Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0C001601.2ON20320310721e-150
Kpol_2002.31.2ON2232173803e-45
KAFR0D007201.121ON2062053514e-41
NCAS0B091401.2ON2052053515e-41
NDAI0A001101.2ON2112073472e-40
Skud_3.1181.121ON2102033307e-38
Suva_3.1471.2ON2102033281e-37
YCR039C (MATALPHA2)1.121ON2102033281e-37
YCL067C (HMLALPHA2)1.2ON2102033281e-37
TPHA0E040701.2ON2312253022e-33
TPHA0E036101.121ON2312253022e-33
Skud_102.1singletonON1851782895e-32
Smik_95.1singletonON1851782895e-32
Smik_3.1421.121ON2281782856e-31
ZYRO0F15818g1.121ON2252162787e-30
ZYRO0F18568g1.2ON2252162787e-30
CAGL0B01265g1.121ON1862042703e-29
Suva_3.135singletonON119942637e-29
Suva_3.74singletonON119942637e-29
Suva_3.751.121ON119942637e-29
YCR096C (HMRA2)singletonOFF119942637e-29
CAGL0B00264g1.2ON2101962602e-27
Ecym_11151.121ON2301592203e-21
Ecym_10021.2ON2301592203e-21
TBLA0A070501.121ON2612482101e-19
TDEL0C070001.2ON2371702037e-19
TBLA0A076001.2ON2302342029e-19
KLLA0C00374g1.2ON2232241862e-16
Kwal_YGOB_matalpha21.121ON110541162e-07
Kwal_33.12995singletonOFF110541162e-07
Kwal_YGOB_HMalpha21.2ON110541162e-07
Kwal_33.matalpha2singletonOFF110541162e-07
KLTH0F00396g1.2ON108661066e-06
Kpol_1036.566.170ON26575983e-04
Skud_16.1036.170ON29570890.005
Skud_71.2singletonON4538800.006
Suva_7.1726.170ON27098870.007
KLTH0H05236g6.170ON23448870.007
YGL096W (TOS8)6.170ON27644870.008
Smik_7.1816.170ON27448870.008
Kwal_27.110926.170ON22948850.012
Suva_16.1326.170ON29265860.012
CAGL0H02959g6.170ON25948850.012
CAGL0C01551g6.170ON22169840.015
AFL049C6.170ON25793840.018
Skud_7.1816.170ON27460840.019
YPL177C (CUP9)6.170ON30648840.020
Smik_6.3746.170ON29464830.028
Ecym_22476.170ON34957830.028
SAKL0A05610g6.170ON32048820.035
TBLA0C037406.170ON29348820.039
KNAG0M005006.170ON29844810.047
NCAS0H011306.170ON28047800.056
NDAI0F021706.170ON38344810.057
TDEL0F018106.170ON25648800.059
KAFR0G036506.170ON17748780.078
TPHA0B025806.170ON26448790.089
KLLA0B10450g6.170ON38944780.11
NDAI0I013206.170ON40970770.16
ZYRO0G22044g6.170ON20165740.25
KAFR0A043706.170ON40948740.38
KNAG0F022106.170ON32448730.45
NCAS0D035706.170ON25752720.56
Suva_69.1singletonON3434603.0
TPHA0M011303.274ON64175648.0
CAGL0E00341gna 1ON13039618.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0C00160
         (203 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0C00160 Chr3 (25548..26159) [612 bp, 203 aa] {ON} Anc_1.2 YC...   417   e-150
Kpol_2002.3 s2002 (4682..5353) [672 bp, 223 aa] {ON} (4682..5353...   150   3e-45
KAFR0D00720 Chr4 (128684..129304) [621 bp, 206 aa] {ON}  mating ...   139   4e-41
NCAS0B09140 Chr2 complement(1754708..1755325) [618 bp, 205 aa] {...   139   5e-41
NDAI0A00110 Chr1 (1584..2219) [636 bp, 211 aa] {ON} Anc_1.2  sil...   138   2e-40
Skud_3.118 Chr3 complement(184042..184674) [633 bp, 210 aa] {ON}...   131   7e-38
Suva_3.147 Chr3 complement(221912..222544) [633 bp, 210 aa] {ON}...   130   1e-37
YCR039C Chr3 complement(199546..200178) [633 bp, 210 aa] {ON}  M...   130   1e-37
YCL067C Chr3 complement(12386..13018) [633 bp, 210 aa] {ON}  HML...   130   1e-37
TPHA0E04070 Chr5 complement(848980..849613,849670..849731) [696 ...   120   2e-33
TPHA0E03610 Chr5 complement(765003..765636,765693..765754) [696 ...   120   2e-33
Skud_102.1 Chr102 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)       115   5e-32
Smik_95.1 Chr95 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)         115   5e-32
Smik_3.142 Chr3 complement(197575..198261) [687 bp, 228 aa] {ON}...   114   6e-31
ZYRO0F15818g Chr6 complement(1302816..1303493) [678 bp, 225 aa] ...   111   7e-30
ZYRO0F18568g Chr6 complement(1532755..1533432) [678 bp, 225 aa] ...   111   7e-30
CAGL0B01265g Chr2 (113719..114279) [561 bp, 186 aa] {ON} similar...   108   3e-29
Suva_3.135 Chr3 complement(211196..211555) [360 bp, 119 aa] {ON}...   105   7e-29
Suva_3.74 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON} ...   105   7e-29
Suva_3.75 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON} ...   105   7e-29
YCR096C Chr3 complement(293179..293538) [360 bp, 119 aa] {OFF}  ...   105   7e-29
CAGL0B00264g Chr2 (11470..12102) [633 bp, 210 aa] {ON} highly si...   104   2e-27
Ecym_1115 Chr1 (237261..237485,237542..238009) [693 bp, 230 aa] ...    89   3e-21
Ecym_1002 Chr1 complement(5334..5801,5858..6082) [693 bp, 230 aa...    89   3e-21
TBLA0A07050 Chr1 (1728941..1729002,1729096..1729189,1729249..172...    86   1e-19
TDEL0C07000 Chr3 complement(1273613..1274326) [714 bp, 237 aa] {...    83   7e-19
TBLA0A07600 Chr1 (1882710..1882771,1882865..1882958,1883018..188...    82   9e-19
KLLA0C00374g Chr3 (25132..25803) [672 bp, 223 aa] {ON} uniprot|Q...    76   2e-16
Kwal_YGOB_matalpha2 s33 (284511..284843) [333 bp, 110 aa] {ON} (...    49   2e-07
Kwal_33.12995 s33 (32369..32701) [333 bp, 110 aa] {OFF} YCR096C ...    49   2e-07
Kwal_YGOB_HMalpha2 s33 (32369..32701) [333 bp, 110 aa] {ON} ANNO...    49   2e-07
Kwal_33.matalpha2 s33 (284511..284843) [333 bp, 110 aa] {OFF} (m...    49   2e-07
KLTH0F00396g Chr6 (31990..32051,32348..32612) [327 bp, 108 aa] {...    45   6e-06
Kpol_1036.56 s1036 (153997..154794) [798 bp, 265 aa] {ON} (15399...    42   3e-04
Skud_16.103 Chr16 complement(185398..186285) [888 bp, 295 aa] {O...    39   0.005
Skud_71.2 Chr71 (734..868) [135 bp, 45 aa] {ON} YCL067C (REAL)         35   0.006
Suva_7.172 Chr7 (319317..320129) [813 bp, 270 aa] {ON} YGL096W (...    38   0.007
KLTH0H05236g Chr8 complement(465998..466702) [705 bp, 234 aa] {O...    38   0.007
YGL096W Chr7 (325331..326161) [831 bp, 276 aa] {ON}  TOS8Homeodo...    38   0.008
Smik_7.181 Chr7 (319819..320643) [825 bp, 274 aa] {ON} YGL096W (...    38   0.008
Kwal_27.11092 s27 (635052..635741) [690 bp, 229 aa] {ON} YPL177C...    37   0.012
Suva_16.132 Chr16 complement(222346..223224) [879 bp, 292 aa] {O...    38   0.012
CAGL0H02959g Chr8 (277540..278319) [780 bp, 259 aa] {ON} some si...    37   0.012
CAGL0C01551g Chr3 complement(169232..169897) [666 bp, 221 aa] {O...    37   0.015
AFL049C Chr6 complement(346546..347319) [774 bp, 257 aa] {ON} Sy...    37   0.018
Skud_7.181 Chr7 (328628..329449) [822 bp, 274 aa] {ON} YGL096W (...    37   0.019
YPL177C Chr16 complement(213042..213962) [921 bp, 306 aa] {ON}  ...    37   0.020
Smik_6.374 Chr6 (610093..610977) [885 bp, 294 aa] {ON} YPL177C (...    37   0.028
Ecym_2247 Chr2 complement(486469..487518) [1050 bp, 349 aa] {ON}...    37   0.028
SAKL0A05610g Chr1 complement(506437..507399) [963 bp, 320 aa] {O...    36   0.035
TBLA0C03740 Chr3 complement(892360..893241) [882 bp, 293 aa] {ON...    36   0.039
KNAG0M00500 Chr13 complement(79067..79963) [897 bp, 298 aa] {ON}...    36   0.047
NCAS0H01130 Chr8 complement(216012..216854) [843 bp, 280 aa] {ON...    35   0.056
NDAI0F02170 Chr6 (527340..528491) [1152 bp, 383 aa] {ON} Anc_6.1...    36   0.057
TDEL0F01810 Chr6 complement(338066..338836) [771 bp, 256 aa] {ON...    35   0.059
KAFR0G03650 Chr7 (752766..753299) [534 bp, 177 aa] {ON} Anc_6.17...    35   0.078
TPHA0B02580 Chr2 (592073..592867) [795 bp, 264 aa] {ON} Anc_6.17...    35   0.089
KLLA0B10450g Chr2 (912877..914046) [1170 bp, 389 aa] {ON} some s...    35   0.11 
NDAI0I01320 Chr9 complement(318160..319389) [1230 bp, 409 aa] {O...    34   0.16 
ZYRO0G22044g Chr7 (1814345..1814950) [606 bp, 201 aa] {ON} some ...    33   0.25 
KAFR0A04370 Chr1 complement(870590..871819) [1230 bp, 409 aa] {O...    33   0.38 
KNAG0F02210 Chr6 complement(423243..424217) [975 bp, 324 aa] {ON...    33   0.45 
NCAS0D03570 Chr4 (664388..665161) [774 bp, 257 aa] {ON} Anc_6.17...    32   0.56 
Suva_69.1 Chr69 complement(1..102) [102 bp, 34 aa] {ON} YCR039C ...    28   3.0  
TPHA0M01130 Chr13 complement(226403..228328) [1926 bp, 641 aa] {...    29   8.0  
CAGL0E00341g Chr5 (29668..29775,29840..30076,30143..30190) [393 ...    28   8.3  

