVDEIVDTFRSQNVSLNKVKAI 179

Query: 177 VCSVGGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIATS 236
           VCSVGGGGLYNGI+ GLEK+ LA+KIP++ +ET GC+  N  L   KQ+E  KITS+ATS
Sbjct: 180 VCSVGGGGLYNGIIHGLEKYHLADKIPVIAMETDGCNSFNACLKAKKQVELPKITSVATS 239

Query: 237 LGTASISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNVDI 296
           LG   ++ + FE  ++Y + SVV+ D  V+ TCLKY  DFN++ EPACGA+LH+AYN  +
Sbjct: 240 LGATGVATKAFENGQRYQSPSVVLQDIDVVNTCLKYANDFNIITEPACGASLHMAYNTKL 299

Query: 297 LEKALGHSLTPNDVILVIACGGSSNTLKDLEDTLVTLNSKS 337
           +EKALG  L  +D+I++IACGGS+NT++DL+++   L++++
Sbjct: 300 IEKALGKKLDSDDIIVIIACGGSANTMEDLQNSYKQLSAEA 340

>ZYRO0F15774g Chr6 (1300486..1301718) [1233 bp, 410 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 410

 Score =  413 bits (1061), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 190/333 (57%), Positives = 248/333 (74%)

Query: 1   MSLVYNKTPLLRQFFPGKNLPQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRA 60
           M  +YNKTPLL+Q F      Q+F+KYECLQPSGSFKSRGIG+LI K A  IQ  G +  
Sbjct: 47  MPSIYNKTPLLKQIFNHATSAQVFVKYECLQPSGSFKSRGIGHLISKRAKDIQGDGRKSP 106

Query: 61  HVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQ 120
           HV                Q+L+LPCTVV+PT TK RM +KIR  GA V+V G+HWKEAD 
Sbjct: 107 HVFSSSGGNAGYAAAVAAQKLNLPCTVVIPTTTKQRMADKIRGCGANVVVQGSHWKEADS 166

Query: 121 HLKKTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKGIVCSV 180
           HLK  + +Q+++   EPIYVHPFDNP IWEGHA++VDEI+ +L ++      VKGIVCSV
Sbjct: 167 HLKNILQNQVNMAILEPIYVHPFDNPTIWEGHASIVDEIISSLKNENTALNRVKGIVCSV 226

Query: 181 GGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTA 240
           GGGGLYNGI+QGLEK+ LA KIP++ VET+GCHVLNTSL + + +EF K+ S+ATSL T+
Sbjct: 227 GGGGLYNGIIQGLEKYNLANKIPLLAVETKGCHVLNTSLQVGQCVEFNKMNSVATSLCTS 286

Query: 241 SISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNVDILEKA 300
            IS +T +  +KY ++S+V++D +V++TCLKY  +FNM+ EPACGA+LHL Y+  ++E+A
Sbjct: 287 QISSRTLDYVQKYGSKSIVLEDKEVLQTCLKYAENFNMITEPACGASLHLGYHPQLIERA 346

Query: 301 LGHSLTPNDVILVIACGGSSNTLKDLEDTLVTL 333
           LG +L  +DVI+VIACGGSSNT+ DLE++L  L
Sbjct: 347 LGKNLDKDDVIIVIACGGSSNTILDLEESLAKL 379

>SAKL0C00418g Chr3 complement(37529..38623) [1095 bp, 364 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 364

 Score =  409 bits (1052), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 197/343 (57%), Positives = 242/343 (70%), Gaps = 3/343 (0%)

Query: 1   MSLVYNKTPLLRQFFPGKNL---PQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGE 57
           M+  Y+KTPLLR+ FP   L   PQ  +KYE  QPSGSFKSRGIG+LI ++A RI+  G 
Sbjct: 1   MTSFYSKTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGN 60

Query: 58  RRAHVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKE 117
           + AHV               C+  SLPCTVVVPT T  RMV KIR TGA VIV+G HW +
Sbjct: 61  KTAHVFASSGGNAGLAAATACRAFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGD 120

Query: 118 ADQHLKKTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKGIV 177
           ADQ+L ++VM  ID    EP+Y HPFDNP IWEGH+T+VDEI+E+L  Q+I    VKGIV
Sbjct: 121 ADQYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIV 180

Query: 178 CSVGGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIATSL 237
           CS+GGGGLYNGI++GLEKH LA  IPI+GVET+GC V + SL   K + F+KITS+ATSL
Sbjct: 181 CSIGGGGLYNGIIEGLEKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSL 240

Query: 238 GTASISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNVDIL 297
           GTA+I K+T E A KYNT+SVV+ D+ V+ TCL +  D N+V EPACGA+LH  YN  +L
Sbjct: 241 GTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNPHLL 300

Query: 298 EKALGHSLTPNDVILVIACGGSSNTLKDLEDTLVTLNSKSIPS 340
           E  LG SL P D+I+VIACGGSS T++DL+   V L     PS
Sbjct: 301 EDTLGGSLGPEDIIIVIACGGSSTTVQDLQQMQVRLGRPLTPS 343

>NDAI0K02950 Chr11 (671102..672106) [1005 bp, 334 aa] {ON} 
          Length = 334

 Score =  392 bits (1008), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 188/337 (55%), Positives = 247/337 (73%), Gaps = 6/337 (1%)

Query: 1   MSLVYNKTPLLRQFFPGKNL-PQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERR 59
           MS +YNKTPLLRQ F    + P++FLKYE LQPSGSFKSRGIG LIL++  ++++ G + 
Sbjct: 1   MSFIYNKTPLLRQTFDSAKIGPRIFLKYENLQPSGSFKSRGIGCLILQHINKLKQDGNKT 60

Query: 60  AHVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEAD 119
           AHV                + L +PCTVVVP +TK RMV KIR TGA V++ G HWKEAD
Sbjct: 61  AHVFSSSGGNAGLAAATASRSLQVPCTVVVPKSTKERMVNKIRKTGASVLIKGDHWKEAD 120

Query: 120 QHLKKTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKGIVCS 179
             L+K+ M ++D    +PIYVHPFD+P IWEGH+T++DEI++TL ++KI  E VKGI+CS
Sbjct: 121 DFLRKS-MKEMDNTQEQPIYVHPFDDPVIWEGHSTIIDEIVQTLQTEKISIEKVKGIICS 179

Query: 180 VGGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGT 239
           VGGGGL+NGI++GLE+H LA+ IP++ VET+GC VLN SL     ++  KITS+ATSLG+
Sbjct: 180 VGGGGLFNGIIKGLERHNLAQSIPVIAVETKGCDVLNKSLKNGTPVQLPKITSVATSLGS 239

Query: 240 ASISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNVDILEK 299
             IS   FE A KYN+RS+ ++D  V+ETCLKY  DF+M  EPACGA++HLAYN  I+E 
Sbjct: 240 TYISSTAFENAMKYNSRSITLNDKDVLETCLKYNDDFSMTLEPACGASVHLAYNPGIVES 299

Query: 300 ALGHSLTPNDVILVIACGGSSNTLKDLEDTLVTLNSK 336
           ALG +L+ +D+++V+ CGGSS TL DLE    +LNSK
Sbjct: 300 ALGTALSNHDIVIVVLCGGSSCTLHDLE----SLNSK 332

>ZYRO0F18524g Chr6 (1528741..1529748) [1008 bp, 335 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 335

 Score =  362 bits (928), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 173/330 (52%), Positives = 238/330 (72%), Gaps = 9/330 (2%)

Query: 1   MSLVYNKTPLLRQFFPGKN---LPQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGE 57
           M+  Y KTPLLRQ    K    LPQ+F+KYE LQP GSFKSRGIGNLI   +++ +  G 
Sbjct: 1   MNNWYYKTPLLRQILNWKTTTELPQIFIKYENLQPGGSFKSRGIGNLI---SLKSEN-GL 56

Query: 58  RRAHVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKE 117
            ++HV                +++ LPCTVVVPT+TK RMV+KI+N+GA+VI+ G+HWKE
Sbjct: 57  VKSHVLSSSGGNAGLAAAIASKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHWKE 116

Query: 118 ADQHLKKTVMSQI-DLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKGI 176
           AD +L++  +    +  T++P+YVHPFD+P +WEGH+T+V EI++ L  Q I  ENV+GI
Sbjct: 117 ADNYLQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENVRGI 176

Query: 177 VCSVGGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIATS 236
           VCSVGGGGL+NGI++GLE HGLA+KIP++ VET GC+VLN SLN  + +  +KITS+ATS
Sbjct: 177 VCSVGGGGLFNGIIKGLEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSLATS 236

Query: 237 LGTASISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNVDI 296
           LG+  I +  FE A +Y  +S+V++D  VIETCL+Y  DF  + EPACGA+LH+ Y+ ++
Sbjct: 237 LGSTYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGYHPEL 296

Query: 297 LEKALGHSLTPNDVILVIACGGSSNTLKDL 326
           LE  LG   + +D+I++IACGGS+ T KDL
Sbjct: 297 LENFLG-GFSKDDIIVIIACGGSTTTFKDL 325

>KLTH0F00440g Chr6 complement(34215..35240) [1026 bp, 341 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 341

 Score =  360 bits (923), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 175/331 (52%), Positives = 230/331 (69%), Gaps = 5/331 (1%)

Query: 1   MSLVYNKTPLLRQFFPGK-----NLPQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKI 55
           M   + KTPLL  +F        N PQ  LK E LQPSGSFKSRGIG +I K A++I+  
Sbjct: 1   MKSAFVKTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSE 60

Query: 56  GERRAHVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHW 115
           G +  HV                + LS+PC+VVVP +T  RMV+KI N GA+V V G +W
Sbjct: 61  GNKLPHVFASSGGNAGLAAATTSRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNW 120

Query: 116 KEADQHLKKTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKG 175
           KEAD+ LK++++S  +   T+ IY HPFD+P IWEGH+++VDEI+++L  QKI  +N+K 
Sbjct: 121 KEADKFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKA 180

Query: 176 IVCSVGGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIAT 235
           IVCSVGGGGLYNGI++GL +H L  KIPI+GVE++GC V N+SL L K  EFE ITSIAT
Sbjct: 181 IVCSVGGGGLYNGIIEGLSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIAT 240

Query: 236 SLGTASISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNVD 295
           S+GT SISK+T E A +Y+T+SVV+ D ++I TCL++  + N++ EPACGAALHL Y  D
Sbjct: 241 SIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYYPD 300

Query: 296 ILEKALGHSLTPNDVILVIACGGSSNTLKDL 326
           IL +AL    TP DVI++I CGGS+ +  DL
Sbjct: 301 ILYQALNSDFTPEDVIIMIGCGGSATSYNDL 331

>KNAG0D05380 Chr4 complement(986308..987312) [1005 bp, 334 aa] {ON} 
          Length = 334

 Score =  356 bits (913), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 173/335 (51%), Positives = 229/335 (68%), Gaps = 2/335 (0%)

Query: 1   MSLVYNKTPLLRQFFPGKNLPQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRA 60
           M  +YNKTPLL +   G + P    KYE +QP GSFK RG+ +LI K   +I+  G++  
Sbjct: 1   MPALYNKTPLLPKNLSGGDGPTFLFKYENMQPGGSFKIRGVSHLIEKRVEQIKSEGKKPP 60

Query: 61  HVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQ 120
           HV               C  LS+PCTVVVPT TK RMVEKIR   A+VIV G++WKEAD 
Sbjct: 61  HVFSSSGGNAGLAAATACHILSIPCTVVVPTLTKPRMVEKIRKANAEVIVKGSNWKEADD 120

Query: 121 HLKKTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKGIVCSV 180
           +L+ TV++  +    +PIYV+PFD+P +WEGH+T++DEI+  LN + I+ + VKGIVCSV
Sbjct: 121 YLRGTVIASNN--AVQPIYVNPFDDPLLWEGHSTMIDEILNALNQENIKLDAVKGIVCSV 178

Query: 181 GGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTA 240
           GGGGL+NGI+ GLE H LA  IP+V VET+GC VL  SL   K +   KI SIATSLG++
Sbjct: 179 GGGGLFNGIVHGLENHQLACTIPVVAVETKGCDVLGLSLAAEKPVRLNKIDSIATSLGSS 238

Query: 241 SISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNVDILEKA 300
            +S Q F+ A K+ +RSVV+ DS V+ TC +Y  DFN + EPACGA +H AY+  ILEKA
Sbjct: 239 YVSCQAFDNAVKFKSRSVVLHDSDVLNTCYRYLDDFNAIVEPACGATIHTAYHYKILEKA 298

Query: 301 LGHSLTPNDVILVIACGGSSNTLKDLEDTLVTLNS 335
           LG  LTP+D+I++I CGGS  T++DLE+    L++
Sbjct: 299 LGQKLTPSDIIIIIVCGGSCVTIQDLENAKRKLDT 333

>AFR747W Chr6 (1808016..1809296) [1281 bp, 426 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL064C (CHA1)
          Length = 426