>KNAG0C00160 Chr3 (25548..26159) [612 bp, 203 aa] {ON} Anc_1.2
           YCL067C silent copy of mating type alpha2 gene at HML
           locus
          Length = 203

 Score =  417 bits (1072), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 203/203 (100%), Positives = 203/203 (100%)

Query: 1   MNRIEIQDLLNNQDCSSLDKDFKNINSQLLEICSNFPKELLSNHGELQMQLQGILLFLTK 60
           MNRIEIQDLLNNQDCSSLDKDFKNINSQLLEICSNFPKELLSNHGELQMQLQGILLFLTK
Sbjct: 1   MNRIEIQDLLNNQDCSSLDKDFKNINSQLLEICSNFPKELLSNHGELQMQLQGILLFLTK 60

Query: 61  LVGKNDLSVTLKNEARMTYQFSKIIASLLKSFEDFFFERKEYNDPATSENEFVFSVVTQD 120
           LVGKNDLSVTLKNEARMTYQFSKIIASLLKSFEDFFFERKEYNDPATSENEFVFSVVTQD
Sbjct: 61  LVGKNDLSVTLKNEARMTYQFSKIIASLLKSFEDFFFERKEYNDPATSENEFVFSVVTQD 120

Query: 121 MMNKRKESMRPCRGHRFSSNSTETLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIRNW 180
           MMNKRKESMRPCRGHRFSSNSTETLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIRNW
Sbjct: 121 MMNKRKESMRPCRGHRFSSNSTETLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIRNW 180

Query: 181 VSNRRRKEKSIHVSPVIQDLLQE 203
           VSNRRRKEKSIHVSPVIQDLLQE
Sbjct: 181 VSNRRRKEKSIHVSPVIQDLLQE 203

>Kpol_2002.3 s2002 (4682..5353) [672 bp, 223 aa] {ON} (4682..5353)
           [672 nt, 224 aa]
          Length = 223

 Score =  150 bits (380), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 91/217 (41%), Positives = 126/217 (58%), Gaps = 14/217 (6%)

Query: 1   MNRIEIQDLLNNQDCSSLDKDFKNINSQLLEICSNFPKELLSNHGELQMQLQGILLFLTK 60
           MN+I I  LLN     +L    + IN +L  +CS  P        E  ++LQ ILLFLT 
Sbjct: 1   MNKIPINILLNPSHQENLKDKLQQINDKLTSLCSKIPGNTSGLEQEDHLELQRILLFLTT 60

Query: 61  LVGKNDLSVTLKNEARMTYQFSKIIASLLKSF----EDFFFE------RKEYNDPATSE- 109
           +V    L        R TYQ S  ++ ++KS     E++  +       +E   P++S+ 
Sbjct: 61  VVKNEKLDNDEIMLVRTTYQLSTTLSIMVKSLRMANENYESQTSKENSEEELTSPSSSDS 120

Query: 110 ---NEFVFSVVTQDMMNKRKESMRPCRGHRFSSNSTETLEDWYKKHHEKPYLDKRSLHEL 166
              NEFVF++VTQDMMNK+K +++  RGHR    + + LE WY ++ E PYLD +S+ EL
Sbjct: 121 NDRNEFVFNIVTQDMMNKKKMNIKSYRGHRLPKQNVKLLERWYIQNVENPYLDDKSISEL 180

Query: 167 EFKTKLSKMQIRNWVSNRRRKEKSIHVSPVIQDLLQE 203
              T LSK+QI+NWVSNRRRKEKSI +SP +  LLQE
Sbjct: 181 MKITSLSKVQIKNWVSNRRRKEKSITISPEVSRLLQE 217

>KAFR0D00720 Chr4 (128684..129304) [621 bp, 206 aa] {ON}  mating
           type gene MATalpha2
          Length = 206

 Score =  139 bits (351), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 81/205 (39%), Positives = 124/205 (60%), Gaps = 3/205 (1%)

Query: 1   MNRIEIQDLLNNQDCSSLDKDFKNINSQLLEICSNFPKELLSNHGELQMQLQGILLFLTK 60
           MN+I+IQDLLN+       ++ ++IN +L  +CS  P        E  ++L+ I+L L+K
Sbjct: 1   MNKIQIQDLLNSPRDVDTKQELRDINDKLFALCSKLPSSEALLEAEFHLELRDIMLNLSK 60

Query: 61  LVGKNDLSVTLKNEARMTYQFSKIIASLLKSFEDFFFERKEYNDPATSENEF--VFSVVT 118
           L   + +    K+ A   +Q +  + +L+K  ++F          + SE++   VF+VVT
Sbjct: 61  LQDTSRMGSEEKHLAYTAHQLTCTMITLIKGMKNFHGTGGHSYSSSKSESDDKTVFNVVT 120

Query: 119 QDMMNKRKESMRPCRGHRFSSNSTETLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIR 178
           QDMMN  +  +   RGHRFS  + + LE WY  H ++PYL+++S   L  KT LS++QI+
Sbjct: 121 QDMMNLNRTGI-SYRGHRFSKENVKVLERWYTAHIDRPYLNRQSTEYLISKTGLSRVQIK 179

Query: 179 NWVSNRRRKEKSIHVSPVIQDLLQE 203
           NWVSNRRRKEKS+HVSP +  LLQ+
Sbjct: 180 NWVSNRRRKEKSVHVSPELIQLLQK 204

>NCAS0B09140 Chr2 complement(1754708..1755325) [618 bp, 205 aa] {ON}
           Anc_1.2
          Length = 205

 Score =  139 bits (351), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 84/205 (40%), Positives = 121/205 (59%), Gaps = 8/205 (3%)

Query: 1   MNRIEIQDLLNNQDCSSLDKDFKNINSQLLEICSNFPKELLSNHGELQMQLQGILLFLTK 60
           MN+I I DLLN  + +   +  ++IN+QL  ICS FP     +    Q QL+ I + L+ 
Sbjct: 1   MNKIAIHDLLNPPNTTKTHEQLESINTQLNTICSVFPTTENLDFKTYQEQLRNIAVTLSS 60

Query: 61  LVGKNDLSVTLKNEARMTYQFSKIIASLLKSFEDFFFERKEYNDPATSENE----FVFSV 116
           L  +N+LS   KN  R+TYQ S ++  LL   E+   + +     + SE+E     VF++
Sbjct: 61  LTNQNELSSENKNVLRVTYQISSVLLKLLG--ENAHNKDQPKTPTSGSESERNPKLVFNI 118

Query: 117 VTQDMMNKRKESMRPCRGHRFSSNSTETLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQ 176
           +T+  M+    S  P RGHR +    + LE WY +H + PYL+K SL  L  +T LSKMQ
Sbjct: 119 LTKKRMSP--TSNEPRRGHRLAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQ 176

Query: 177 IRNWVSNRRRKEKSIHVSPVIQDLL 201
           I+NWVSNRRRKEKS+ ++P I D+L
Sbjct: 177 IKNWVSNRRRKEKSLSIAPEIVDIL 201

>NDAI0A00110 Chr1 (1584..2219) [636 bp, 211 aa] {ON} Anc_1.2  silent
           copy of MATalpha2 gene at HMLalpha
          Length = 211

 Score =  138 bits (347), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 78/207 (37%), Positives = 121/207 (58%), Gaps = 8/207 (3%)

Query: 1   MNRIEIQDLLNNQDCSSLDKDFKNINSQLLEICSNFPKELLSNHGELQMQLQGILLFLTK 60
           MN+I I DLLN      +  +  +IN+QL+ ICS FP    +  G  Q+QL  I+ FL+ 
Sbjct: 1   MNKIAISDLLNPPTAGPVTSNLDSINNQLVTICSKFPTAKENVDGSYQIQLHNIVSFLST 60

Query: 61  LVGKNDLSVTLKNEARMTYQFSKIIASLLKSF------EDFFFERKEYNDPATSENEFVF 114
           L    +L+    +  ++TY+ S ++  +LK        E+   ++ +  +   + +++VF
Sbjct: 61  LTQSTNLTSKDCSNIQLTYELSSMLGKVLKDMVLLNGTEEVEKKKVKEEEELETNSKYVF 120