 Score =  355 bits (911), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 177/341 (51%), Positives = 233/341 (68%), Gaps = 7/341 (2%)

Query: 1   MSLVYNKTPLLRQFFPGKNL-----PQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKI 55
           M+  Y KTPL+R  F  +N+     P++ LKYE  QPSGSFKSRGIGNLI K   +I++ 
Sbjct: 69  MASFYCKTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQN 128

Query: 56  GERRAHVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHW 115
              + HV                ++L LPCTVVVP  T+ RMVE+IR+TGA VI  G+  
Sbjct: 129 SSLQPHVFASSGGNAGLAAATASRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVL 188

Query: 116 KEADQHLKKTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKG 175
           KE+D +L+  +M  ++L+   PIY HPFDNP IWEGHAT+VDE++E L+ Q +Q E+VKG
Sbjct: 189 KESDDYLRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKG 248

Query: 176 IVCSVGGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIAT 235
           IVCSVGGGGLYNGI+ GLEKHGLA+ IP+V VET GC VL+ SL L + +      S+AT
Sbjct: 249 IVCSVGGGGLYNGIVYGLEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNP-KSVAT 307

Query: 236 SLGTASISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNVD 295
           SL T+ ++  T   A+KY T+SVV+D   V++TCL +  + N+V EPACGAALHL Y+ +
Sbjct: 308 SLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHLGYHPE 367

Query: 296 ILEKALGHSLTPNDVILVIACGGSSNTLKDLEDTLVTLNSK 336
           ILE+ LG  LTP DV++VIACGGS+  L DL+++   L  K
Sbjct: 368 ILERELG-PLTPQDVVIVIACGGSTMNLADLKESEDQLQPK 407

>SAKL0C13904g Chr3 (1223973..1224992) [1020 bp, 339 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 339

 Score =  345 bits (885), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 165/324 (50%), Positives = 224/324 (69%), Gaps = 1/324 (0%)

Query: 5   YNKTPLL-RQFFPGKNLPQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRAHVX 63
           YNKTPLL R        P+ FLKYE LQP GSFKSRGIG L+ K+  + ++ G +   V 
Sbjct: 8   YNKTPLLPRVLTTTDGAPRFFLKYEFLQPGGSFKSRGIGYLVKKSYEKARRDGGKSLAVF 67

Query: 64  XXXXXXXXXXXXXXCQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQHLK 123
                          Q  S+ CTVVVP  TK+RMVEKIR TGA+V+V G HW  AD++L+
Sbjct: 68  SSSGGNAGLAAAIAAQTFSINCTVVVPRTTKSRMVEKIRKTGAEVLVYGKHWGMADEYLR 127

Query: 124 KTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKGIVCSVGGG 183
           + VM ++D+    P+YVHPFDNP IW+GH+T+VDE++  L  + +  + VK IVCSVGGG
Sbjct: 128 EVVMKEVDVSKVVPLYVHPFDNPIIWQGHSTIVDEVVAQLKEENVSIDKVKAIVCSVGGG 187

Query: 184 GLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTASIS 243
           GLYNGI++GLE H LA++IPI+ +ET+GC VLN SLN    +  E +TS+A+SL +  IS
Sbjct: 188 GLYNGIVKGLETHQLADRIPILAIETKGCDVLNKSLNSGNPVVLESLTSVASSLASPYIS 247

Query: 244 KQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNVDILEKALGH 303
           ++ FE A+KY ++S+++ DS+VIETCL +  D  +V EPACGA+L+  Y+ ++L   +G 
Sbjct: 248 EKAFENARKYESKSILLKDSQVIETCLNFADDAGIVVEPACGASLYSCYHPELLPLYIGK 307

Query: 304 SLTPNDVILVIACGGSSNTLKDLE 327
            LT +DVI+VIACGGS+ T KDLE
Sbjct: 308 ELTEDDVIVVIACGGSAVTYKDLE 331

>KLLA0C00440g Chr3 complement(32008..33141) [1134 bp, 377 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 377

 Score =  346 bits (888), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 165/326 (50%), Positives = 227/326 (69%), Gaps = 1/326 (0%)

Query: 4   VYNKTPLLRQFFPGKNLPQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIG-ERRAHV 62
           +++KTPLL+  F     PQ+ LKYE LQPSGSFKSRGIG+LI      I+K   E+  HV
Sbjct: 24  LFSKTPLLKHQFKRSKGPQVLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSPEKIGHV 83

Query: 63  XXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQHL 122
                             L++PCTVVV  AT+ R++EKIR+ GA V+V+G HWKEAD  +
Sbjct: 84  FASSGGNAGLAAAVASLELNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEADSFM 143

Query: 123 KKTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKGIVCSVGG 182
           K+ +M ++D    EPIY HPFDNP IWEGH+ +VDEIM+ L S KI    +KGIVCS GG
Sbjct: 144 KEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVCSFGG 203

Query: 183 GGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTASI 242
           GGLYNG++ GL+++ LA+KIPIV VET+G  VL+ SL +   +EFEKI+S ATSLGTA+I
Sbjct: 204 GGLYNGLILGLQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLGTATI 263

Query: 243 SKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNVDILEKALG 302
           S   ++  K++ ++S V+ D++VI TCL+++ D N+VAEP CGA L+  YN+D L+  LG
Sbjct: 264 STTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNIDKLQNILG 323

Query: 303 HSLTPNDVILVIACGGSSNTLKDLED 328
             +  +D +++I CGGSS +L+DL++
Sbjct: 324 SDIKDDDYVILIGCGGSSTSLEDLKE 349

>Smik_9.2 Chr9 (6779..7795) [1017 bp, 338 aa] {ON} YCL064C (REAL)
          Length = 338

 Score =  337 bits (863), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 164/323 (50%), Positives = 222/323 (68%), Gaps = 1/323 (0%)

Query: 5   YNKTPLLRQFFP-GKNLPQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRAHVX 63
           Y KTPL+RQ F  GK  P  ++K++ LQP GSFKSRGIG+LI K        G  +  V 
Sbjct: 6   YEKTPLIRQVFDNGKTNPLFYIKHDMLQPGGSFKSRGIGHLIRKKNKEALAEGSGKLVVF 65

Query: 64  XXXXXXXXXXXXXXCQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQHLK 123
                         C+ ++L CTVVVP  TK+RMV+KI++ GAKVI++G HW EAD++LK
Sbjct: 66  SSSGGNAGLAAATSCRLMALNCTVVVPKTTKSRMVKKIQSAGAKVIIHGDHWGEADEYLK 125

Query: 124 KTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKGIVCSVGGG 183
           + VM+Q     ++ +YVHPFD+  IWEGH+T+VDEI++ L  + I    VKG+VCSVGGG
Sbjct: 126 QEVMAQEGQHGSKTLYVHPFDDEIIWEGHSTIVDEILQQLQEKDISPLQVKGLVCSVGGG 185

Query: 184 GLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTASIS 243
           GL++GI++GLE++ LA KIPIV VET GC VLN SL     +  E++TS+ATSLG+  I+
Sbjct: 186 GLFSGIIKGLERNRLAGKIPIVAVETAGCDVLNKSLKNGSPVALERLTSVATSLGSPYIA 245

Query: 244 KQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNVDILEKALGH 303
              FE    Y  +SVV+ D  V++TCL+Y  D+N + EPACGA+LHL Y+ +ILEKALG 
Sbjct: 246 PFAFESFITYGCKSVVLSDQDVLDTCLRYADDYNFIVEPACGASLHLCYHPEILEKALGQ 305

Query: 304 SLTPNDVILVIACGGSSNTLKDL 326
            L+ +DV+++IACGGS  T +DL
Sbjct: 306 KLSEDDVVIIIACGGSCMTYEDL 328

>Ecym_1006 Chr1 complement(9635..10729) [1095 bp, 364 aa] {ON}
           similar to Ashbya gossypii AFR747W
          Length = 364

 Score =  336 bits (862), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 168/351 (47%), Positives = 231/351 (65%), Gaps = 10/351 (2%)

Query: 1   MSLVYNKTPLLRQFFPGKNL-----PQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKI 55
           MS +Y KTPLLR+ F   N+     PQ  +KYE  QPSGSFKSRGIGNLI      I++ 
Sbjct: 1   MSSLYVKTPLLRRAFGKPNIQISKVPQFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRRD 60

Query: 56  GERRAHVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHW 115
             ++ HV                QR+ +PCTVVVPT+T+ R++EKI  TGA +I  G ++
Sbjct: 61  PAKQPHVFSSSGGNAGLAAATASQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDYF 120

Query: 116 KEADQHLKKTVMSQIDLKTTE----PIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTE 171
            EAD +LK  +    +  T +    PIYVHPF++P IW GH+ +V+EI+E+L ++ I   
Sbjct: 121 AEADSYLKDLMQEAANKNTRDKKNVPIYVHPFNHPLIWHGHSYIVEEILESLRNENIPYS 180

Query: 172 NVKGIVCSVGGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKIT 231
            VKGIVCSVGGGGLYNGI++GLE+H LA  IPI+GVET GC VL+ SL   K I F+K  
Sbjct: 181 RVKGIVCSVGGGGLYNGIIEGLERHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKKAL 240

Query: 232 SIATSLGTASISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLA 291
           S+ATSL   +I+K+T   A+KY T+S+V+ + +V++TCL++T + N+V EPACGA LHL 
Sbjct: 241 SVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLHLG 300

Query: 292 YNVDILEKALGHSLTPNDVILVIACGGSSNTLKDLEDTLVTLNSKSIPSPP 342
           Y+  IL K LG  L+  D++++IACGGS+ TL DL +  +  N  ++   P
Sbjct: 301 YHPAILHKELG-PLSSEDIVILIACGGSATTLADLRELKLKYNPVTLDDSP 350

>Scer_YGOB_SDL1 Chr9 (29032..29411,29415..30048) [1014 bp, 337 aa]
           {ON} ANNOTATED BY YGOB - Skipping over stop codon in
           S288c
          Length = 337

 Score =  323 bits (827), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 160/331 (48%), Positives = 216/331 (65%), Gaps = 2/331 (0%)

Query: 5   YNKTPLLRQFFP-GKNLPQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRAHVX 63
           Y KTPL+RQF   GK     ++K+E LQP GSFKSRGIG+LI K+       G  +  V 
Sbjct: 6   YEKTPLIRQFLNNGKTNSWFYVKHEMLQPGGSFKSRGIGHLIRKSNEEALSEGSGKLAVF 65

Query: 64  XXXXXXXXXXXXXXCQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQHLK 123
                         C+ ++L C+VVVP  TK RMV+KI++ GAKVI++G HW EAD++L+
Sbjct: 66  SSSGGNAGLAAATACRSMALNCSVVVPKTTKPRMVKKIQSAGAKVIIHGDHWGEADEYLR 125

Query: 124 KTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKGIVCSVGGG 183
              M+Q     ++ +YVHPFDN  IWEGH+T+VDEI+E L    I    VK +VCSVGGG
Sbjct: 126 HE-MAQESQHGSKTLYVHPFDNETIWEGHSTIVDEIIEQLKENDISLPRVKALVCSVGGG 184

Query: 184 GLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTASIS 243
           GL++GI++GL+++ LAEKIP+V VET GC VLN SL     +  EK+TS+ATSL +  I+
Sbjct: 185 GLFSGIIKGLDRNQLAEKIPVVAVETAGCDVLNKSLKKGSPVTLEKLTSVATSLASPYIA 244

Query: 244 KQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNVDILEKALGH 303
              FE   KY  +SVV+ D  V+ TCL+Y  D+N + EPACGA+LHL Y+ +ILE  L  
Sbjct: 245 SFAFESFNKYGCKSVVLSDQDVLATCLRYADDYNFIVEPACGASLHLCYHPEILEDILEQ 304

Query: 304 SLTPNDVILVIACGGSSNTLKDLEDTLVTLN 334
            +  +D++++IACGGS  T +DL     TLN
Sbjct: 305 KIYEDDIVIIIACGGSCMTYEDLVKASSTLN 335

>Skud_9.2 Chr9 (5919..6938) [1020 bp, 339 aa] {ON} YCL064C (REAL)
          Length = 339

 Score =  322 bits (824), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 153/326 (46%), Positives = 220/326 (67%), Gaps = 1/326 (0%)

Query: 5   YNKTPLLRQFFP-GKNLPQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRAHVX 63
           Y +TPL+ Q F  G+  P+L++K+E LQP GSFKSRGIG+LI ++       G  +  V 
Sbjct: 6   YERTPLIHQVFNNGQTGPRLYVKHEMLQPGGSFKSRGIGHLINRSNEEALADGSGKLAVF 65

Query: 64  XXXXXXXXXXXXXXCQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQHLK 123
                         C  ++L CTVVVP  TK+RM++KI+N GAKVI++G+HW EAD++L+
Sbjct: 66  SSSGGNAGLAAATACSSMALDCTVVVPKTTKSRMIKKIQNAGAKVIIHGSHWGEADEYLR 125