Query: 115 SVVTQDMMNKRKESMRPCRGHRFSSNSTETLEDWYKKHHEKPYLDKRSLHELEFKTKLSK 174
           +V+TQDMM   K   +P RGHR        LE WY  H +KPYLD ++L  L  +TKLSK
Sbjct: 121 NVITQDMMIPEKN--KPHRGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSK 178

Query: 175 MQIRNWVSNRRRKEKSIHVSPVIQDLL 201
           +QI+NW+SNRRRKEK + +SP I +++
Sbjct: 179 VQIKNWISNRRRKEKLLSISPDIVEII 205

>Skud_3.118 Chr3 complement(184042..184674) [633 bp, 210 aa] {ON}
           YCR039C (REAL)
          Length = 210

 Score =  131 bits (330), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 84/203 (41%), Positives = 115/203 (56%), Gaps = 5/203 (2%)

Query: 1   MNRIEIQDLLNNQDCSSLDKDFKNINSQLLEICSNFPKELLSNHGELQMQLQGILLFLTK 60
           MN+I I+DLLN Q       +  +IN +L  IC N PK   S   E +++L+ IL FL++
Sbjct: 1   MNKIPIKDLLNPQITDEFKSNILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR 60

Query: 61  LVGKNDLSVTLKNEARMTYQFSKIIASLLKSFEDFFFERKEY--NDPATSENEFVFSVVT 118
                 +S   K   + T Q +  I  LLK       +R  Y       S +  VF+VVT
Sbjct: 61  ANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSNYQLTQKNKSADGLVFNVVT 120

Query: 119 QDMMNKRKESMRPCRGHRFSSNSTETLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIR 178
           QDM+NK   S +P RGHRF+  +   LE W+ K+ E PYLD + L  L   T LS++QI+
Sbjct: 121 QDMINK---STKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIK 177

Query: 179 NWVSNRRRKEKSIHVSPVIQDLL 201
           NWVSNRRRKEK+I ++P + DLL
Sbjct: 178 NWVSNRRRKEKTITIAPELADLL 200

>Suva_3.147 Chr3 complement(221912..222544) [633 bp, 210 aa] {ON}
           (REAL)
          Length = 210

 Score =  130 bits (328), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 84/203 (41%), Positives = 114/203 (56%), Gaps = 5/203 (2%)

Query: 1   MNRIEIQDLLNNQDCSSLDKDFKNINSQLLEICSNFPKELLSNHGELQMQLQGILLFLTK 60
           MN+I I+DLLN Q          +IN +L  IC N PK   S   E +++L+ IL FL++
Sbjct: 1   MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR 60

Query: 61  LVGKNDLSVTLKNEARMTYQFSKIIASLLKSFEDFFFERKEY--NDPATSENEFVFSVVT 118
                 +S   K   + T Q +  I  LLK       +R  Y       S +  VF+VVT
Sbjct: 61  ANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSNYQLTQKNKSADGLVFNVVT 120

Query: 119 QDMMNKRKESMRPCRGHRFSSNSTETLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIR 178
           QDM+NK   S +P RGHRF+  +   LE W+ K+ E PYLD + L  L   T LS++QI+
Sbjct: 121 QDMINK---STKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIK 177

Query: 179 NWVSNRRRKEKSIHVSPVIQDLL 201
           NWVSNRRRKEK+I ++P + DLL
Sbjct: 178 NWVSNRRRKEKTITIAPELADLL 200

>YCR039C Chr3 complement(199546..200178) [633 bp, 210 aa] {ON}
           MATALPHA2Homeobox-domain protein that, with Mcm1p,
           represses a-specific genes in haploids; acts with A1p to
           repress transcription of haploid-specific genes in
           diploids; one of two genes encoded by the MATalpha
           mating type cassette
          Length = 210

 Score =  130 bits (328), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 84/203 (41%), Positives = 114/203 (56%), Gaps = 5/203 (2%)

Query: 1   MNRIEIQDLLNNQDCSSLDKDFKNINSQLLEICSNFPKELLSNHGELQMQLQGILLFLTK 60
           MN+I I+DLLN Q          +IN +L  IC N PK   S   E +++L+ IL FL++
Sbjct: 1   MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR 60

Query: 61  LVGKNDLSVTLKNEARMTYQFSKIIASLLKSFEDFFFERKEY--NDPATSENEFVFSVVT 118
                 +S   K   + T Q +  I  LLK       +R  Y       S +  VF+VVT
Sbjct: 61  ANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSNYQLTQKNKSADGLVFNVVT 120

Query: 119 QDMMNKRKESMRPCRGHRFSSNSTETLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIR 178
           QDM+NK   S +P RGHRF+  +   LE W+ K+ E PYLD + L  L   T LS++QI+
Sbjct: 121 QDMINK---STKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIK 177

Query: 179 NWVSNRRRKEKSIHVSPVIQDLL 201
           NWVSNRRRKEK+I ++P + DLL
Sbjct: 178 NWVSNRRRKEKTITIAPELADLL 200

>YCL067C Chr3 complement(12386..13018) [633 bp, 210 aa] {ON}
           HMLALPHA2Silenced copy of ALPHA2 at HML; homeobox-domain
           protein that associates with Mcm1p in haploid cells to
           repress a-specific gene expression and interacts with
           a1p in diploid cells to repress haploid-specific gene
           expression
          Length = 210

 Score =  130 bits (328), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 84/203 (41%), Positives = 114/203 (56%), Gaps = 5/203 (2%)

Query: 1   MNRIEIQDLLNNQDCSSLDKDFKNINSQLLEICSNFPKELLSNHGELQMQLQGILLFLTK 60
           MN+I I+DLLN Q          +IN +L  IC N PK   S   E +++L+ IL FL++
Sbjct: 1   MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR 60

Query: 61  LVGKNDLSVTLKNEARMTYQFSKIIASLLKSFEDFFFERKEY--NDPATSENEFVFSVVT 118
                 +S   K   + T Q +  I  LLK       +R  Y       S +  VF+VVT
Sbjct: 61  ANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSNYQLTQKNKSADGLVFNVVT 120

Query: 119 QDMMNKRKESMRPCRGHRFSSNSTETLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIR 178
           QDM+NK   S +P RGHRF+  +   LE W+ K+ E PYLD + L  L   T LS++QI+
Sbjct: 121 QDMINK---STKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIK 177

Query: 179 NWVSNRRRKEKSIHVSPVIQDLL 201
           NWVSNRRRKEK+I ++P + DLL
Sbjct: 178 NWVSNRRRKEKTITIAPELADLL 200

>TPHA0E04070 Chr5 complement(848980..849613,849670..849731) [696 bp,
           231 aa] {ON}   silenced copy of alpha2 at HMLalpha locus
          Length = 231

 Score =  120 bits (302), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 78/225 (34%), Positives = 119/225 (52%), Gaps = 22/225 (9%)

Query: 1   MNRIEIQDLLNNQDCSSLDKDFKNINSQLLEICSNFPKELLSNHGELQMQLQGILLFLTK 60
           MN+I I  LLN     +L +  + IN  L  +C+  P  +         +LQ ILL+LT 
Sbjct: 1   MNKIPINKLLNPSQHYNLTEKLQQINITLSNLCTKLPDTITDLTEADHRELQDILLYLTT 60

Query: 61  LVGKNDLSVTLKNEARMTYQFSKIIASLLKS----------------FEDFFFERKEYND 104
           +V + +L        + TYQ    +  ++KS                +E    +  E N 
Sbjct: 61  VVKQQELKKEEIMLVKTTYQLCTTLTLMVKSCKQENDKENKENEIIKYESGTSDNSETNS 120

Query: 105 PA-TSENE-----FVFSVVTQDMMNKRKESMRPCRGHRFSSNSTETLEDWYKKHHEKPYL 158
              +S+NE      VF+V+TQDMMN  K++ +  RGHR    + + LEDWY  H + PYL
Sbjct: 121 SCNSSDNEDKNSILVFNVITQDMMNNNKKNNKSYRGHRLPKKNVQYLEDWYMDHRKNPYL 180

Query: 159 DKRSLHELEFKTKLSKMQIRNWVSNRRRKEKSIHVSPVIQDLLQE 203
           ++ ++  L  KT LS++Q++NW+SNRRRKEKSI +SP +  LL++
Sbjct: 181 NEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITISPEVSALLRD 225

>TPHA0E03610 Chr5 complement(765003..765636,765693..765754) [696 bp,
           231 aa] {ON} Anc_1.122 YCR039C MATalpha2 gene at MAT
           locus
          Length = 231

 Score =  120 bits (302), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 78/225 (34%), Positives = 119/225 (52%), Gaps = 22/225 (9%)

Query: 1   MNRIEIQDLLNNQDCSSLDKDFKNINSQLLEICSNFPKELLSNHGELQMQLQGILLFLTK 60
           MN+I I  LLN     +L +  + IN  L  +C+  P  +         +LQ ILL+LT 
Sbjct: 1   MNKIPINKLLNPSQHYNLTEKLQQINITLSNLCTKLPDTITDLTEADHRELQDILLYLTT 60

Query: 61  LVGKNDLSVTLKNEARMTYQFSKIIASLLKS----------------FEDFFFERKEYND 104
           +V + +L        + TYQ    +  ++KS                +E    +  E N 
Sbjct: 61  VVKQQELKKEEIMLVKTTYQLCTTLTLMVKSCKQENDKENKENEIIKYESGTSDNSETNS 120