Query: 124 KTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKGIVCSVGGG 183
           + +M Q     ++ +YVHPFD+  IWEGH+T+VDE+++ L  + I    +K +VCSVGGG
Sbjct: 126 QELMIQESQLGSKTLYVHPFDDERIWEGHSTIVDEVLQQLQEKNISLARIKAMVCSVGGG 185

Query: 184 GLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTASIS 243
           GL++GI++GLE++ LA KI ++ VET GC VLN SL     I  E+++SIATSLG+  I+
Sbjct: 186 GLFSGIIKGLERNNLAGKIRVIAVETIGCDVLNKSLVNGSPITLERLSSIATSLGSPYIA 245

Query: 244 KQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNVDILEKALGH 303
              FE    Y  +SVV+ D  V+ TCL+Y  D+N + EPACGA+LHL Y+ +ILE AL  
Sbjct: 246 PFAFESFNAYGCKSVVLSDQDVLATCLRYADDYNSIVEPACGASLHLCYHQEILENALEQ 305

Query: 304 SLTPNDVILVIACGGSSNTLKDLEDT 329
            L+ +D++++IACGGS  T +DL +T
Sbjct: 306 KLSDDDIVIIIACGGSCMTYEDLVET 331

>TDEL0D06540 Chr4 (1175562..1176575) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score =  310 bits (795), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 154/324 (47%), Positives = 210/324 (64%), Gaps = 3/324 (0%)

Query: 6   NKTPLLRQFF--PGKNLPQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRAHVX 63
           +K+PLL + F    K+ PQ FLKYE LQPSGSFKSRGIG LI   A   +       HV 
Sbjct: 5   HKSPLLNRRFKESEKDGPQFFLKYETLQPSGSFKSRGIGYLINSKAKEARSRDGSDVHVF 64

Query: 64  XXXXXXXXXXXXXXCQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQHLK 123
                          + L+L CTVVVP  TK  M+++I+N G++VIV+G HW  AD +LK
Sbjct: 65  SSSGGNAGLAAANASKLLNLNCTVVVPVTTKRHMIDRIQNAGSQVIVHGTHWGMADTYLK 124

Query: 124 KTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKGIVCSVGGG 183
           + VM ++     EP+YVHPFD+P +WEGH+ ++DEI+E L  Q     +VKGI+CSVGGG
Sbjct: 125 EVVMKKVP-SNVEPLYVHPFDDPLVWEGHSFMIDEIVEQLQEQGRSMRDVKGIICSVGGG 183

Query: 184 GLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTASIS 243
           GLYNGI+ GLE+HG A KIPI+ VET G   L  SL   K +   ++TSIA+SLG+  I+
Sbjct: 184 GLYNGIVGGLERHGYAGKIPIIAVETVGADALAKSLAAGKPVRLTEVTSIASSLGSPYIA 243

Query: 244 KQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNVDILEKALGH 303
           + +FE A +Y TRS V  D + + T L++ ++ N++ EPAC A++ L Y+VD L K L  
Sbjct: 244 QDSFEKAIRYKTRSFVQTDEEAVRTSLRFFQETNILVEPACAASVSLCYHVDELNKLLSC 303

Query: 304 SLTPNDVILVIACGGSSNTLKDLE 327
            L+  D+++VI CGGS+ T+ DLE
Sbjct: 304 KLSSKDIVIVIVCGGSATTISDLE 327

>KLLA0E01805g Chr5 complement(173125..174093) [969 bp, 322 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 322

 Score =  300 bits (767), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 152/321 (47%), Positives = 207/321 (64%), Gaps = 8/321 (2%)

Query: 7   KTPLLRQFFPGKNLPQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRAHVXXXX 66
           KTPLL    P    P   LKYE LQP GSFKSRGI +LI K  M      E    V    
Sbjct: 7   KTPLLPFREPLNGGPTFLLKYENLQPGGSFKSRGISHLI-KTTMDSISDPENELAVYSSS 65

Query: 67  XXXXXXXXXXXCQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQHLKKTV 126
                      C  L +PCTV+VP +TK RM++KI + GAKV++ G HWKEAD +L++ V
Sbjct: 66  GGNAGLAAARACATLKVPCTVIVPKSTKPRMIKKIESAGAKVVIFGDHWKEADTYLREYV 125

Query: 127 MSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKGIVCSVGGGGLY 186
           M Q     T  +YVHPFDNP IW+GH+T++DEI+E L        +VKGIVCSVGGGGLY
Sbjct: 126 MRQSSYSNT--LYVHPFDNPIIWDGHSTMIDEIIEQLAESHTDINDVKGIVCSVGGGGLY 183

Query: 187 NGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTASISKQT 246
           NG++ GLE+HGLA  IP+  +ET GC VL+ SL   + +  ++I+SIATSLG+  I   +
Sbjct: 184 NGVVNGLERHGLAGSIPVFAMETDGCDVLSKSLIAGEPVVLDRISSIATSLGSTEICADS 243

Query: 247 FELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNVDILEKALGHSLT 306
           F+ A K++++S+V+DD  V++TCL++  + +++ EPACGA+LH  Y  ++L       L 
Sbjct: 244 FQKAIKFSSKSIVLDDKNVVDTCLRFFDETSILVEPACGASLHTCYRPELLGP-----LG 298

Query: 307 PNDVILVIACGGSSNTLKDLE 327
           P+D+++VI CGGS NT  DL+
Sbjct: 299 PDDIVVVILCGGSCNTYDDLK 319

>KNAG0A01150 Chr1 (6346..7041) [696 bp, 231 aa] {ON}
          Length = 231

 Score =  258 bits (660), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 124/231 (53%), Positives = 171/231 (74%), Gaps = 4/231 (1%)

Query: 107 KVIVNGAHWKEADQHLKKTVMSQIDL-KTTEPIYVHPFDNPDIWEGHATLVDEIMETLNS 165
           +V V+ A+ KEAD +L+  V   IDL K  +PIYV+PFD+P IWEGH+T++DEI+ TL  
Sbjct: 4   EVFVHVANLKEADYYLQNVV---IDLYKDVQPIYVNPFDDPLIWEGHSTIIDEILNTLTQ 60

Query: 166 QKIQTENVKGIVCSVGGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQI 225
           + I+  +VKGI+CS  GGGLYNGIMQGLEK+ LA  IP+V VET+GC VLN SL  NK +
Sbjct: 61  ENIEVGSVKGIICSFSGGGLYNGIMQGLEKYDLAYNIPVVAVETKGCDVLNLSLAANKPV 120

Query: 226 EFEKITSIATSLGTASISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACG 285
           + + ITSIA SLG++ +S++ F+   KY+++S+V++DS  ++TC KY  DF  V EPACG
Sbjct: 121 QLDSITSIAKSLGSSVVSQKVFDNVIKYHSKSLVLNDSDALDTCFKYLDDFGTVLEPACG 180

Query: 286 AALHLAYNVDILEKALGHSLTPNDVILVIACGGSSNTLKDLEDTLVTLNSK 336
           A++H AY+ ++LE+AL   L P+DVI++IACGGS  T +DLE   V L +K
Sbjct: 181 ASVHTAYHYNVLEEALDQKLRPDDVIIIIACGGSCATFQDLERAKVQLGNK 231

>YIL167W Chr9 (29416..30048) [633 bp, 210 aa] {OFF}  SDL1Open
           reading frame, unlikely to produce a functional protein
           in S288C; in closely related species and other S.
           cerevisiae strain backgrounds YIL167W and adjacent
           ORF, YIL168W, constitute a single ORF encoding L-serine
           dehydratase
          Length = 210

 Score =  222 bits (566), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 142/208 (68%)

Query: 127 MSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKGIVCSVGGGGLY 186
           M+Q     ++ +YVHPFDN  IWEGH+T+VDEI+E L    I    VK +VCSVGGGGL+
Sbjct: 1   MAQESQHGSKTLYVHPFDNETIWEGHSTIVDEIIEQLKENDISLPRVKALVCSVGGGGLF 60

Query: 187 NGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTASISKQT 246
           +GI++GL+++ LAEKIP+V VET GC VLN SL     +  EK+TS+ATSL +  I+   
Sbjct: 61  SGIIKGLDRNQLAEKIPVVAVETAGCDVLNKSLKKGSPVTLEKLTSVATSLASPYIASFA 120

Query: 247 FELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNVDILEKALGHSLT 306
           FE   KY  +SVV+ D  V+ TCL+Y  D+N + EPACGA+LHL Y+ +ILE  L   + 
Sbjct: 121 FESFNKYGCKSVVLSDQDVLATCLRYADDYNFIVEPACGASLHLCYHPEILEDILEQKIY 180

Query: 307 PNDVILVIACGGSSNTLKDLEDTLVTLN 334
            +D++++IACGGS  T +DL     TLN
Sbjct: 181 EDDIVIIIACGGSCMTYEDLVKASSTLN 208

>YIL168W Chr9 (29032..29415) [384 bp, 127 aa] {OFF} Open reading
           frame, unlikely to produce a functional protein in
           S288C; in closely related species and other S.
           cerevisiae strain backgrounds YIL168W and adjacent
           ORF, YIL167W, constitute a single ORF encoding L-serine
           dehydratase
          Length = 127

 Score =  109 bits (272), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 55/120 (45%), Positives = 74/120 (61%), Gaps = 1/120 (0%)

Query: 5   YNKTPLLRQFFP-GKNLPQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRAHVX 63
           Y KTPL+RQF   GK     ++K+E LQP GSFKSRGIG+LI K+       G  +  V 
Sbjct: 6   YEKTPLIRQFLNNGKTNSWFYVKHEMLQPGGSFKSRGIGHLIRKSNEEALSEGSGKLAVF 65

Query: 64  XXXXXXXXXXXXXXCQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQHLK 123
                         C+ ++L C+VVVP  TK RMV+KI++ GAKVI++G HW EAD++L+
Sbjct: 66  SSSGGNAGLAAATACRSMALNCSVVVPKTTKPRMVKKIQSAGAKVIIHGDHWGEADEYLR 125

>SAKL0F11858g Chr6 (920767..922455) [1689 bp, 562 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 562

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 71/260 (27%), Positives = 119/260 (45%), Gaps = 19/260 (7%)

Query: 25  LKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRAHVXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N+I K         ++   V                + L++P
Sbjct: 83  LKREDLLPVFSFKLRGAYNMIAK-----LDESQKTQGVIACSAGNHAQGVAYASKHLNIP 137

Query: 85  CTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQHLKKTVMSQIDLKTTEPIYVHPFD 144
            T+V+P +T +   + +   G++V++ G  + EA     K  +++    T  P    PFD
Sbjct: 138 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTK--LTEERGLTNIP----PFD 191

Query: 145 NPDIWEGHATLVDEIMETL-NSQKIQTENVKGIVCSVGGGGLYNGIMQGLEKHGLAEKIP 203
           +P +  G  T+  EI+  + N+ KI     K + C+VGGGGL  G+   L++  +A  I 
Sbjct: 192 HPYVIAGQGTIAMEILRQVHNASKI-----KAVFCAVGGGGLITGVGAYLKR--IAPHIK 244

Query: 204 IVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTASISKQTFELAKKYNTRSVVVDDS 263
           ++GVET     L+TSL   K++    + + A       I ++TF +AK      V+V+  
Sbjct: 245 VIGVETYDAATLHTSLKAGKRVPLPNVGTFADGTSVRMIGEETFRVAKDVVDEVVLVNTD 304

Query: 264 KVIETCLKYTRDFNMVAEPA 283
           ++         D   + EP+
Sbjct: 305 EICAAVKDIFEDTRSIVEPS 324

>KAFR0K01700 Chr11 (352943..354682) [1740 bp, 579 aa] {ON} Anc_7.367
           YER086W
          Length = 579

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 75/282 (26%), Positives = 128/282 (45%), Gaps = 20/282 (7%)

Query: 25  LKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRAHVXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N+I K    ++  G     V                ++L +P
Sbjct: 100 LKREDLLPVFSFKLRGAYNMIAKLDDNVRNQG-----VIACSAGNHAQGVAYAAKKLGIP 154

Query: 85  CTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQHLKKTVMSQIDLKTTEPIYVHPFD 144
            T+V+P +T +   + +   G++V++ G  + EA     K  +S+    T  P    PFD
Sbjct: 155 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAK--LSEERGLTNIP----PFD 208

Query: 145 NPDIWEGHATLVDEIMETL-NSQKIQTENVKGIVCSVGGGGLYNGIMQGLEKHGLAEKIP 203
           +P +  G  T+  EI+  + N+ KI       +   VGGGGL  G+   L++  +A  I 
Sbjct: 209 HPYVIAGQGTVAMEILRQVHNANKIN-----AVFVPVGGGGLIAGVGAYLKR--IAPHIK 261

Query: 204 IVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTASISKQTFELAKKYNTRSVVVDDS 263
           ++GVET     L+TSL   K+ E  K+ + A       I ++TF +A++     V+V+  
Sbjct: 262 VIGVETYDATTLHTSLQNGKRTELTKVGTFADGTSVRLIGEETFRVAQEVVDEIVLVNTD 321

Query: 264 KVIETCLKYTRDFNMVAEPACGAALH-LAYNVDILEKALGHS 304
           ++         D   + EP+   ++  +   + +L   + HS
Sbjct: 322 ELCAAIKDVFEDTRSILEPSGALSVAGMKKYISVLHPEIDHS 363

>CAGL0I05126g Chr9 complement(481145..482860) [1716 bp, 571 aa] {ON}
           highly similar to uniprot|P00927 Saccharomyces
           cerevisiae YER086w ILV1 anabolic serine and threonine
           dehydratase precursor
          Length = 571

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 72/265 (27%), Positives = 117/265 (44%), Gaps = 19/265 (7%)

Query: 25  LKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRAHVXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N+I K         +R   V                + L +P
Sbjct: 92  LKREDLLPVFSFKLRGAYNMIAK-----LDDTQRNQGVIACSAGNHAQGVAYAARHLDIP 146

Query: 85  CTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQHLKKTVMSQIDLKTTEPIYVHPFD 144
            T+V+P +T +   + +   G++V++ G  + EA     K  +++    T  P    PFD
Sbjct: 147 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTK--LAEERGLTNIP----PFD 200

Query: 145 NPDIWEGHATLVDEIM-ETLNSQKIQTENVKGIVCSVGGGGLYNGIMQGLEKHGLAEKIP 203
           +P +  G  T+  EI+ +  NS KI       +   VGGGGL  G+   L++  +   I 
Sbjct: 201 HPYVIAGQGTVAMEILRQVYNSNKI-----GAVFVPVGGGGLIAGVGAYLKR--VTPHIK 253

Query: 204 IVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTASISKQTFELAKKYNTRSVVVDDS 263
           I+GVET     L+TSL  NK+     + + A       I ++TF +A++     V+V+  
Sbjct: 254 IIGVETHDAATLHTSLQRNKRTNLASVGTFADGTSVRIIGEETFRVAREVVDEIVLVNTD 313

Query: 264 KVIETCLKYTRDFNMVAEPACGAAL 288
           ++         D   + EP+   A+
Sbjct: 314 EICAAVKDVFEDTRSIVEPSGALAV 338

>Ecym_4708 Chr4 (1386138..1387850) [1713 bp, 570 aa] {ON} similar to
           Ashbya gossypii ACR232C
          Length = 570

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 73/288 (25%), Positives = 131/288 (45%), Gaps = 22/288 (7%)

Query: 4   VYNKTPLLRQFFPGKNL-PQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRAHV 62
           + N++P+ R  F    L   + LK E L P  SFK RG  N+I  +   +QK    +  V
Sbjct: 69  IINESPISRSEFLSSRLNTDVQLKREDLLPVFSFKLRGAYNMI-SHLDDVQK----KCGV 123

Query: 63  XXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQHL 122
                           + L +P T+V+P +T +   + +   GA+V++ G ++  A    
Sbjct: 124 IACSAGNHAQGVAYSAKHLGIPATIVMPVSTPSIKYQNVSRLGAEVVLYGDNFDAAKVEC 183

Query: 123 KKTVMSQIDLKTTEPIY-VHPFDNPDIWEGHATLVDEIMETL-NSQKIQTENVKGIVCSV 180
            +       L   + +Y + PFD+P +  G  T+  EI++ + NS KI       + C+V
Sbjct: 184 SR-------LSEEKGLYDIPPFDHPYVIAGQGTIAMEILKQIQNSSKI-----GAVFCAV 231

Query: 181 GGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTA 240
           GGGGL  G+   +++   A  I ++GVET     L+TS+  N +    ++   A      
Sbjct: 232 GGGGLIAGVGAYIKR--AAPHIKVIGVETYDAATLHTSMQNNARTTLSQVGGFADGTSVR 289

Query: 241 SISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAAL 288
            I +++F +A++     ++V+  ++         D   V EP+   A+
Sbjct: 290 LIGEESFRVAREVVDEVILVNTDEICAAIKDIFEDTRAVVEPSGALAV 337

>NCAS0A14230 Chr1 (2801647..2803356) [1710 bp, 569 aa] {ON}
           Anc_7.367
          Length = 569

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 67/264 (25%), Positives = 113/264 (42%), Gaps = 17/264 (6%)

Query: 25  LKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRAHVXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N+I K         +R   V                + L +P
Sbjct: 90  LKREDLLPVFSFKLRGAYNMIAK-----LDDSQRNQGVIACSAGNHAQGVAYAAKHLGIP 144

Query: 85  CTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQHLKKTVMSQIDLKTTEPIYVHPFD 144
            T+V+P +T +   + +   G++V++ G  + EA     K  +++    T  P    PFD
Sbjct: 145 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTK--LAEERGLTNIP----PFD 198

Query: 145 NPDIWEGHATLVDEIMETLNSQKIQTENVKGIVCSVGGGGLYNGIMQGLEKHGLAEKIPI 204
           +P +  G  T+  EI+     +++   N  G V    GGG +   +    K  +A  I +
Sbjct: 199 HPYVIAGQGTVAMEIL-----RQVHNANKIGAVFVPVGGGGFIAGVGAYLKR-IAPHIKV 252

Query: 205 VGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTASISKQTFELAKKYNTRSVVVDDSK 264
           +GVET     L+TSL  NK+     + + A       I ++TF +A++     V+V+  +
Sbjct: 253 IGVETFDAATLHTSLKHNKRTPLPTVGTFADGTSVRVIGEETFRVAQQVVDEVVLVNTDE 312

Query: 265 VIETCLKYTRDFNMVAEPACGAAL 288
           +         D   + EP+   A+
Sbjct: 313 ICAAVKDIFEDTRSIVEPSGALAV 336

>KLLA0E19779g Chr5 complement(1760800..1762503) [1704 bp, 567 aa]
           {ON} highly similar to uniprot|P00927 Saccharomyces
           cerevisiae YER086W ILV1 Threonine deaminase catalyzes
           the first step in isoleucine biosynthesis expression is
           under general amino acid control ILV1 locus exhibits
           highly positioned nucleosomes whose organization is
           independent of known ILV1 regulation
          Length = 567

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 67/264 (25%), Positives = 118/264 (44%), Gaps = 17/264 (6%)

Query: 25  LKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRAHVXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N+I K         ++ A V                  +++P
Sbjct: 88  LKREDLLPVFSFKLRGAYNMIAK-----LDETQKNAGVIACSAGNHAQGVAFSSNHMNIP 142

Query: 85  CTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQHLKKTVMSQIDLKTTEPIYVHPFD 144
            T+V+P +T +   + +   GA+V++ G  + EA   L+   +++    T  P    PFD
Sbjct: 143 ATIVMPVSTPSIKYQNVSRLGAQVVLYGDDFDEA--KLECARLAEERGMTDIP----PFD 196

Query: 145 NPDIWEGHATLVDEIMETLNSQKIQTENVKGIVCSVGGGGLYNGIMQGLEKHGLAEKIPI 204
           +P +  G  T+  EI+  + +      N+  + C+VGGGGL +GI   L++  +A  I +
Sbjct: 197 HPYVIAGQGTIAMEILRQVQN----GSNIGAVFCAVGGGGLISGIGSYLKR--IAPHIKV 250

Query: 205 VGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTASISKQTFELAKKYNTRSVVVDDSK 264
           +GVET     L+ SL   K+     + + A       I ++TF + +      ++V+  +
Sbjct: 251 IGVETYDAATLDVSLKNGKRTPLPSVGTFADGTSVRLIGEETFRVCQDVVDEVILVNTDE 310

Query: 265 VIETCLKYTRDFNMVAEPACGAAL 288
           +         D   + EP+   A+
Sbjct: 311 ICAAVKDVFEDTRSIVEPSGALAV 334

>YER086W Chr5 (328477..330207) [1731 bp, 576 aa] {ON}  ILV1Threonine
           deaminase, catalyzes the first step in isoleucine
           biosynthesis; expression is under general amino acid
           control; ILV1 locus exhibits highly positioned
           nucleosomes whose organization is independent of known
           ILV1 regulation
          Length = 576

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 69/262 (26%), Positives = 117/262 (44%), Gaps = 19/262 (7%)

Query: 23  LFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRAHVXXXXXXXXXXXXXXXCQRLS 82
           + LK E L P  SFK RG  N+I K         +R   V                + L 
Sbjct: 95  VILKREDLLPVFSFKLRGAYNMIAK-----LDDSQRNQGVIACSAGNHAQGVAFAAKHLK 149

Query: 83  LPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQHLKKTVMSQIDLKTTEPIYVHP 142
           +P T+V+P  T +   + +   G++V++ G  + EA     K  +++    T  P    P
Sbjct: 150 IPATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAK--LAEERGLTNIP----P 203

Query: 143 FDNPDIWEGHATLVDEIMETLNSQKIQTEN-VKGIVCSVGGGGLYNGIMQGLEKHGLAEK 201
           FD+P +  G  T+  EI+     ++++T N +  +   VGGGGL  GI   L++  +A  
Sbjct: 204 FDHPYVIAGQGTVAMEIL-----RQVRTANKIGAVFVPVGGGGLIAGIGAYLKR--VAPH 256

Query: 202 IPIVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTASISKQTFELAKKYNTRSVVVD 261
           I I+GVET     L+ SL  N++     + + A       I ++TF +A++     V+V+
Sbjct: 257 IKIIGVETYDAATLHNSLQRNQRTPLPVVGTFADGTSVRMIGEETFRVAQQVVDEVVLVN 316

Query: 262 DSKVIETCLKYTRDFNMVAEPA 283
             ++         D   + EP+
Sbjct: 317 TDEICAAVKDIFEDTRSIVEPS 338

>Skud_5.205 Chr5 (322688..324418) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 65.1 bits (157), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 69/262 (26%), Positives = 117/262 (44%), Gaps = 19/262 (7%)

Query: 23  LFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRAHVXXXXXXXXXXXXXXXCQRLS 82
           + LK E L P  SFK RG  N+I K         +R   V                + L 
Sbjct: 95  VILKREDLLPVFSFKLRGAYNMIAK-----LDDSQRNQGVIACSAGNHAQGVAFAAKHLK 149

Query: 83  LPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQHLKKTVMSQIDLKTTEPIYVHP 142
           +P T+V+P  T +   + +   G++V++ G  + EA     K  +++    T  P    P
Sbjct: 150 IPATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAK--LAEERGLTNIP----P 203

Query: 143 FDNPDIWEGHATLVDEIMETLNSQKIQTEN-VKGIVCSVGGGGLYNGIMQGLEKHGLAEK 201
           FD+P +  G  T+  EI+     ++++T N +  +   VGGGGL  GI   L++  +A  
Sbjct: 204 FDHPYVIAGQGTVAMEIL-----RQVRTANKIGAVFVPVGGGGLIAGIGAYLKR--VAPH 256

Query: 202 IPIVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTASISKQTFELAKKYNTRSVVVD 261
           I ++GVET     L+ SL  N++     + S A       I ++TF +A++     V+V+
Sbjct: 257 IKVIGVETFDAPTLHNSLQRNQRTPLPVVGSFADGTSVRMIGEETFRVAQQVVDEVVLVN 316

Query: 262 DSKVIETCLKYTRDFNMVAEPA 283
             ++         D   + EP+
Sbjct: 317 TDEICAAVKDVFEDTRSIVEPS 338

>Smik_5.225 Chr5 (337064..338794) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 68/262 (25%), Positives = 117/262 (44%), Gaps = 19/262 (7%)

Query: 23  LFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRAHVXXXXXXXXXXXXXXXCQRLS 82
           + LK E L P  SFK RG  N+I K         +R   V                + L 
Sbjct: 95  VILKREDLLPVFSFKLRGAYNMIAK-----LDDSQRNQGVIACSAGNHAQGVAFAAKHLK 149

Query: 83  LPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQHLKKTVMSQIDLKTTEPIYVHP 142
           +P T+V+P  T +   + +   G++V++ G  + EA     K  +++    T  P    P
Sbjct: 150 IPATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAK--LAEERGLTNIP----P 203

Query: 143 FDNPDIWEGHATLVDEIMETLNSQKIQTEN-VKGIVCSVGGGGLYNGIMQGLEKHGLAEK 201
           FD+P +  G  T+  EI+     ++++T N +  +   VGGGGL  GI   L++  +A  
Sbjct: 204 FDHPYVIAGQGTVAMEIL-----RQVRTANKIGAVFVPVGGGGLIAGIGAYLKR--VAPH 256

Query: 202 IPIVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTASISKQTFELAKKYNTRSVVVD 261
           I ++GVET     L+ SL  N++     + + A       I ++TF +A++     V+V+
Sbjct: 257 IKVIGVETYDAATLHNSLQRNQRTPLPVVGTFADGTSVRMIGEETFRVAQQVVDEVVLVN 316