Query: 105 PA-TSENE-----FVFSVVTQDMMNKRKESMRPCRGHRFSSNSTETLEDWYKKHHEKPYL 158
              +S+NE      VF+V+TQDMMN  K++ +  RGHR    + + LEDWY  H + PYL
Sbjct: 121 SCNSSDNEDKNSILVFNVITQDMMNNNKKNNKSYRGHRLPKKNVQYLEDWYMDHRKNPYL 180

Query: 159 DKRSLHELEFKTKLSKMQIRNWVSNRRRKEKSIHVSPVIQDLLQE 203
           ++ ++  L  KT LS++Q++NW+SNRRRKEKSI +SP +  LL++
Sbjct: 181 NEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITISPEVSALLRD 225

>Skud_102.1 Chr102 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)
          Length = 185

 Score =  115 bits (289), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 74/178 (41%), Positives = 101/178 (56%), Gaps = 5/178 (2%)

Query: 26  NSQLLEICSNFPKELLSNHGELQMQLQGILLFLTKLVGKNDLSVTLKNEARMTYQFSKII 85
           N +L  IC N PK   S   E +++L+ IL FL++      +S   K   + T Q +  I
Sbjct: 1   NKKLFSICCNLPKLPESVTTEEEVELRDILGFLSRANKNRKISDEEKKLLQTTSQLTTTI 60

Query: 86  ASLLKSFEDFFFERKEY--NDPATSENEFVFSVVTQDMMNKRKESMRPCRGHRFSSNSTE 143
             LLK       +R  Y       S +  VF+VVTQDM+NK   S +P RGHRF+  +  
Sbjct: 61  TVLLKEMRSIENDRSNYQLTQKNKSADGLVFNVVTQDMINK---STKPYRGHRFTKENVR 117

Query: 144 TLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIRNWVSNRRRKEKSIHVSPVIQDLL 201
            LE W+ K+ E PYLD + L  L   T LS++QI+NWVSNRRRKEK+I ++P + DLL
Sbjct: 118 ILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 175

>Smik_95.1 Chr95 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)
          Length = 185

 Score =  115 bits (289), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 74/178 (41%), Positives = 101/178 (56%), Gaps = 5/178 (2%)

Query: 26  NSQLLEICSNFPKELLSNHGELQMQLQGILLFLTKLVGKNDLSVTLKNEARMTYQFSKII 85
           N +L  IC N PK   S   E +++L+ IL FL++      +S   K   + T Q +  I
Sbjct: 1   NKKLFSICCNLPKLPESVTTEEEVELRDILGFLSRANKNRKISDEEKKLLQTTSQLTTTI 60

Query: 86  ASLLKSFEDFFFERKEY--NDPATSENEFVFSVVTQDMMNKRKESMRPCRGHRFSSNSTE 143
             LLK       +R  Y       S +  VF+VVTQDM+NK   S +P RGHRF+  +  
Sbjct: 61  TVLLKEMRSIENDRSNYQLTQKNKSADGLVFNVVTQDMINK---STKPYRGHRFTKENVR 117

Query: 144 TLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIRNWVSNRRRKEKSIHVSPVIQDLL 201
            LE W+ K+ E PYLD + L  L   T LS++QI+NWVSNRRRKEK+I ++P + DLL
Sbjct: 118 ILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 175

>Smik_3.142 Chr3 complement(197575..198261) [687 bp, 228 aa] {ON}
           YCL067C (REAL)
          Length = 228

 Score =  114 bits (285), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 74/178 (41%), Positives = 101/178 (56%), Gaps = 5/178 (2%)

Query: 26  NSQLLEICSNFPKELLSNHGELQMQLQGILLFLTKLVGKNDLSVTLKNEARMTYQFSKII 85
           N +L  IC N PK   S   E +++L+ IL FL++      +S   K   + T Q +  I
Sbjct: 44  NKKLFSICCNLPKLPESVTTEEEVELRDILGFLSRANKNRKISDEEKKLLQTTSQLTTTI 103

Query: 86  ASLLKSFEDFFFERKEY--NDPATSENEFVFSVVTQDMMNKRKESMRPCRGHRFSSNSTE 143
             LLK       +R  Y       S +  VF+VVTQDM+NK   S +P RGHRF+  +  
Sbjct: 104 TVLLKEMRSIENDRSNYQLTQKNKSADGLVFNVVTQDMINK---STKPYRGHRFTKENVR 160

Query: 144 TLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIRNWVSNRRRKEKSIHVSPVIQDLL 201
            LE W+ K+ E PYLD + L  L   T LS++QI+NWVSNRRRKEK+I ++P + DLL
Sbjct: 161 ILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 218

>ZYRO0F15818g Chr6 complement(1302816..1303493) [678 bp, 225 aa]
           {ON} similar to uniprot|Q6B2C0 Saccharomyces cerevisiae
           YCR039C MATALPHA2 Homeobox-domain containing protein
           which in haploid cells acts with Mcm1p to repress
           a-specific genes in diploid cells Alpha2p acts together
           with A1p to repress transcription of haploid-specific
           genes
          Length = 225

 Score =  111 bits (278), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 75/216 (34%), Positives = 114/216 (52%), Gaps = 14/216 (6%)

Query: 1   MNRIEIQDLLNNQDCSSLDKDFKNINSQLLEICSNFPKELLSNHGELQMQLQGILLFLTK 60
           MN+I I+ LLN        +  KNIN++LL +CS  P E      + + +L+ IL  L  
Sbjct: 1   MNKIPIERLLNPVHQEFPHEKLKNINNKLLALCSKLPSENEQFEKD-KAELEKILPSLNI 59

Query: 61  LVGKNDLSVTLKNEARMTYQFSKIIASLLKSFED-------FFFERKEYNDPA------T 107
           L+ +   S   +      +Q S + + LL    +       F   + +Y+ P       T
Sbjct: 60  LIRECGSSKEDQKMVHRIHQLSSVFSLLLNEVSELKSKRSQFLRSKPKYHLPYAAALGNT 119

Query: 108 SENEFVFSVVTQDMMNKRKESMRPCRGHRFSSNSTETLEDWYKKHHEKPYLDKRSLHELE 167
            +   VF++VTQD +N  + S +  RGHR   + T  LE W+ ++ E PYL   S+ EL 
Sbjct: 120 GKEGMVFNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKELM 179

Query: 168 FKTKLSKMQIRNWVSNRRRKEKSIHVSPVIQDLLQE 203
            +TKLS  QI+NWVSNRRRKEKS+ +S  + +L++E
Sbjct: 180 VETKLSGPQIKNWVSNRRRKEKSLTISFEVSELVKE 215

>ZYRO0F18568g Chr6 complement(1532755..1533432) [678 bp, 225 aa]
           {ON} similar to uniprot|Q6B2C0 Saccharomyces cerevisiae
           YCR039C MATALPHA2 Homeobox-domain containing protein
           which in haploid cells acts with Mcm1p to repress
           a-specific genes in diploid cells Alpha2p acts together
           with A1p to repress transcription of haploid-specific
           genes
          Length = 225

 Score =  111 bits (278), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 75/216 (34%), Positives = 114/216 (52%), Gaps = 14/216 (6%)

Query: 1   MNRIEIQDLLNNQDCSSLDKDFKNINSQLLEICSNFPKELLSNHGELQMQLQGILLFLTK 60
           MN+I I+ LLN        +  KNIN++LL +CS  P E      + + +L+ IL  L  
Sbjct: 1   MNKIPIERLLNPVHQEFPHEKLKNINNKLLALCSKLPSENEQFEKD-KAELEKILPSLNI 59

Query: 61  LVGKNDLSVTLKNEARMTYQFSKIIASLLKSFED-------FFFERKEYNDPA------T 107
           L+ +   S   +      +Q S + + LL    +       F   + +Y+ P       T
Sbjct: 60  LIRECGSSKEDQKMVHRIHQLSSVFSLLLNEVSELKSKRSQFLRSKPKYHLPYAAALGNT 119

Query: 108 SENEFVFSVVTQDMMNKRKESMRPCRGHRFSSNSTETLEDWYKKHHEKPYLDKRSLHELE 167
            +   VF++VTQD +N  + S +  RGHR   + T  LE W+ ++ E PYL   S+ EL 
Sbjct: 120 GKEGMVFNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKELM 179

Query: 168 FKTKLSKMQIRNWVSNRRRKEKSIHVSPVIQDLLQE 203
            +TKLS  QI+NWVSNRRRKEKS+ +S  + +L++E
Sbjct: 180 VETKLSGPQIKNWVSNRRRKEKSLTISFEVSELVKE 215

>CAGL0B01265g Chr2 (113719..114279) [561 bp, 186 aa] {ON} similar to
           uniprot|P01367 Saccharomyces cerevisiae YCR039c or
           uniprot|P01367 Saccharomyces cerevisiae YCL067c HMLALP2
           mating type regulatory protein
          Length = 186

 Score =  108 bits (270), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 105/204 (51%), Gaps = 31/204 (15%)

Query: 3   RIEIQDLLNNQDCSSLDKDFKNINSQLLEICSNFPKELLSNHGELQMQLQGILLFLTKLV 62
           RI I  LLN     +L +  + IN+QL+ +CS+ PK         +  L G    + + +
Sbjct: 6   RISITHLLNPIQEENLKEKLQEINNQLISLCSSLPK---------RQSLPGPSSDILRFL 56