Query: 262 DSKVIETCLKYTRDFNMVAEPA 283
             ++         D   + EP+
Sbjct: 317 TDEICAAVKDIFEDTRSIVEPS 338

>TBLA0C05070 Chr3 (1230732..1232459) [1728 bp, 575 aa] {ON}
           Anc_7.367 YER086W
          Length = 575

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 72/290 (24%), Positives = 123/290 (42%), Gaps = 22/290 (7%)

Query: 4   VYNKTPLLRQFFPGKNL-PQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRAHV 62
           V N++P+ +       L  Q+ LK E L P  SFK RG  N++ K         +R+  V
Sbjct: 69  VINESPMTKGIGLSSKLNSQIQLKREDLLPVFSFKMRGAYNMVAK-----LDETQRKQGV 123

Query: 63  XXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQHL 122
                           + L +P T+V+P +T +   E +   G++V++ G  +  +    
Sbjct: 124 IACSAGNHAQGVAYAAKHLGIPATIVMPVSTPSIKYENVSRLGSQVVLYGNDFDSSKGEC 183

Query: 123 KKTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETL-NSQKIQTENVKGIVCSVG 181
           ++    +        + + PFD+P +  G  T+  EI+  + NS KI    V      + 
Sbjct: 184 ERLCEER------GLVNIPPFDHPYVIAGQGTVAMEILRQVKNSAKIGAVFVPVGGGGLV 237

Query: 182 GGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTAS 241
                 GI   L++  +A  I IVGVET     L TSL+  K+ E   + + A       
Sbjct: 238 -----AGIGAYLKR--IAPHIKIVGVETYDAATLKTSLDNGKRTELNTVGTFADGTAVKM 290

Query: 242 ISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLA 291
           I ++TF ++K      V+V+  ++         D   + EP+   AL +A
Sbjct: 291 IGEETFRVSKDVVDEIVLVNTDELCAAVKDIFEDTRSIVEPS--GALSVA 338

>Suva_5.199 Chr5 (303073..304803) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 68/262 (25%), Positives = 117/262 (44%), Gaps = 19/262 (7%)

Query: 23  LFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRAHVXXXXXXXXXXXXXXXCQRLS 82
           + LK E L P  SFK RG  N+I K         +R   V                + L 
Sbjct: 95  VILKREDLLPVFSFKLRGAYNMIAK-----LDDSQRNQGVIACSAGNHAQGVAFAAKHLK 149

Query: 83  LPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQHLKKTVMSQIDLKTTEPIYVHP 142
           +P T+V+P  T +   + +   G++V++ G  + EA     K  +++    T  P    P
Sbjct: 150 IPATIVMPVCTPSIKYQNVSRLGSQVVLFGNDFDEAKAECTK--LAEERGLTNIP----P 203

Query: 143 FDNPDIWEGHATLVDEIMETLNSQKIQTEN-VKGIVCSVGGGGLYNGIMQGLEKHGLAEK 201
           FD+P +  G  T+  EI+     ++++T N +  +   VGGGGL  GI   L++  +A  
Sbjct: 204 FDHPYVIAGQGTVAMEIL-----RQVRTVNKIGAVFVPVGGGGLIAGIGAYLKR--IAPH 256

Query: 202 IPIVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTASISKQTFELAKKYNTRSVVVD 261
           I ++GVET     L+ SL  N++     + + A       I ++TF +A++     V+V+
Sbjct: 257 IKVIGVETYDAATLHNSLQRNQRTPLPAVGTFADGTSVRMIGEETFRVAQQVVDEVVLVN 316

Query: 262 DSKVIETCLKYTRDFNMVAEPA 283
             ++         D   + EP+
Sbjct: 317 TDEICAAVKDVFEDTRSIVEPS 338

>ACR232C Chr3 complement(767330..769012) [1683 bp, 560 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER086W
           (ILV1)
          Length = 560

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 68/259 (26%), Positives = 113/259 (43%), Gaps = 17/259 (6%)

Query: 25  LKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRAHVXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N+I  N    QK     A V                + L + 
Sbjct: 82  LKREDLLPVFSFKLRGAYNMI-SNLDEYQK----SAGVIACSAGNHAQGVAFSARELGIR 136

Query: 85  CTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQHLKKTVMSQIDLKTTEPIYVHPFD 144
             +V+PT+T +     +   GA+V++ G  + EA     +  ++Q+   T  P    PFD
Sbjct: 137 AMIVMPTSTPSIKYNSVAAMGAEVVLYGKDFDEAKAECAR--LAQLHKLTDIP----PFD 190

Query: 145 NPDIWEGHATLVDEIMETLNSQKIQTENVKGIVCSVGGGGLYNGIMQGLEKHGLAEKIPI 204
           +P +  G  T+  EI+  +++       +  + C VGGGGL  GI   L++  +A  I I
Sbjct: 191 HPYVIAGQGTIATEILRQVHN----ASQIGAVFCGVGGGGLIAGIGSYLKR--IAPHIKI 244

Query: 205 VGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTASISKQTFELAKKYNTRSVVVDDSK 264
           +GVET     L+T+L   ++     +   A       + ++TF +A+      V+V+  +
Sbjct: 245 IGVETHDAPTLHTALKQGRRTMLPAVGCFADGTSVRMMGEETFRVARDVVDEVVLVNTDE 304

Query: 265 VIETCLKYTRDFNMVAEPA 283
           +         D   + EP+
Sbjct: 305 LCAAIKDIFEDTRAIVEPS 323

>TDEL0C01800 Chr3 complement(313699..315408) [1710 bp, 569 aa] {ON}
           Anc_7.367 YER086W
          Length = 569

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 72/265 (27%), Positives = 115/265 (43%), Gaps = 19/265 (7%)

Query: 25  LKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRAHVXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N+I K         ++   V                + +S+P
Sbjct: 90  LKREDLLPVFSFKLRGAYNMIAK-----LDDSQKNQGVIACSAGNHAQGVAFAAKHMSIP 144

Query: 85  CTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQHLKKTVMSQIDLKTTEPIYVHPFD 144
            T+V+P +T +   + +   G++V++ G  + EA      T +S+    T  P    PFD
Sbjct: 145 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAEC--TRLSEERGLTNIP----PFD 198

Query: 145 NPDIWEGHATLVDEIMETL-NSQKIQTENVKGIVCSVGGGGLYNGIMQGLEKHGLAEKIP 203
           +P +  G  T+  EI+  + NS KI       +    GGGGL  GI   L++  +A  I 
Sbjct: 199 HPYVIAGQGTVAMEILRQVRNSAKI-----GAVFVPCGGGGLVAGIGAYLKR--IAPHIK 251

Query: 204 IVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTASISKQTFELAKKYNTRSVVVDDS 263
           I+GVET     L+TSL   K+     + + A       I ++TF +A+      V+V   
Sbjct: 252 IIGVETFDSATLHTSLKNGKRTPLASVGTFADGTSVRMIGEETFRIAQDVVDEVVLVGTD 311

Query: 264 KVIETCLKYTRDFNMVAEPACGAAL 288
           ++         D   + EP+   A+
Sbjct: 312 EICAAIKDIFEDTRGIVEPSGALAV 336

>TPHA0F03130 Chr6 complement(685292..686998) [1707 bp, 568 aa] {ON}
           Anc_7.367 YER086W
          Length = 568

 Score = 62.0 bits (149), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 65/264 (24%), Positives = 116/264 (43%), Gaps = 17/264 (6%)

Query: 25  LKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRAHVXXXXXXXXXXXXXXXCQRLSLP 84
           LK + L P  SFK RG  N++ K         ++   V                + L +P
Sbjct: 89  LKRDDLLPVFSFKLRGAYNMMAK-----LDDTQKNQGVIACSAGNHAQGVAYAAKHLKIP 143

Query: 85  CTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQHLKKTVMSQIDLKTTEPIYVHPFD 144
            T+V+P +T +   + +   G++V++ G  + EA     +  +++    T  P    PFD
Sbjct: 144 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAR--LAEERGLTNIP----PFD 197

Query: 145 NPDIWEGHATLVDEIMETLNSQKIQTENVKGIVCSVGGGGLYNGIMQGLEKHGLAEKIPI 204
           +P +  G  T+  EI+  ++     +  +  +   VGGGGL  G+   L++  +A  I I
Sbjct: 198 HPYVIAGQGTVAMEILRQVH----MSSKIGAVFVPVGGGGLIAGVGTYLKR--IAPHIKI 251

Query: 205 VGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTASISKQTFELAKKYNTRSVVVDDSK 264
           +GVET     L TSL   K+   E + S A       + ++TF +A++     V+V+  +
Sbjct: 252 IGVETYDACALYTSLQSGKRAALESVGSFADGTAVRLLGEETFRVAQEVVDEVVLVNTDE 311

Query: 265 VIETCLKYTRDFNMVAEPACGAAL 288
           +         D   + EP+   A+
Sbjct: 312 ICAGIKDIFEDTRSIVEPSGALAV 335

>NDAI0A01810 Chr1 complement(400890..402602) [1713 bp, 570 aa] {ON}
           Anc_7.367
          Length = 570

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 64/260 (24%), Positives = 109/260 (41%), Gaps = 19/260 (7%)

Query: 25  LKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRAHVXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N+I K         +R   V                + L++P
Sbjct: 91  LKREDLLPVFSFKLRGAYNMIAK-----LDDSQRNQGVIACSAGNHAQGVAFAAKHLNIP 145

Query: 85  CTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQHLKKTVMSQIDLKTTEPIYVHPFD 144
            T+V+P +T +   + +   G++V++ G  + EA     K  +++    T  P    PFD
Sbjct: 146 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTK--LAEERGLTNIP----PFD 199

Query: 145 NPDIWEGHATLVDEIMETL-NSQKIQTENVKGIVCSVGGGGLYNGIMQGLEKHGLAEKIP 203
           +P +  G  T+  EI+  + N+ KI    V      +       G+   L++  +A  I 
Sbjct: 200 HPYVIAGQGTVAMEILRQVHNANKIGAVFVPVGGGGLV-----AGVGAYLKR--IAPHIK 252

Query: 204 IVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTASISKQTFELAKKYNTRSVVVDDS 263
           I+GVET     L TSL   ++     +   A       I ++TF +A++     V+V+  
Sbjct: 253 IIGVETHDAATLQTSLKHGRRTPLSVVGPFADGTSVRLIGEETFRVAQEVVDEVVLVNTD 312

Query: 264 KVIETCLKYTRDFNMVAEPA 283
           ++         D   + EP+
Sbjct: 313 EICAAVKDVFEDTRSIVEPS 332

>ZYRO0B02772g Chr2 (224426..226135) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 569

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 70/260 (26%), Positives = 116/260 (44%), Gaps = 19/260 (7%)

Query: 25  LKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRAHVXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N+I K     +  G     V                + +++P
Sbjct: 90  LKREDLLPVFSFKLRGAYNMIAKLDENQKNQG-----VIACSAGNHAQGVAYAARHMNIP 144

Query: 85  CTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQHLKKTVMSQIDLKTTEPIYVHPFD 144
            T+V+P +T +   + +   G++V++ G  + EA     K  +++    T  P    PFD
Sbjct: 145 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAK--LAEERGLTNIP----PFD 198

Query: 145 NPDIWEGHATLVDEIMETL-NSQKIQTENVKGIVCSVGGGGLYNGIMQGLEKHGLAEKIP 203
           +P +  G  T+  EI+  + NS KI       +   VGGGGL  GI   L++  +A  I 
Sbjct: 199 HPYVIAGQGTVAMEILRQVHNSLKI-----GAVFVPVGGGGLIAGIGAYLKR--IAPHIK 251

Query: 204 IVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTASISKQTFELAKKYNTRSVVVDDS 263
           IVGVET     L+ S+   K+   + + S A       I ++TF ++++     V+V+  
Sbjct: 252 IVGVETHDAPTLSASMKTGKRELLKTVGSFADGTSVRIIGEETFRVSQEVVDEIVLVNTD 311

Query: 264 KVIETCLKYTRDFNMVAEPA 283
           ++         D   + EP+
Sbjct: 312 EICAAVKDIFEDTRSIIEPS 331

>Kpol_530.16 s530 complement(41170..42870) [1701 bp, 566 aa] {ON}
           complement(41170..42870) [1701 nt, 567 aa]
          Length = 566

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 63/259 (24%), Positives = 115/259 (44%), Gaps = 17/259 (6%)

Query: 25  LKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRAHVXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N++ K         ++   V                + L++P
Sbjct: 87  LKREDLLPVFSFKLRGAYNMMAK-----LDDSQKNQGVIACSAGNHAQGIAYAAKHLNIP 141

Query: 85  CTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQHLKKTVMSQIDLKTTEPIYVHPFD 144
            T+V+P +T +   + +   G++V++ G  + EA     +  +++    T  P    PFD
Sbjct: 142 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAR--LAEERGLTNIP----PFD 195

Query: 145 NPDIWEGHATLVDEIMETLNSQKIQTENVKGIVCSVGGGGLYNGIMQGLEKHGLAEKIPI 204
           +P +  G  T+  EI+  ++    +   +  +   VGGGGL  G+   L++  +A  I I
Sbjct: 196 HPYVIAGQGTVAMEILRQVH----KANKIGAVFVPVGGGGLIAGVGAYLKR--IAPHIKI 249

Query: 205 VGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTASISKQTFELAKKYNTRSVVVDDSK 264
           +GVET   + L TSL   K++    + + A       I ++TF + ++     V+V+  +
Sbjct: 250 IGVETFDANCLYTSLQSGKRVPLSSVGTFADGTAVRLIGEETFRVCQEVVDEVVLVNTDE 309

Query: 265 VIETCLKYTRDFNMVAEPA 283
           +         D   + EP+
Sbjct: 310 ICAAVKDVFEDTRSIVEPS 328

>Kwal_33.14822 s33 complement(830029..831717) [1689 bp, 562 aa] {ON}
           YER086W (ILV1) - threonine deaminase [contig 101] FULL
          Length = 562

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 64/265 (24%), Positives = 109/265 (41%), Gaps = 19/265 (7%)

Query: 25  LKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRAHVXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N++ K A      G+    V                + L++P
Sbjct: 83  LKREDLLPVFSFKLRGAYNMMAKLAE-----GQGNKGVIACSAGNHAQGVAFASRHLNIP 137

Query: 85  CTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQHLKKTVMSQIDLKTTEPIYVHPFD 144
             +V+P  T +   + +   G +V++ G  + EA     +  +S+    T  P    PFD
Sbjct: 138 AIIVMPVNTPSIKYQNVSRLGGQVVLYGNDFDEAKIECAR--ISEERGLTNIP----PFD 191

Query: 145 NPDIWEGHATLVDEIMETL-NSQKIQTENVKGIVCSVGGGGLYNGIMQGLEKHGLAEKIP 203
           +P +  G  T+  EI+  + N+ KI    V      +       G+   L++  +A  I 
Sbjct: 192 HPYVIAGQGTVAMEILRQVHNASKIGAVFVPVGGGGLV-----AGVAAYLKR--IAPHIK 244

Query: 204 IVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTASISKQTFELAKKYNTRSVVVDDS 263
           IVGVET     L TSL+   +     + + A       I ++TF + + +    V+V+  
Sbjct: 245 IVGVETYDSATLKTSLDAGCRTPLTSVGTFADGTSVRMIGEETFRICEDFVDEVVLVNTD 304

Query: 264 KVIETCLKYTRDFNMVAEPACGAAL 288
           ++         D   + EP+   A+
Sbjct: 305 EICAAVKDIFEDTRSIVEPSGALAV 329

>KNAG0C03690 Chr3 complement(722238..723971) [1734 bp, 577 aa] {ON}
           Anc_7.367 YER086W
          Length = 577

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 62/265 (23%), Positives = 110/265 (41%), Gaps = 19/265 (7%)

Query: 25  LKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRAHVXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N++ K         ++   V                + L +P
Sbjct: 98  LKREDLLPVFSFKLRGAYNMMAK-----LDDTQKNQGVIACSAGNHAQGVAFAAKHLDIP 152

Query: 85  CTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQHLKKTVMSQIDLKTTEPIYVHPFD 144
            T+V+P +T +   + +   G++V++ G  + EA     K  +S+    T  P    PFD
Sbjct: 153 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTK--LSKERGLTNIP----PFD 206

Query: 145 NPDIWEGHATLVDEIMETLN-SQKIQTENVKGIVCSVGGGGLYNGIMQGLEKHGLAEKIP 203
           +P +  G  T+  EI+  ++ + KI    V      +       G+   L++  +A  I 
Sbjct: 207 HPYVIAGQGTVAMEILRQVHIANKIGAVFVPVGGGGLV-----AGVGAYLKR--IAPHIK 259

Query: 204 IVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTASISKQTFELAKKYNTRSVVVDDS 263
           I+GVET     L TSL   ++     + + A       I ++TF +++      V+V+  
Sbjct: 260 IIGVETFDASTLYTSLQRGRRTSLPSVGTFADGTSVKLIGEETFRISQDVVDEVVLVNTD 319

Query: 264 KVIETCLKYTRDFNMVAEPACGAAL 288
           ++         D   + EP+   A+
Sbjct: 320 EICAAVKDIFEDTRSIVEPSGALAV 344

>SAKL0A10626g Chr1 complement(932879..933841) [963 bp, 320 aa] {ON}
           similar to uniprot|P36007 Saccharomyces cerevisiae
           YKL218C SRY1 3-hydroxyaspartate dehydratase deaminates
           L- threo-3-hydroxyaspartate to form oxaloacetate and
           ammonia required for survival in the presence of
           hydroxyaspartate
          Length = 320

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 62/278 (22%), Positives = 105/278 (37%), Gaps = 21/278 (7%)

Query: 6   NKTPLLRQFFPGKNL-PQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRAHVXX 64
           NKTP+L        L  +++ K E  Q  G+FK RG  N +LK         +R A V  
Sbjct: 21  NKTPVLTSRTVNAELGAEVYFKCENFQRIGAFKFRGAMNTLLKLTQE-----QRAAGVVA 75

Query: 65  XXXXXXXXXXXXXCQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQHLKK 124
                         + L +P T+V+P       V      GA  IV    + E  + + +
Sbjct: 76  FSSGNHAQAIALSAKLLGVPATIVMPNDAPAAKVRATAGYGAN-IVRYDRYTEDREQIGR 134

Query: 125 TVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKGIVCSVGGGG 184
            +  +  L       V P+D+PD+  G  T   E++E +    +           V  GG
Sbjct: 135 ALAEEKGL-----TLVPPYDHPDVIAGQGTAAKELIEEVGELDL---------LFVPLGG 180

Query: 185 LYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTASISK 244
                   L    L+ +  I+GVE    +    SL     +  +   +IA    T  + +
Sbjct: 181 GGLLSGSALAAKRLSPRCEIIGVEPEAGNDGQQSLRSGSIVHIDTPETIADGAQTQHLGQ 240

Query: 245 QTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEP 282
            TFE+        +   D++++++   +     +V EP
Sbjct: 241 YTFEVIHANVADILTASDAELVDSMRFFAERMKIVVEP 278

>KLTH0B04884g Chr2 (400193..401914) [1722 bp, 573 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 573

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 61/265 (23%), Positives = 107/265 (40%), Gaps = 19/265 (7%)

Query: 25  LKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRAHVXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N++ K +       ++   V                + L++P
Sbjct: 94  LKREDLLPVFSFKLRGAYNMMAKLSE-----AQKNQGVIACSAGNHAQGVAFASRHLNIP 148

Query: 85  CTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQHLKKTVMSQIDLKTTEPIYVHPFD 144
             +V+P  T +   + +   G +V++ G  + EA      T +S+    T  P    PFD
Sbjct: 149 AIIVMPVNTPSIKYQNVSRLGGQVVLYGNDFDEAKTEC--TRISEERGLTNIP----PFD 202

Query: 145 NPDIWEGHATLVDEIMETL-NSQKIQTENVKGIVCSVGGGGLYNGIMQGLEKHGLAEKIP 203
           +P +  G  T+  EI+  + N+ KI    V      +       G+   L++  +A  I 
Sbjct: 203 HPYVIAGQGTVAMEILRQVHNAAKIGAVFVPVGGGGLV-----AGVAAYLKR--IAPHIK 255

Query: 204 IVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTASISKQTFELAKKYNTRSVVVDDS 263
           I+GVET     L TSL    +     + + A       I ++TF + +      ++V+  
Sbjct: 256 IIGVETYDSATLKTSLEAGTRTPLSTVGTFADGTSVRMIGEETFRICQDLVDDVILVNTD 315

Query: 264 KVIETCLKYTRDFNMVAEPACGAAL 288
           ++         D   + EP+   A+
Sbjct: 316 EICAAVKDIFEDTRSIVEPSGALAV 340

>Skud_11.2 Chr11 complement(1812..2792) [981 bp, 326 aa] {ON}
           YKL218C (REAL)
          Length = 326

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 66/159 (41%), Gaps = 12/159 (7%)

Query: 6   NKTPLLRQFFPGKNL-PQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRAHVXX 64
           NKTP+L        L  +++ K E  Q  G+FK RG  N + K + +     ER+  V  
Sbjct: 21  NKTPVLTSRTLNDRLEAEVYFKGENYQRVGAFKFRGAMNAVSKLSDK-----ERKKGVIA 75

Query: 65  XXXXXXXXXXXXXCQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQHLKK 124
                         +  ++P T+++P       V      GA +I     + E  +H+ +
Sbjct: 76  FSSGNHAQAIALSAKLFNVPATIIMPEDAPALKVAATAGYGAHIIKYN-RYTEDREHIGR 134

Query: 125 TVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETL 163
            + ++        + + P+D+PD+  G  T   E+ E +
Sbjct: 135 QLAAKHGY-----VLIPPYDHPDVIAGQGTSAKELFEEV 168

>Kwal_26.7518 s26 (398913..400394) [1482 bp, 493 aa] {ON} YGR155W
           (CYS4) - Cystathionine beta-synthase [contig 52] FULL
          Length = 493

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 86/212 (40%), Gaps = 10/212 (4%)

Query: 21  PQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRAHVXXXXXXXXXXXXXXXCQR 80
           PQ++ K E   P GS K R I   ++++A +  +I   R  +                  
Sbjct: 33  PQVYAKLELYNPGGSIKDR-IAKCMIEDAEKSGRIHPSRTTLIEPTSGNTGIGLALMGAV 91

Query: 81  LSLPCTVVVPTATKTRMVEKIRNTGAKVIVN--GAHWKEADQHLKKTVMSQIDLKTTEPI 138
                 + +P       V  ++  GA++I     A W   + H+   V  +++ +    +
Sbjct: 92  KGYRTIITLPEKMSNEKVSVLKALGAEIIRTPTAAAWDSPESHI--GVAKKLEKEIPHAV 149

Query: 139 YVHPFDNPDIWEGHATLV-DEIMETLNSQKIQTENVKGIVCSVGGGGLYNGIMQGLEKHG 197
            +  ++N    E H      EI E L +Q+ Q E + G+    G GG  +GI + L++  
Sbjct: 150 ILDQYNNMKNPEAHYLGTGKEIHEQL-AQRGQFEKLHGVFAGAGTGGTISGIAKYLKEQD 208

Query: 198 LAEKIPIVGVETRGCHVLN-TSLNLNKQIEFE 228
               I IVG +  G  +    SLN N   E++
Sbjct: 209 --SNIKIVGADPEGSILAQPESLNENGAPEYK 238

>YKL218C Chr11 complement(17359..18339) [981 bp, 326 aa] {ON}
           SRY13-hydroxyaspartate dehydratase, deaminates
           L-threo-3-hydroxyaspartate to form oxaloacetate and
           ammonia; required in the presence of hydroxyaspartate;
           highly similar to mouse serine racemase (Srr) but has no
           serine racemase activity
          Length = 326

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 66/160 (41%), Gaps = 12/160 (7%)

Query: 6   NKTPLLRQFFPGKNL-PQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRAHVXX 64
           NKTP+L        L  Q++ K E  Q  G+FK RG  N + K +       +R   V  
Sbjct: 21  NKTPVLTSRMLNDRLGAQIYFKGENFQRVGAFKFRGAMNAVSKLSDE-----KRSKGVIA 75

Query: 65  XXXXXXXXXXXXXCQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQHLKK 124
                         + L++P T+V+P       V      GA +I    + ++ +Q + +
Sbjct: 76  FSSGNHAQAIALSAKLLNVPATIVMPEDAPALKVAATAGYGAHIIRYNRYTEDREQ-IGR 134

Query: 125 TVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLN 164
            + ++          + P+D+PD+  G  T   E++E + 
Sbjct: 135 QLAAEHGFA-----LIPPYDHPDVIAGQGTSAKELLEEVG 169

>KLTH0D04092g Chr4 (391381..392862) [1482 bp, 493 aa] {ON} highly
           similar to uniprot|P32582 Saccharomyces cerevisiae
           YGR155W CYS4 Cystathionine beta-synthase catalyzes the
           synthesis of cystathionine from serine and homocysteine
           the first committed step in cysteine biosynthesis
          Length = 493

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/211 (20%), Positives = 85/211 (40%), Gaps = 8/211 (3%)

Query: 21  PQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRAHVXXXXXXXXXXXXXXXCQR 80
           PQ++ K E   P GS K R I   ++++A +  +I   R  +                  
Sbjct: 33  PQVYAKLELYNPGGSIKDR-IAKSMIEDAEKSGRIHPSRTTLIEPTSGNTGIGLALMGAV 91

Query: 81  LSLPCTVVVPTATKTRMVEKIRNTGAKVIVN--GAHWKEADQHLKKTVMSQIDLKTTEPI 138
                 + +P       V  ++  GA++I     A W   + H+   V  +++ +    +
Sbjct: 92  KGYRTIITLPEKMSNEKVSVLKALGAEIIRTPTAAAWDSPESHI--GVAKKLEKEIPHAV 149