Query: 63  GKNDLSVTLKNEARMTYQFSKIIASLLKSFEDFFFERKEYNDPATSENEFVFSVVTQDMM 122
            +N+L        + TY+ S +++ L                    E+E VF+VVT+D +
Sbjct: 57  SRNNLDPQEIGLIKTTYRLSTLLSKL-------------------REHEIVFNVVTKDHL 97

Query: 123 NKR---KESMRPCRGHRFSSNSTETLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIRN 179
            K+          RGHRF+  + + LE WY+ H + PYLD  S   L  KT LSK+QI+N
Sbjct: 98  LKKGVPNHYAASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKN 157

Query: 180 WVSNRRRKEKSIHVSPVIQDLLQE 203
           WV+NRRRK+KSI++SP    L+ +
Sbjct: 158 WVANRRRKQKSIYISPFRPTLMAQ 181

>Suva_3.135 Chr3 complement(211196..211555) [360 bp, 119 aa] {ON}
           YCR096C (REAL)
          Length = 119

 Score =  105 bits (263), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 66/94 (70%), Gaps = 3/94 (3%)

Query: 108 SENEFVFSVVTQDMMNKRKESMRPCRGHRFSSNSTETLEDWYKKHHEKPYLDKRSLHELE 167
           S +  VF+VVTQDM+NK   S +P RGHRF+  +   LE W+ K+ E PYLD + L  L 
Sbjct: 19  SADGLVFNVVTQDMINK---STKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLM 75

Query: 168 FKTKLSKMQIRNWVSNRRRKEKSIHVSPVIQDLL 201
             T LS++QI+NWVSNRRRKEK+I ++P + DLL
Sbjct: 76  KNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 109

>Suva_3.74 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON}
           YCR039C (REAL)
          Length = 119

 Score =  105 bits (263), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 66/94 (70%), Gaps = 3/94 (3%)

Query: 108 SENEFVFSVVTQDMMNKRKESMRPCRGHRFSSNSTETLEDWYKKHHEKPYLDKRSLHELE 167
           S +  VF+VVTQDM+NK   S +P RGHRF+  +   LE W+ K+ E PYLD + L  L 
Sbjct: 19  SADGLVFNVVTQDMINK---STKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLM 75

Query: 168 FKTKLSKMQIRNWVSNRRRKEKSIHVSPVIQDLL 201
             T LS++QI+NWVSNRRRKEK+I ++P + DLL
Sbjct: 76  KNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 109

>Suva_3.75 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON}
           YCL067C (REAL)
          Length = 119

 Score =  105 bits (263), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 66/94 (70%), Gaps = 3/94 (3%)

Query: 108 SENEFVFSVVTQDMMNKRKESMRPCRGHRFSSNSTETLEDWYKKHHEKPYLDKRSLHELE 167
           S +  VF+VVTQDM+NK   S +P RGHRF+  +   LE W+ K+ E PYLD + L  L 
Sbjct: 19  SADGLVFNVVTQDMINK---STKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLM 75

Query: 168 FKTKLSKMQIRNWVSNRRRKEKSIHVSPVIQDLL 201
             T LS++QI+NWVSNRRRKEK+I ++P + DLL
Sbjct: 76  KNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 109

>YCR096C Chr3 complement(293179..293538) [360 bp, 119 aa] {OFF}
           HMRA2Silenced copy of a2 at HMR; similarity to Alpha2p;
           required along with a1p for inhibiting expression of the
           HO endonuclease in a/alpha HO/HO diploid cells with an
           active mating-type interconversion system
          Length = 119

 Score =  105 bits (263), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 66/94 (70%), Gaps = 3/94 (3%)

Query: 108 SENEFVFSVVTQDMMNKRKESMRPCRGHRFSSNSTETLEDWYKKHHEKPYLDKRSLHELE 167
           S +  VF+VVTQDM+NK   S +P RGHRF+  +   LE W+ K+ E PYLD + L  L 
Sbjct: 19  SADGLVFNVVTQDMINK---STKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLM 75

Query: 168 FKTKLSKMQIRNWVSNRRRKEKSIHVSPVIQDLL 201
             T LS++QI+NWVSNRRRKEK+I ++P + DLL
Sbjct: 76  KNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 109

>CAGL0B00264g Chr2 (11470..12102) [633 bp, 210 aa] {ON} highly
           similar to uniprot|P01367 Saccharomyces cerevisiae
           YCR039c or uniprot|P01367 Saccharomyces cerevisiae
           YCL067c HMLALP 2 mating type regulatory protein
          Length = 210

 Score =  104 bits (260), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 102/196 (52%), Gaps = 31/196 (15%)

Query: 2   NRIEIQDLLNNQDCSSLDKDFKNINSQLLEICSNFPKELLSNHGELQMQLQGILLFLTKL 61
           +RI I  LLN     +L +  + IN+QL+ +CS+ PK         +  L G    + + 
Sbjct: 5   SRISITHLLNPIQEENLKEKLQEINNQLISLCSSLPK---------RQSLPGPSSDILRF 55

Query: 62  VGKNDLSVTLKNEARMTYQFSKIIASLLKSFEDFFFERKEYNDPATSENEFVFSVVTQDM 121
           + +N+L        + TY+ S +++ L                    E+E VF+VVT+D 
Sbjct: 56  LSRNNLDPQEIGLIKTTYRLSTLLSKL-------------------REHEIVFNVVTKDH 96

Query: 122 MNKRK---ESMRPCRGHRFSSNSTETLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIR 178
           + K+          RGHRF+  + + LE WY+ H + PYLD  S   L  KT LSK+QI+
Sbjct: 97  LLKKGVPNHYAASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIK 156

Query: 179 NWVSNRRRKEKSIHVS 194
           NWV+NRRRK+KSI++S
Sbjct: 157 NWVANRRRKQKSIYIS 172

>Ecym_1115 Chr1 (237261..237485,237542..238009) [693 bp, 230 aa]
           {ON} similar to YCL067C HMLALPHA2, 1-intron
          Length = 230

 Score = 89.4 bits (220), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 57/159 (35%), Positives = 84/159 (52%), Gaps = 12/159 (7%)

Query: 51  LQGILLFLTKLVGKNDLSVTLKNEARMTYQFSKIIASLLKSFEDFFFERKEYNDP----- 105
           LQG+ +  +  V      V ++N +    Q + II  L+   ED    +K   DP     
Sbjct: 74  LQGLKILSSDQVFSKPDRVVIQNIS----QLTAIIVRLVNKKEDIINLQKGLVDPKEIPE 129

Query: 106 ATSENE--FVFSVVTQDMM-NKRKESMRPCRGHRFSSNSTETLEDWYKKHHEKPYLDKRS 162
           A S+ +   +F+VVTQDMM N RK      +GHR      + LE WYK + E PYL+   
Sbjct: 130 AISKEKCGIIFNVVTQDMMENGRKGGSSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTD 189

Query: 163 LHELEFKTKLSKMQIRNWVSNRRRKEKSIHVSPVIQDLL 201
           +  L  +T  S+ Q++NWV+N+RRK+K   +SP + DLL
Sbjct: 190 IRILMRETGFSRSQVKNWVANKRRKDKHSTISPELSDLL 228

>Ecym_1002 Chr1 complement(5334..5801,5858..6082) [693 bp, 230 aa]
           {ON} similar to Saccharomyces cerevisiae YCL067C
           HMLALPHA2; 1-intron
          Length = 230

 Score = 89.4 bits (220), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 57/159 (35%), Positives = 84/159 (52%), Gaps = 12/159 (7%)

Query: 51  LQGILLFLTKLVGKNDLSVTLKNEARMTYQFSKIIASLLKSFEDFFFERKEYNDP----- 105
           LQG+ +  +  V      V ++N +    Q + II  L+   ED    +K   DP     
Sbjct: 74  LQGLKILSSDQVFSKPDRVVIQNIS----QLTAIIVRLVNKKEDIINLQKGLVDPKEIPE 129

Query: 106 ATSENE--FVFSVVTQDMM-NKRKESMRPCRGHRFSSNSTETLEDWYKKHHEKPYLDKRS 162
           A S+ +   +F+VVTQDMM N RK      +GHR      + LE WYK + E PYL+   
Sbjct: 130 AISKEKCGIIFNVVTQDMMENGRKGGSSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTD 189

Query: 163 LHELEFKTKLSKMQIRNWVSNRRRKEKSIHVSPVIQDLL 201
           +  L  +T  S+ Q++NWV+N+RRK+K   +SP + DLL
Sbjct: 190 IRILMRETGFSRSQVKNWVANKRRKDKHSTISPELSDLL 228

>TBLA0A07050 Chr1
           (1728941..1729002,1729096..1729189,1729249..1729878)
           [786 bp, 261 aa] {ON}  MATalpha2 gene at MAT locus
          Length = 261

 Score = 85.5 bits (210), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 74/248 (29%), Positives = 109/248 (43%), Gaps = 54/248 (21%)

Query: 1   MNRIEIQDLLNNQDCSSLDKDFKNINSQLLEICSNFPKELLSNHGELQMQLQGILLFLTK 60
           MN+I I  LLN  +  ++ +  +N+N +LL +CS  P    S     + QL  IL FLTK
Sbjct: 1   MNKIPIDTLLNPTNSENIKEQLQNLNKELLSMCSRLP----SAKSMEETQLSEILKFLTK 56