Query: 139 YVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKGIVCSVGGGGLYNGIMQGLEKHGL 198
            +  ++N    E H     + ++    Q  + EN+ G+    G GG  +GI + L++   
Sbjct: 150 ILDQYNNMKNPEAHYQGTGKEIQGQLQQLGEYENLHGVFAGAGTGGTISGISKYLKEQN- 208

Query: 199 AEKIPIVGVETRGCHVLN-TSLNLNKQIEFE 228
             +I I+G +  G  +    SLN  +  E++
Sbjct: 209 -PEIKIIGADPEGSILAQPESLNETEAAEYK 238

>Smik_6.260 Chr6 (417812..419335) [1524 bp, 507 aa] {ON} YGR155W
           (REAL)
          Length = 507

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 84/206 (40%), Gaps = 10/206 (4%)

Query: 21  PQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRAHVXXXXXXXXXXXXXXXCQR 80
           PQ++ K E   P GS K R I   +++ A    +I   R+ +                  
Sbjct: 37  PQIYAKLELYNPGGSIKDR-IAKSMVEEAEASGRIHPSRSTLIEPTSGNTGIGLALIGAV 95

Query: 81  LSLPCTVVVPTATKTRMVEKIRNTGAKVIV--NGAHWKEADQHLKKTVMSQIDLKTTEPI 138
                 + +P       V  ++  GA++I     A W   + H+   V  +++ +    +
Sbjct: 96  KGYRTIITLPEKMSNEKVSVLKALGAEIIRTPTAAAWDSPESHI--GVAKKLEKEIPGAV 153

Query: 139 YVHPFDNPDIWEGHATLVD-EIMETLNSQKIQTENVKGIVCSVGGGGLYNGIMQGLEKHG 197
            +  ++N    E H      EI + L    +  +N++ +V   G GG  +GI + L++  
Sbjct: 154 ILDQYNNMMNPEAHYFGTGREIQKQLEDLDL-FDNLRAVVAGAGTGGTISGIAKYLKEQN 212

Query: 198 LAEKIPIVGVETRGCHVLNTSLNLNK 223
             EKI IVG +  G  +L    NLNK
Sbjct: 213 --EKIQIVGADPFGS-ILAQPENLNK 235

>YGR155W Chr7 (798543..800066) [1524 bp, 507 aa] {ON}
           CYS4Cystathionine beta-synthase, catalyzes synthesis of
           cystathionine from serine and homocysteine, the first
           committed step in cysteine biosynthesis; responsible for
           hydrogen sulfide generation; advances passage through
           START by promoting cell growth which requires catalytic
           activity, and reducing critical cell size independent of
           catalytic activity; mutations in human ortholog cause
           homocystinuria
          Length = 507

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/209 (22%), Positives = 86/209 (41%), Gaps = 16/209 (7%)

Query: 21  PQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRAHVXXXXXXXXXXXXXXXCQR 80
           PQ++ K E   P GS K R I   +++ A    +I   R+ +                  
Sbjct: 37  PQIYAKLELYNPGGSIKDR-IAKSMVEEAEASGRIHPSRSTLIEPTSGNTGIGLALIGAI 95

Query: 81  LSLPCTVVVPTATKTRMVEKIRNTGAKVIV--NGAHWKEADQHLKKTVMSQIDLKTTEPI 138
                 + +P       V  ++  GA++I     A W   + H+   V  +++ +    +
Sbjct: 96  KGYRTIITLPEKMSNEKVSVLKALGAEIIRTPTAAAWDSPESHI--GVAKKLEKEIPGAV 153

Query: 139 YVHPFD---NPDI-WEGHATLVDEIMETLNSQKIQTENVKGIVCSVGGGGLYNGIMQGLE 194
            +  ++   NP+  + G    +   +E LN      +N++ +V   G GG  +GI + L+
Sbjct: 154 ILDQYNNMMNPEAHYFGTGREIQRQLEDLN----LFDNLRAVVAGAGTGGTISGISKYLK 209

Query: 195 KHGLAEKIPIVGVETRGCHVLNTSLNLNK 223
           +    +KI IVG +  G  +L    NLNK
Sbjct: 210 EQN--DKIQIVGADPFGS-ILAQPENLNK 235

>Kpol_1025.27 s1025 complement(63047..64237) [1191 bp, 396 aa] {ON}
           complement(63047..64237) [1191 nt, 397 aa]
          Length = 396

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 75/338 (22%), Positives = 118/338 (34%), Gaps = 57/338 (16%)

Query: 15  FPGKNLPQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRAHVXXXXXXXXXXXX 74
           + G+N+   + K E   P+GS K R   N+I         +      V            
Sbjct: 66  YTGRNI---YAKLELENPAGSAKDRVALNIIKTAEKEGLLVRGEPGWVFEGTSGSTGISI 122

Query: 75  XXXCQRLSLPCTVVVPTATKTRMVEKIRNTGAKV-------------IVNGAHWKEADQ- 120
              C  L     + +P  T    +  + + GA V              VN A  K  D+ 
Sbjct: 123 AMICNSLGYNAHISLPDDTANEKLALLESLGATVNKVKPASIVDPNQYVNAAK-KACDEL 181

Query: 121 ---HLKKTVMSQIDLKTTEPIYVHPFDNPDIWEGH-ATLVDEIMETLNSQKIQTENVKGI 176
              HLK       D      I+   F+N   W  H  T   EI   L        N++G 
Sbjct: 182 NAKHLK-------DKTIPRGIFADQFENESNWRVHYETTGPEIYHQLRG------NIQGF 228

Query: 177 VCSVGGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLN---KQIEFE----- 228
           +   G GG  +G+ + L+      K  +V  + +G    N  +N      ++E E     
Sbjct: 229 IAGCGTGGTISGVSKYLKSRFRTRKCHVVLADPQGSGFYN-RINFGVMYDRVEKEGTRRR 287

Query: 229 -KITSIATSLGTASISKQTFELAKKYNTRSVVVDDSKVIETC--LKYTRDFNMVAEPACG 285
            ++ +I   +G   I+K  F+  +K    S+ V D + I+    L       + +  A  
Sbjct: 288 HQVDTIVEGIGLNRITKN-FQEGEKLIDESIRVTDEQAIKMAKFLSVNDGLFIGSSTAIN 346

Query: 286 AALHLAYNVDILEKALGHSLTPNDVILVIACGGSSNTL 323
           A   +          L  SL PN  I++IAC   S  L
Sbjct: 347 AVAAIE---------LAQSLKPNSNIVIIACDSGSRHL 375

>NDAI0K02590 Chr11 complement(579163..580365) [1203 bp, 400 aa] {ON}
           Anc_4.148
          Length = 400

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 65/320 (20%), Positives = 118/320 (36%), Gaps = 35/320 (10%)

Query: 22  QLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRAHVXXXXXXXXXXXXXXXCQRL 81
           +++ K E   P+GS K R   N+I     + Q I  +   V               C  L
Sbjct: 76  EIYAKMELCNPAGSAKDRVALNIIKTAESQGQLIRGQPGWVFEGTSGSTGISIAMICNSL 135

Query: 82  SLPCTVVVPTATKTRMVEKIRNTGAKV-------IVNGAHWKEADQHLKKTVMSQIDLKT 134
                + +P  T    +  + + GA V       IV+   +  A +    T++   D   
Sbjct: 136 GYRAHISLPDDTSLEKLSLLESLGATVNKVKPASIVDPDQYVNAAKKACDTLLK--DHSG 193

Query: 135 TEPIYVHPFDNPDIWEGH-ATLVDEIMETLNSQKIQTENVKGIVCSVGGGGLYNGIMQGL 193
            + ++   F+N   W+ H  T   EI + ++        +   +   G GG  +G+ + L
Sbjct: 194 AKGVFADQFENEANWKVHYETTGPEIWKQMDGH------IDAFIAGCGTGGTISGVSKYL 247

Query: 194 -EKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEF---------EKITSIATSLGTASIS 243
            E   L  K  +V  + +G    N  +N     ++          ++ +I   +G   I+
Sbjct: 248 KEAKNLHGKCHVVLADPQGSGFFN-RINYGVMYDYVEKEGTRRRHQVDTIIEGIGLNRIT 306

Query: 244 KQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNVDILEKALGH 303
           K  F L + +   S+ V D + I      + +  +        A++    VD     L  
Sbjct: 307 KN-FHLGESFIDESIRVIDKQAIRMAKYLSVNDGLFV--GSSTAINAVAAVD-----LSR 358

Query: 304 SLTPNDVILVIACGGSSNTL 323
           +L P   I++IAC   S  L
Sbjct: 359 NLKPGSRIVIIACDSGSRHL 378

>TBLA0A00310 Chr1 complement(52232..54913) [2682 bp, 893 aa] {ON}
           Anc_8.81 YPL008W
          Length = 893

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 35/71 (49%), Gaps = 7/71 (9%)

Query: 119 DQHLKKTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKGIVC 178
           D   K  +  +ID K   PI+    D PDI + + T V+      NS KI ++   GI+ 
Sbjct: 706 DNWQKINIFDKID-KNIRPIFFETKDGPDILQDYITSVE------NSSKIASKLGAGILF 758

Query: 179 SVGGGGLYNGI 189
           S+ GG L  GI
Sbjct: 759 SIVGGKLSEGI 769

>Kpol_1026.13 s1026 (30466..31953) [1488 bp, 495 aa] {ON}
           (30466..31953) [1488 nt, 496 aa]
          Length = 495

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 42/198 (21%), Positives = 79/198 (39%), Gaps = 15/198 (7%)

Query: 21  PQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRAHVXXXXXXXXXXXXXXXCQR 80
           P++F K E   P GS K R I   +++ A     I   R  +                  
Sbjct: 30  PRIFAKLELYNPGGSIKDR-IAKSMIEYAESTGHIHPSRTTLIEPTSGNTGIGLALIGAI 88

Query: 81  LSLPCTVVVPTATKTRMVEKIRNTGAKVIVN--GAHWKEADQHLKKTVMSQIDLKTTEPI 138
                 + +P       V  ++  GA++I     A W   + H+   V  +++ +    +
Sbjct: 89  KGYRTIITLPEKMSNEKVSVLKALGAEIIRTPTEAAWDSPESHI--GVAKKLEREIPGAV 146

Query: 139 YVHPFDN---PDI-WEGHATLVDEIMETLNSQKIQTENVKGIVCSVGGGGLYNGIMQGLE 194
            +  ++N   PD  + G    + + +  L+    Q +N++ +V   G GG  +GI + ++
Sbjct: 147 ILDQYNNMKNPDAHYFGTGREIHKQLVNLD----QFKNLRAVVAGAGTGGTISGIARYIK 202

Query: 195 KHGLAEKIPIVGVETRGC 212
           +    EKI IVG +  G 
Sbjct: 203 EQD--EKIQIVGADPIGS 218

>TDEL0F02810 Chr6 (511257..512750) [1494 bp, 497 aa] {ON} Anc_4.69
           YGR155W
          Length = 497

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 38/194 (19%), Positives = 76/194 (39%), Gaps = 7/194 (3%)

Query: 21  PQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRAHVXXXXXXXXXXXXXXXCQR 80
           P+++ K E   P GS K R I   +++ A    +I   R  +                  
Sbjct: 32  PRVYAKLELYNPGGSIKDR-IAKSMIEYAEAAGEIHPDRTTLIEPTSGNTGIGLALIGAI 90

Query: 81  LSLPCTVVVPTATKTRMVEKIRNTGAKVIVN--GAHWKEADQHLKKTVMSQIDLKTTEPI 138
                 + +P       V  ++  GA+++     A W   + H+   V  ++  +    +
Sbjct: 91  KGYRTIITLPEKMSNEKVSVLKALGAEIVRTPTEAAWDSPESHI--GVAERLQKEIPGAV 148

Query: 139 YVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKGIVCSVGGGGLYNGIMQGLEKHGL 198
            +  ++NP   E H     + ++    +  + +++K ++   G GG  +GI + L+  G 
Sbjct: 149 ILDQYNNPRNPEAHYLGTGKEIQDQLEKLGKFDSLKAVIAGAGTGGTISGISKWLK--GK 206

Query: 199 AEKIPIVGVETRGC 212
            E I IVG +  G 
Sbjct: 207 NEDIKIVGADPVGS 220

>AEL161W Chr5 (329283..330353) [1071 bp, 356 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGR012W
          Length = 356

 Score = 35.0 bits (79), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 138 IYVHPFDNPDIWEGH-ATLVDEIMETLNSQKIQTENVKGIVCSVGGGGLYNGIMQGL 193
           ++ + FDN   W+ H AT   EI++ + +  ++   V    CS G GG ++GI + L
Sbjct: 156 VWTNQFDNEANWKAHYATTGPEILQQMRNAGLE---VDAFTCSTGTGGTFSGIARYL 209