Query: 61  LVGKNDLSVTLKNEARMTYQFSKIIASLLKSFEDFFFERKEYNDPATSENEFVFSVVTQD 120
            +    L          T Q S +++SL+K  E     R  ++   ++ N  VF+V+TQ 
Sbjct: 57  TIKHEPLGKEETELVTTTVQLSTVLSSLVK--EARQLHRLHHSQ--STHNPRVFNVLTQH 112

Query: 121 MMNKR------------------KESMRPC---------------------------RGH 135
           MM+                    K+S  P                            RGH
Sbjct: 113 MMSNSNSTSTSPHSNSLPNSPSTKKSTTPLTNPSPPYYYSSSSPKSLSPPLQHTPSHRGH 172

Query: 136 RFSSNSTETLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIRNWVSNRRRKEK-SIHVS 194
           R   ++   LE W+  +   PYL    L  L  ++ LSK Q++NW+SNRRRKE+ S+ +S
Sbjct: 173 RLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKERHSLKIS 232

Query: 195 PVIQDLLQ 202
             I  LLQ
Sbjct: 233 NNIASLLQ 240

>TDEL0C07000 Chr3 complement(1273613..1274326) [714 bp, 237 aa] {ON}
           Anc_1.122 YCR039C silenced copy of alpha2 gene at T.
           delbrueckii HML locus
          Length = 237

 Score = 82.8 bits (203), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 59/170 (34%), Positives = 86/170 (50%), Gaps = 19/170 (11%)

Query: 46  ELQMQLQGILLFLTKLVGKNDLSVTLKNEARMTYQFSKIIASLLKSFE------------ 93
           EL+ +L+ +L  L  +     L    +   R T+Q SK ++ +L  F+            
Sbjct: 61  ELRCELKKVLSSLKVVTTNGKLEENGELLLRTTFQLSKTLSVVLSEFKKVEESNIQFHKS 120

Query: 94  -DFFFERKEYNDPATSEN-EFVFSVVTQDMMNKRKESMRPCRGHRFSSNSTETLEDWYKK 151
            D+  ERKE N      N E V     QD    ++      RGHR  S   E LE W+ +
Sbjct: 121 RDWDSERKETNLRCKVPNFEIVPLNTKQDYSTGKRH-----RGHRLPSEKVEKLELWFNQ 175

Query: 152 HHEKPYLDKRSLHELEFKTKLSKMQIRNWVSNRRRKEKSIHVSPVIQDLL 201
           +  KPYL++R+L  L  +T LS +QI+NW+SNRRRK+KS  ++  I DLL
Sbjct: 176 NISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKKSAGIADTISDLL 225

>TBLA0A07600 Chr1
           (1882710..1882771,1882865..1882958,1883018..1883554)
           [693 bp, 230 aa] {ON} Anc_1.2 YCL067C silenced copy of
           alpha2 gene at HML locus
          Length = 230

 Score = 82.4 bits (202), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 68/234 (29%), Positives = 101/234 (43%), Gaps = 53/234 (22%)

Query: 1   MNRIEIQDLLNNQDCSSLDKDFKNINSQLLEICSNFPKELLSNHGELQMQLQGILLFLTK 60
           MN+I I  LLN  +  ++ +  +N+N +LL +CS  P    S     + QL  IL FLTK
Sbjct: 1   MNKIPIDTLLNPTNSENIKEQLQNLNKELLSMCSRLP----SAKSMEETQLSEILKFLTK 56

Query: 61  LVGKNDLSVTLKNEARMTYQFSKIIASLLKSFEDFFFERKEYNDPATSENEFVFSVVTQD 120
            +    L          T Q S +++SL+K  E     R  ++   ++ N  VF+V+TQ 
Sbjct: 57  TIKHEPLGKEETELVTTTVQLSTVLSSLVK--EARQLHRLHHSQ--STHNPRVFNVLTQH 112

Query: 121 MMNKR------------------KESMRPC---------------------------RGH 135
           MM+                    K+S  P                            RGH
Sbjct: 113 MMSNSNSTSTSPHSNSLPNSPSTKKSTTPLTNPSPPYYYSSSSPKSLSPPLQHTPSHRGH 172

Query: 136 RFSSNSTETLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIRNWVSNRRRKEK 189
           R   ++   LE W+  +   PYL    L  L  ++ LSK Q++NW+SNRRRKE+
Sbjct: 173 RLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKER 226

>KLLA0C00374g Chr3 (25132..25803) [672 bp, 223 aa] {ON}
           uniprot|Q9HDS5 Kluyveromyces lactis HMLALPHA2 Mating-
           type protein ALPHA2
          Length = 223

 Score = 76.3 bits (186), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 65/224 (29%), Positives = 105/224 (46%), Gaps = 25/224 (11%)

Query: 1   MNRIEIQDLLN-NQDCSSLD------KDFKNINSQLLEICSNFPK---ELLSNHGELQMQ 50
           M+RI I  LLN ++ C S+       +D    N +  ++ + F +    +L N+ +    
Sbjct: 1   MSRIPIHSLLNPSESCKSISNVPSNYRDLSTFNKERAKVITTFQEMFYSMLENNDDYNKI 60

Query: 51  LQGILLFLTKLVGKNDL-SVTLKNEARMTYQFSKIIASLL------KSFEDFFFERKE-- 101
              I  F  KL   +   S+T K +A +T    K I SLL          +  F RKE  
Sbjct: 61  ESLIRNFQPKLTWSHKCESLTFKQKAYLTAIIQKSIKSLLVLLKEKGKMREIEFSRKEVR 120

Query: 102 ----YNDPATSENEFVFSVVTQDMMNKRKESMRPCRGHRFSSNSTETLEDWYKKHHEKPY 157
               Y   + +       ++TQD+M+      +  +G RF  +  + LE+WY  +   PY
Sbjct: 121 KINKYRQSSKNFESVNIKILTQDLMHSNNNEFK--KGKRFPKSHIQLLENWYSMNRRNPY 178

Query: 158 LDKRSLHELEFKTKLSKMQIRNWVSNRRRKEKSIHVSPVIQDLL 201
           L +  L  +   T L+K QI+NW++NRRRK+K   VS  I+++L
Sbjct: 179 LAENDLAYISKNTTLTKTQIKNWLANRRRKDKITEVSSDIRNIL 222

>Kwal_YGOB_matalpha2 s33 (284511..284843) [333 bp, 110 aa] {ON}
           (matalpha2) - mating type alpha2 protein [contig MAT]
           FULL
          Length = 110

 Score = 49.3 bits (116), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 34/54 (62%)

Query: 136 RFSSNSTETLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIRNWVSNRRRKEK 189
           ++  N +  LE+W+  +   PYL ++ +  L  +T LS  QIRNW+SNRRRK K
Sbjct: 38  KYPHNISMHLENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91

>Kwal_33.12995 s33 (32369..32701) [333 bp, 110 aa] {OFF} YCR096C
           (HMRA2) - Regulatory protein MATa2p (no known function);
           sequence is the same as the last 119 residues of
           MATalpha2p [contig 123] FULL
          Length = 110

 Score = 49.3 bits (116), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 34/54 (62%)

Query: 136 RFSSNSTETLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIRNWVSNRRRKEK 189
           ++  N +  LE+W+  +   PYL ++ +  L  +T LS  QIRNW+SNRRRK K
Sbjct: 38  KYPHNISMHLENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91

>Kwal_YGOB_HMalpha2 s33 (32369..32701) [333 bp, 110 aa] {ON}
           ANNOTATED BY YGOB - This is Kwal_33.12995
          Length = 110

 Score = 49.3 bits (116), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 34/54 (62%)

Query: 136 RFSSNSTETLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIRNWVSNRRRKEK 189
           ++  N +  LE+W+  +   PYL ++ +  L  +T LS  QIRNW+SNRRRK K
Sbjct: 38  KYPHNISMHLENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91

>Kwal_33.matalpha2 s33 (284511..284843) [333 bp, 110 aa] {OFF}
           (matalpha2) - mating type alpha2 protein [contig MAT]
           FULL
          Length = 110

 Score = 49.3 bits (116), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 34/54 (62%)

Query: 136 RFSSNSTETLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIRNWVSNRRRKEK 189
           ++  N +  LE+W+  +   PYL ++ +  L  +T LS  QIRNW+SNRRRK K
Sbjct: 38  KYPHNISMHLENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91

>KLTH0F00396g Chr6 (31990..32051,32348..32612) [327 bp, 108 aa] {ON}
           conserved hypothetical protein
          Length = 108

 Score = 45.4 bits (106), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 40/66 (60%)

Query: 136 RFSSNSTETLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIRNWVSNRRRKEKSIHVSP 195
           +F++ + + LE W+  + + PY +K  +  L   T LS  QI+NW+SNRRRK +   +  
Sbjct: 41  KFNATAKKRLERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRKESIDS 100

Query: 196 VIQDLL 201
           +++ +L
Sbjct: 101 LLEPIL 106

>Kpol_1036.56 s1036 (153997..154794) [798 bp, 265 aa] {ON}
           (153997..154794) [798 nt, 266 aa]
          Length = 265

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 36/75 (48%), Gaps = 7/75 (9%)

Query: 121 MMNKRKESMRPCRG-------HRFSSNSTETLEDWYKKHHEKPYLDKRSLHELEFKTKLS 173
           + N  K+SM+ C G            NS + L  W   H + PY   +   EL  +T L+
Sbjct: 140 ISNVSKKSMKKCHGIIGAGKRSNLPKNSVQILNQWLLNHLQNPYPTPQEKKELLKQTGLT 199

Query: 174 KMQIRNWVSNRRRKE 188
           K+Q+ NW  N RR++
Sbjct: 200 KIQLSNWFINVRRRK 214

>Skud_16.103 Chr16 complement(185398..186285) [888 bp, 295 aa] {ON}
           YPL177C (REAL)
          Length = 295

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 2/70 (2%)

Query: 119 QDMMNKRKESMRPCRGHRFSSNSTETLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIR 178
           +D  +KRK++    R       + + L  W   H   PY  ++   EL  KT L+K+Q+ 
Sbjct: 142 EDSKSKRKQNS--GRRSNLPKETVQILNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLS 199

Query: 179 NWVSNRRRKE 188
           NW  N RR++
Sbjct: 200 NWFINVRRRK 209

>Skud_71.2 Chr71 (734..868) [135 bp, 45 aa] {ON} YCL067C (REAL)
          Length = 45

 Score = 35.4 bits (80), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 22/38 (57%)

Query: 1  MNRIEIQDLLNNQDCSSLDKDFKNINSQLLEICSNFPK 38
          MN+I I+DLLN Q       +  +IN +L  IC N PK
Sbjct: 1  MNKIPIKDLLNPQITDEFKSNILDINKKLFSICCNLPK 38

>Suva_7.172 Chr7 (319317..320129) [813 bp, 270 aa] {ON} YGL096W
           (REAL)
          Length = 270

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 41/98 (41%), Gaps = 19/98 (19%)

Query: 105 PATSENEFVFSVVTQDMMNKRKESMRPC----------RGHRFSSN----STETLEDWYK 150
           P    N  VFS  T      RK + RP           +GH   SN    +   L  W  
Sbjct: 160 PVGISNNKVFSSST-----SRKTAPRPNTKSSVKEKRNKGHGKRSNLPGATVHILNKWLL 214

Query: 151 KHHEKPYLDKRSLHELEFKTKLSKMQIRNWVSNRRRKE 188
           +H   PY   +   EL  +T L+K+QI NW  N RR++
Sbjct: 215 EHINNPYPTLQEKRELLAQTGLTKLQISNWFINARRRK 252

>KLTH0H05236g Chr8 complement(465998..466702) [705 bp, 234 aa] {ON}
           some similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 234

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 25/48 (52%)

Query: 141 STETLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIRNWVSNRRRKE 188
           + E L  W   H   PY   +   EL  +T LSK+Q+ NW  N RR++
Sbjct: 113 TVEILNAWLASHLNNPYPSPQEKRELLVQTGLSKVQLSNWFINVRRRK 160

>YGL096W Chr7 (325331..326161) [831 bp, 276 aa] {ON}
           TOS8Homeodomain-containing protein and putative
           transcription factor found associated with chromatin;
           target of SBF transcription factor; induced during
           meiosis and under cell-damaging conditions; similar to
           Cup9p transcription factor
          Length = 276

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%)

Query: 145 LEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIRNWVSNRRRKE 188
           L  W  +H   PY   +   EL  KT L+K+QI NW  N RR++
Sbjct: 209 LNKWLHEHVNNPYPTVQEKRELLAKTGLTKLQISNWFINARRRK 252

>Smik_7.181 Chr7 (319819..320643) [825 bp, 274 aa] {ON} YGL096W
           (REAL)
          Length = 274

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 25/48 (52%)

Query: 141 STETLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIRNWVSNRRRKE 188
           +   L  W  +H   PY   +   EL  KT L+K+QI NW  N RR++
Sbjct: 203 TVSILNKWLLEHINNPYPTVQEKRELLAKTGLTKLQISNWFINARRRK 250

>Kwal_27.11092 s27 (635052..635741) [690 bp, 229 aa] {ON} YPL177C
           (CUP9) - putative DNA binding protein which shows
           similarity in homeobox domain to human proto-oncogene
           PBX1 [contig 31] FULL
          Length = 229

 Score = 37.4 bits (85), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 26/48 (54%)

Query: 141 STETLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIRNWVSNRRRKE 188
           + + L +W   H   PY   +   EL  KT LSK+Q+ NW  N RR++
Sbjct: 129 TVDILNNWLLAHLNYPYPSPQEKRELLIKTGLSKVQLSNWFINVRRRK 176

>Suva_16.132 Chr16 complement(222346..223224) [879 bp, 292 aa] {ON}
           YPL177C (REAL)
          Length = 292

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 30/65 (46%)

Query: 124 KRKESMRPCRGHRFSSNSTETLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIRNWVSN 183
           K K+     R       + + L  W   H   PY  ++   EL  KT L+K+Q+ NW  N
Sbjct: 142 KSKKKQNSGRRSNLPKETVQVLNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFIN 201

Query: 184 RRRKE 188
            RR++
Sbjct: 202 VRRRK 206

>CAGL0H02959g Chr8 (277540..278319) [780 bp, 259 aa] {ON} some
           similarities with uniprot|P53147 Saccharomyces
           cerevisiae YGL096w TOS8
          Length = 259

 Score = 37.4 bits (85), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 26/48 (54%)

Query: 141 STETLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIRNWVSNRRRKE 188
           + + L +W   H   PY   +   EL  KT L+K+Q+ NW  N RR++
Sbjct: 172 TVKILNEWLYDHINNPYPTPQEKMELSLKTGLTKIQLSNWFINVRRRK 219

>CAGL0C01551g Chr3 complement(169232..169897) [666 bp, 221 aa] {ON}
           similar to uniprot|P41817 Saccharomyces cerevisiae
           YPL177c CUP9
          Length = 221

 Score = 37.0 bits (84), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 6/69 (8%)

Query: 120 DMMNKRKESMRPCRGHRFSSNSTETLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIRN 179
           +MM K K      R      ++ + L  W   H   PY  ++   +L  KT L+K+Q+ N
Sbjct: 71  NMMKKSK------RRSNLPKDTIQILNQWLLDHIHNPYPTQQEKRDLLIKTGLTKIQLSN 124

Query: 180 WVSNRRRKE 188
           W  N RR++
Sbjct: 125 WFINVRRRK 133

>AFL049C Chr6 complement(346546..347319) [774 bp, 257 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL177C
           (CUP9) and YGL096W (TOS8)
          Length = 257

 Score = 37.0 bits (84), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 42/93 (45%), Gaps = 10/93 (10%)

Query: 105 PATSENEFVFSVVTQD---------MMNKRKESMRPCRGHRFSSNSTETLEDWYKKHHEK 155
           PA    E  F+V  +D            K KE+ +  R       + + L +W + H++ 
Sbjct: 98  PAAPATE-PFTVYGRDDQQEPAPDGTKGKLKETKKQHRRSNLPKETVDILNEWLRNHYDN 156

Query: 156 PYLDKRSLHELEFKTKLSKMQIRNWVSNRRRKE 188
           PY   +   EL  +T L+ +Q+ NW  N RR++
Sbjct: 157 PYPSPQEKKELLKQTGLNPVQLSNWFINVRRRK 189

>Skud_7.181 Chr7 (328628..329449) [822 bp, 274 aa] {ON} YGL096W
           (REAL)
          Length = 274

 Score = 37.0 bits (84), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 4/60 (6%)

Query: 133 RGHRFSSNSTET----LEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIRNWVSNRRRKE 188
           +GH   SN  +     L  W  +H   PY   +   +L  KT L+K+QI NW  N RR++
Sbjct: 191 KGHGKRSNLPKATVCILNQWLLEHIHNPYPTVQEKRDLLAKTGLTKLQISNWFINARRRK 250

>YPL177C Chr16 complement(213042..213962) [921 bp, 306 aa] {ON}
           CUP9Homeodomain-containing transcriptional repressor of
           PTR2, which encodes a major peptide transporter;
           imported peptides activate ubiquitin-dependent
           proteolysis, resulting in degradation of Cup9p and
           de-repression of PTR2 transcription
          Length = 306

 Score = 37.0 bits (84), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 26/48 (54%)

Query: 141 STETLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIRNWVSNRRRKE 188
           + + L  W   H   PY  ++   EL  KT L+K+Q+ NW  N RR++
Sbjct: 173 TVQILNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINVRRRK 220

>Smik_6.374 Chr6 (610093..610977) [885 bp, 294 aa] {ON} YPL177C
           (REAL)
          Length = 294

 Score = 36.6 bits (83), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 29/64 (45%)

Query: 124 KRKESMRPCRGHRFSSNSTETLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIRNWVSN 183
           K K+     R       + + L  W   H   PY  ++   EL  KT L+K+Q+ NW  N
Sbjct: 144 KSKKKQNSGRRSNLPKETVQILNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFIN 203

Query: 184 RRRK 187
            RR+
Sbjct: 204 VRRR 207

>Ecym_2247 Chr2 complement(486469..487518) [1050 bp, 349 aa] {ON}
           similar to Ashbya gossypii AFL049C
          Length = 349

 Score = 36.6 bits (83), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 135 HRFSSNSTET---LEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIRNWVSNRRRKE 188
           HR S+   ET   L +W + H++ PY   +   EL  +T L+ +Q+ NW  N RR++
Sbjct: 225 HRRSNLPKETVDILNEWLRDHYDNPYPSPQEKKELLKQTGLNPVQLSNWFINVRRRK 281

>SAKL0A05610g Chr1 complement(506437..507399) [963 bp, 320 aa] {ON}
           some similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 320