>Kpol_1013.43 s1013 complement(97761..98366) [606 bp, 201 aa] {ON}
           complement(97761..98366) [606 nt, 202 aa]
          Length = 201

 Score = 34.3 bits (77), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 32/72 (44%), Gaps = 3/72 (4%)

Query: 251 KKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALH---LAYNVDILEKALGHSLTP 307
           K YN +    DD  +  TC    +  N++A PA     H    A N+ + + +L  S TP
Sbjct: 46  KSYNHKEGQTDDYIIFATCANTEKYENILANPAVSLLFHDWITANNLSVRKNSLSQSATP 105

Query: 308 NDVILVIACGGS 319
           +   L  +  GS
Sbjct: 106 DPTTLPTSTKGS 117

>TBLA0E01580 Chr5 (373152..374672) [1521 bp, 506 aa] {ON} Anc_4.69
           YGR155W
          Length = 506

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 43/200 (21%), Positives = 77/200 (38%), Gaps = 19/200 (9%)

Query: 21  PQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRAHVXXXXXXXXXXXXXXXCQR 80
           P+++ K E   P GS K R I   ++++A     I   R+ +                  
Sbjct: 30  PKIYAKLELYNPGGSIKDR-IAKYMIEDAEARGIIDPSRSTLIEPTSGNTGIGLALIGAI 88

Query: 81  LSLPCTVVVPTATKTRMVEKIRNTGAKVIVN--GAHWKEADQH------LKKTVMSQIDL 132
                 + +P       V  ++  GA++I     A W   + H      L+K +   I L
Sbjct: 89  KGYRTIITLPEKMSNEKVSVLKALGAEIIRTPTQAAWDSPESHIGVAKKLEKEIPGAIIL 148

Query: 133 KTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKGIVCSVGGGGLYNGIMQG 192
                +  +PF +   +EG    + E ++ L     + E +  ++   G GG  +GI + 
Sbjct: 149 DQYNNMQ-NPFAH---YEGTGREIKEQLQELK----KYEKLNAVIAGAGTGGTISGIAKY 200

Query: 193 LEKHGLAEKIPIVGVETRGC 212
           L++     KI IVG +  G 
Sbjct: 201 LKEQN--PKIKIVGADPEGS 218

>KAFR0F03450 Chr6 (686311..687471) [1161 bp, 386 aa] {ON} 
          Length = 386

 Score = 33.9 bits (76), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 51/263 (19%), Positives = 107/263 (40%), Gaps = 28/263 (10%)

Query: 22  QLFLKYECLQPSGSFKSRGIGNLI-LKNAMRIQKIGERRAHVXXXXXXXXXXXXXXXCQR 80
           +++ K E + P+GS K R   N++       + K GE    V               C  
Sbjct: 65  EVYAKLELVNPAGSAKDRVALNIVQTAEKQGLLKRGE-PGWVFEGTSGSTGISIAMICNA 123

Query: 81  LSLPCTVVVPTATKTRMVEKIRNTGAKV-IVNGAHWKEADQHL--KKTVMSQIDLKTTE- 136
           L     + +P  T    +  + + GA V +V  A   + +Q++   K+   +++ K  E 
Sbjct: 124 LGYKAHISLPDDTSNEKLALLESLGAVVNMVKPASIVDPNQYVNASKSACEELNRKGVER 183

Query: 137 PIYVHPFDNPDIWEGH-ATLVDEIMETLNSQKIQTENVKGIVCSVGGGGLYNGIMQGLEK 195
            ++   F+N   W+ H  T   E+ + +N +      +   +   G GG  +G+ + L+ 
Sbjct: 184 GVFADQFENEANWKVHFQTTGPEVYKQMNGK------IDAFIAGCGTGGTISGVSKYLKD 237

Query: 196 HGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFE-----------KITSIATSLGTASISK 244
               +   +V  + +G    N    +N  + ++           ++ +I   +G   ++ 
Sbjct: 238 VKGLKNCHVVLADPQGSGFYN---RINFDVMYDSAEKEGTRRRHQVDTIVEGIGLNRLT- 293

Query: 245 QTFELAKKYNTRSVVVDDSKVIE 267
           Q F++ + Y   S+ V DS+ I+
Sbjct: 294 QNFKIGESYIDESIRVSDSQAIK 316

>NCAS0C05620 Chr3 (1144950..1146458) [1509 bp, 502 aa] {ON} Anc_4.69
          Length = 502

 Score = 33.9 bits (76), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 45/201 (22%), Positives = 77/201 (38%), Gaps = 21/201 (10%)

Query: 21  PQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRAHVXXXXXXXXXXXXXXXCQR 80
           PQ+F K E   P GS K R I   +++ A    +I   R  +                  
Sbjct: 32  PQVFAKLELYNPGGSIKDR-IAKSMIEEAEARGEISPERTTLIEPTSGNTGIGLALIGAI 90

Query: 81  LSLPCTVVVPTATKTRMVEKIRNTGAKVIV--NGAHWKEADQH------LKKTVMSQIDL 132
                 + +P       V  ++  GA++I     A W   + H      L+K +   + L
Sbjct: 91  KGYRTIITLPEKMSNEKVSVLKALGAEIIRTPTEAAWDSPESHIGVALRLEKEIPGAVIL 150

Query: 133 KTTEPIYVHPFDNPDI-WEGHATLVDEIMETLNSQKIQTENVKGIVCSVGGGGLYNGIMQ 191
                 Y +P  NPD  ++G    +   +E L+    + + +  +V   G GG  +GI +
Sbjct: 151 DQ----YNNPM-NPDAHYKGTGKEIKLQLEHLH----KFDKLNAVVAGAGTGGTISGIAK 201

Query: 192 GLEKHGLAEKIPIVGVETRGC 212
            +++     KI IVG +  G 
Sbjct: 202 YIKEQD--PKIQIVGADPVGS 220

>Kwal_47.16696 s47 complement(67984..72276) [4293 bp, 1430 aa] {ON}
            YJR137C (ECM17) - Putative sulfite reductase [contig 376]
            FULL
          Length = 1430

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 33/75 (44%), Gaps = 21/75 (28%)

Query: 123  KKTVMSQIDLKTTEPIY--------------VHPFDNPDIWEGHATLVDEIMETLNSQKI 168
            KKT++S   L   EPIY              V PF++ D+W     L+  + E+      
Sbjct: 1038 KKTLVSGNALVDVEPIYGPTYLPRKFKVNIAVPPFNDVDVWSSDVGLIAIVDES------ 1091

Query: 169  QTENVKGIVCSVGGG 183
             T+ VKG    VGGG
Sbjct: 1092 -TQTVKGFNLYVGGG 1105

>TPHA0F00890 Chr6 (206111..207325) [1215 bp, 404 aa] {ON} Anc_4.148
           YGR012W
          Length = 404

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 70/343 (20%), Positives = 123/343 (35%), Gaps = 50/343 (14%)

Query: 22  QLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRAHVXXXXXXXXXXXXXXXCQRL 81
            ++ K E   P+GS K R   N+I         +  +   V               C  L
Sbjct: 75  NIYAKLELNNPAGSAKDRVALNIIKTAEKEGLLVRGKPGVVFEGTSGSTGISIAMICNAL 134

Query: 82  SLPCTVVVPTATKTRMVEKIRNTGAKV-------------IVNGAHWKEADQHLKKTVMS 128
                + +P  T    +  + + GA +              VN A  K+A   L +    
Sbjct: 135 GYKSYISLPDDTSNEKLALLESLGATLNKVKPAAIIDPNQYVNAA--KKACGDLNRENED 192

Query: 129 QIDLKTTEPIYVHPFDNPDIWEGHATLVD-EIMETLNSQKIQTENVKGIVCSVGGGGLYN 187
           + D      I+   F+N   W  H      EI + LN       N++  +   G GG  +
Sbjct: 193 KPDELRIRGIFADQFENESNWRAHYEATGPEIYKQLNG------NIQAFIAGCGTGGTIS 246

Query: 188 GIMQGL-EKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFE-----------KITSIAT 235
           G+ + L EK GL   + +V  + +G    N    +N  + ++           ++ +I  
Sbjct: 247 GVSKYLKEKIGLI-NLHVVLADPQGSGFYN---RINYGVMYDTVEKEGTRRRHQVDTIVE 302

Query: 236 SLGTASISKQTFELAKKYNTRSVVVDDSKVIETC--LKYTRDFNMVAEPACGAALHLAYN 293
            +G   I+   F   +     S+ V+D + I+    L       + +  A  A   +   
Sbjct: 303 GIGLNRIT-NNFSKGEHLIDESIRVNDEQAIKMAKFLSVNDGLFIGSSTAINAVAAV--- 358

Query: 294 VDILEKALGHSLTPNDVILVIACGGSSNTLKDLEDTLVTLNSK 336
             IL K    ++ PN  I++IAC   S  L     + V ++S+
Sbjct: 359 --ILSK----NMKPNSNIVIIACDSGSRHLSKFWKSAVAIDSE 395

>SAKL0H23364g Chr8 complement(2023937..2025424) [1488 bp, 495 aa]
           {ON} highly similar to uniprot|P32582 Saccharomyces
           cerevisiae YGR155W CYS4 Cystathionine beta-synthase
           catalyzes the synthesis of cystathionine from serine and
           homocysteine the first committed step in cysteine
           biosynthesis
          Length = 495

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 44/215 (20%), Positives = 82/215 (38%), Gaps = 16/215 (7%)

Query: 21  PQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRAHVXXXXXXXXXXXXXXXCQR 80
           PQ++ K E   P GS K R I   +++ A    +I   R  +                  
Sbjct: 34  PQIYAKLELYNPGGSIKDR-IAKSMIEYAESQGQIHPSRTTLIEPTSGNTGIGLALIGAV 92

Query: 81  LSLPCTVVVPTATKTRMVEKIRNTGAKVIV--NGAHWKEADQHLKKTVMSQIDLKTTEPI 138
                 + +P       V  ++  GA++I     A W   + H+   V  +++ +    +
Sbjct: 93  KGYRTIITLPEKMSNEKVSVLKALGAEIIRTPTAAAWDSPESHI--GVAKRLENEIPGAV 150

Query: 139 YVHPFD---NPDI-WEGHATLVDEIMETLNSQKIQTENVKGIVCSVGGGGLYNGIMQGLE 194
            +  ++   NPD  + G    +   +  LN    +   +  ++   G GG  +GI + L+
Sbjct: 151 ILDQYNNMKNPDAHYHGTGKEIQTQLNDLN----KFSKLHAVIAGAGTGGTISGISKYLK 206

Query: 195 KHGLAEKIPIVGVETRGCHVLN-TSLNLNKQIEFE 228
           +     KI IVG +  G  +    SLN     E++
Sbjct: 207 EQD--SKIQIVGADPVGSILAQPESLNDTDSAEYK 239

>TBLA0B07240 Chr2 complement(1716738..1717877) [1140 bp, 379 aa]
           {ON} Anc_2.343 YDL104C
          Length = 379

 Score = 30.8 bits (68), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 48/108 (44%), Gaps = 4/108 (3%)

Query: 160 METLNSQKIQTENVKGIVCSVGGGGLYNGIMQGLE-KHGLA--EKIPIVGVETRGCHVLN 216
           M  L  QKI  +N   +VC+  G G+   +  GL+   GLA    +P+VGV     H+L 
Sbjct: 78  MVNLILQKIPLDNKLDLVCATRGPGMPGSLAVGLDFAKGLAVGRGVPLVGVHHMLGHLLV 137

Query: 217 TSLNLNKQIEFEKITSIATSLGTASISKQTFELAKKY-NTRSVVVDDS 263
           + L     + F   T + +   T  +  ++ E  K   NT  +   D+
Sbjct: 138 SRLKNESSLNFPFATLLVSGGHTQLVVSKSVEEHKVICNTLDIAAGDA 185

>KAFR0H02090 Chr8 complement(397562..400285) [2724 bp, 907 aa] {ON}
           Anc_8.359 YLR148W
          Length = 907

 Score = 30.4 bits (67), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 44/93 (47%), Gaps = 5/93 (5%)

Query: 269 CLKYTRDFNMVAEPACGAALHLAYNV--DILEKALGHSLTPNDVILVIACGGSSNTLKDL 326
           C+++  D +++A  + G    + +N   D + K L  S  P  +  V+  GG+ N L  +
Sbjct: 119 CIQWLDDNSLLAGTSNGHIYSILFNNINDPVIKVLWKSKMPASISGVLYNGGNGNILVAI 178

Query: 327 EDTLVTLNSKSIPSPPEYWIPSQVLKKTHIKQL 359
           ++TL+   S    SP +     Q +K T IK  
Sbjct: 179 DNTLIYWKSDVFSSPIK---TLQEIKPTEIKDF 208

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,739,996
Number of extensions: 1447736
Number of successful extensions: 4240
Number of sequences better than 10.0: 96
Number of HSP's gapped: 4236
Number of HSP's successfully gapped: 96
Length of query: 359
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 248
Effective length of database: 40,753,473
Effective search space: 10106861304
Effective search space used: 10106861304
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)