 Score = 36.2 bits (82), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%)

Query: 141 STETLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIRNWVSNRRRKE 188
           + + L +W   H   PY   +   EL  KT L+ +Q+ NW  N RR++
Sbjct: 217 TVQILNNWLLAHLHNPYPSPQEKRELLLKTGLNPVQLSNWFINVRRRK 264

>TBLA0C03740 Chr3 complement(892360..893241) [882 bp, 293 aa] {ON}
           Anc_6.170 YPL177C
          Length = 293

 Score = 36.2 bits (82), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%)

Query: 141 STETLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIRNWVSNRRRKE 188
           + + L DW   H   PY   +   EL   T L+K+Q+ NW  N RR++
Sbjct: 186 TVQILNDWLLNHLRNPYPTPKEKSELLVLTGLTKIQLSNWFINVRRRK 233

>KNAG0M00500 Chr13 complement(79067..79963) [897 bp, 298 aa] {ON}
           Anc_6.170 YPL177C
          Length = 298

 Score = 35.8 bits (81), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 23/44 (52%)

Query: 145 LEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIRNWVSNRRRKE 188
           L  W   H   PY   +   EL  KT LSK+Q+ NW  N RR++
Sbjct: 191 LNRWLLDHLHNPYPTSQEKRELLIKTGLSKIQLSNWFINVRRRK 234

>NCAS0H01130 Chr8 complement(216012..216854) [843 bp, 280 aa] {ON}
           Anc_6.170 YGL096W
          Length = 280

 Score = 35.4 bits (80), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%)

Query: 142 TETLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIRNWVSNRRRKE 188
            + L  W   H + PY   +   EL  KT L+K+Q+ NW  N RR++
Sbjct: 138 VQILNTWLLNHLQNPYPTSQEKRELLIKTGLTKVQLSNWFINVRRRK 184

>NDAI0F02170 Chr6 (527340..528491) [1152 bp, 383 aa] {ON} Anc_6.170
           YGL096W
          Length = 383

 Score = 35.8 bits (81), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 24/44 (54%)

Query: 145 LEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIRNWVSNRRRKE 188
           L  W   H + PY   +   +L  KT L+K+Q+ NW  N RR++
Sbjct: 278 LNSWLLNHLQNPYPTSQEKRDLLIKTGLTKVQLSNWFINVRRRK 321

>TDEL0F01810 Chr6 complement(338066..338836) [771 bp, 256 aa] {ON}
           Anc_6.170 YPL177C
          Length = 256

 Score = 35.4 bits (80), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%)

Query: 141 STETLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIRNWVSNRRRKE 188
           + + L  W   H   PY   +   EL  KT L+K+Q+ NW  N RR++
Sbjct: 140 TVQILNTWLLDHLRNPYPTPQEKRELLIKTGLTKIQLSNWFINVRRRK 187

>KAFR0G03650 Chr7 (752766..753299) [534 bp, 177 aa] {ON} Anc_6.170
           YPL177C
          Length = 177

 Score = 34.7 bits (78), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%)

Query: 141 STETLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIRNWVSNRRRKE 188
           + + L  W   H   PY   +   +L  KT L+K+Q+ NW  N RR++
Sbjct: 80  TIQILNAWLLNHLHNPYPTSQEKRDLLIKTGLTKIQLSNWFINVRRRK 127

>TPHA0B02580 Chr2 (592073..592867) [795 bp, 264 aa] {ON} Anc_6.170
           YPL177C
          Length = 264

 Score = 35.0 bits (79), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 24/48 (50%)

Query: 141 STETLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIRNWVSNRRRKE 188
           S + L  W   H   PY   +   EL   T LSK+Q+ NW  N RR++
Sbjct: 164 SVDVLNKWLLNHLGNPYPTPKEKEELLELTGLSKIQLSNWFINVRRRK 211

>KLLA0B10450g Chr2 (912877..914046) [1170 bp, 389 aa] {ON} some
           similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 389

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 24/44 (54%)

Query: 145 LEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIRNWVSNRRRKE 188
           L DW  K+   PY   +   EL  KT L+ +Q+ NW  N RR++
Sbjct: 264 LNDWLLKNLHNPYPTPQVKRELLEKTGLNPVQLSNWFINVRRRK 307

>NDAI0I01320 Chr9 complement(318160..319389) [1230 bp, 409 aa] {ON}
           Anc_6.170 YGL096W
          Length = 409

 Score = 34.3 bits (77), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 34/70 (48%), Gaps = 1/70 (1%)

Query: 119 QDMMNKRKESMRPCRGHRFSSNSTETLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIR 178
           Q+ MN R++     R       + + L +W   H   PY   +   EL  +T L+K+Q+ 
Sbjct: 295 QNEMNMRRKKGS-GRRSSLPITTVQILNEWLLDHLTNPYPTTQEKKELLKQTGLTKIQLS 353

Query: 179 NWVSNRRRKE 188
           NW  N RR++
Sbjct: 354 NWFINVRRRK 363

>ZYRO0G22044g Chr7 (1814345..1814950) [606 bp, 201 aa] {ON} some
           similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 201

 Score = 33.1 bits (74), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 28/65 (43%)

Query: 123 NKRKESMRPCRGHRFSSNSTETLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIRNWVS 182
            K  +  R  R       + + L  W   H   PY   +   +L  KT L+K+Q+ NW  
Sbjct: 70  GKNHKGSRSGRRSNLPKETVQILNRWLLDHLGNPYPTPQEKRDLLIKTGLTKIQLSNWFI 129

Query: 183 NRRRK 187
           N RR+
Sbjct: 130 NVRRR 134

>KAFR0A04370 Chr1 complement(870590..871819) [1230 bp, 409 aa] {ON}
           Anc_6.170 YPL177C
          Length = 409

 Score = 33.1 bits (74), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 26/48 (54%)

Query: 141 STETLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIRNWVSNRRRKE 188
           + + L +W   H   PY      +EL  +T L+K+Q+ NW  N RR++
Sbjct: 279 TVQILNNWLVNHLGNPYPTAIEKNELLKQTGLTKIQLSNWFINVRRRK 326

>KNAG0F02210 Chr6 complement(423243..424217) [975 bp, 324 aa] {ON}
           Anc_6.170 YPL177C
          Length = 324

 Score = 32.7 bits (73), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%)

Query: 141 STETLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIRNWVSNRRRKE 188
           + + L +W   H   PY       EL  +T L+K+Q+ NW  N RR++
Sbjct: 250 TVQMLNNWLLNHLHDPYPTPHEKLELLRQTGLTKIQLSNWFINVRRRK 297

>NCAS0D03570 Chr4 (664388..665161) [774 bp, 257 aa] {ON} Anc_6.170
           YGL096W
          Length = 257

 Score = 32.3 bits (72), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 6/52 (11%)

Query: 140 NSTETLEDWYKKHHEKPYLD---KRSLHELEFKTKLSKMQIRNWVSNRRRKE 188
            + E L  W  +H   PY +   K+ L EL   T L+K+Q+ NW  N RR++
Sbjct: 190 GTVEVLNGWLLEHLNNPYPNVQEKKLLLEL---TGLTKVQLSNWFINVRRRK 238

>Suva_69.1 Chr69 complement(1..102) [102 bp, 34 aa] {ON} YCR039C
          (REAL)
          Length = 34

 Score = 27.7 bits (60), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 18/34 (52%)

Query: 1  MNRIEIQDLLNNQDCSSLDKDFKNINSQLLEICS 34
          MN+I I+DLLN Q          +IN +L  IC 
Sbjct: 1  MNKIPIKDLLNPQITDEFKSSILDINKKLFSICC 34

>TPHA0M01130 Chr13 complement(226403..228328) [1926 bp, 641 aa] {ON}
           Anc_3.274 YBR060C
          Length = 641

 Score = 29.3 bits (64), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 38/75 (50%), Gaps = 2/75 (2%)

Query: 26  NSQLLEICSNFPKELLSNHGELQMQLQGILLFLTKLVGKNDLSVTLKNEARMTYQFSKII 85
           N++     S+  KE+L N G+ + +++G L  L   + KN  +  L +  +      KII
Sbjct: 203 NNKKYSYISSLKKEILKNIGDDKKKMKGDLKPLQ--LTKNFKNTPLPDSNQYKPPMEKII 260

Query: 86  ASLLKSFEDFFFERK 100
            S   +FE +F +R+
Sbjct: 261 GSFFDTFEGYFDQRR 275

>CAGL0E00341g Chr5 (29668..29775,29840..30076,30143..30190) [393 bp,
           130 aa] {ON} similar to uniprot|P09091 Saccharomyces
           cerevisiae YCR097w Mating-type protein a1
          Length = 130

 Score = 28.1 bits (61), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 24/39 (61%)

Query: 154 EKPYLDKRSLHELEFKTKLSKMQIRNWVSNRRRKEKSIH 192
           +K YL +   H+L  +  ++  Q++ W +NRR++ K ++
Sbjct: 89  KKRYLTRCEKHQLAVQCGITTNQVQIWFANRRKRSKDLN 127

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.132    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,577,769
Number of extensions: 991815
Number of successful extensions: 4553
Number of sequences better than 10.0: 119
Number of HSP's gapped: 4602
Number of HSP's successfully gapped: 121
Length of query: 203
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 99
Effective length of database: 41,556,135
Effective search space: 4114057365
Effective search space used: 4114057365
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)