Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0C001501.1ON1451457511e-103
Smik_92.1singletonON1561521842e-17
ZYRO0F18590g1.1ON2001781741e-15
ZYRO0F15840g1.120ON2001781741e-15
KAFR0D007101.120ON1721641713e-15
Suva_69.2singletonON1451531589e-14
Suva_3.1481.1ON1751531582e-13
Skud_71.1singletonON1551491572e-13
Skud_3.1191.120ON1741491563e-13
YCR040W (MATALPHA1)1.120ON175521539e-13
YCL066W (HMLALPHA1)1.1ON175521539e-13
TDEL0C070101.1ON205781471e-11
NCAS0B091501.1ON1501431423e-11
TPHA0E036201.120ON1951671426e-11
TPHA0E040801.1ON1951671426e-11
KLLA0C00352g1.1ON2611591393e-10
TBLA0A070401.120ON201481365e-10
TBLA0A075901.1ON201481365e-10
CAGL0B01243g1.120ON143481336e-10
CAGL0B00242g1.1ON184481321e-09
Kwal_33.matalpha1singletonOFF2441451332e-09
Kwal_33.12992singletonOFF2441451332e-09
Kwal_YGOB_matalpha11.120ON2441451332e-09
Kwal_YGOB_HMalpha11.1ON2441451332e-09
Kpol_2002.21.1ON209491313e-09
KLTH0F00374g1.1ON2491501226e-08
Ecym_10031.1ON263531023e-05
Ecym_11141.120ON263531023e-05
NDAI0A001001.1ON13558984e-05
TDEL0E053006.221ON58450652.6
TBLA0F028207.498ON72138644.4
KLTH0B00550gna 1ON66743635.5
Skud_10.1051.253ON1770105628.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0C00150
         (145 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0C00150 Chr3 complement(24902..25339) [438 bp, 145 aa] {ON} ...   293   e-103
Smik_92.1 Chr92 complement(3..470) [468 bp, 156 aa] {ON} YCR040W...    75   2e-17
ZYRO0F18590g Chr6 (1533781..1534383) [603 bp, 200 aa] {ON} simil...    72   1e-15
ZYRO0F15840g Chr6 (1303842..1304444) [603 bp, 200 aa] {ON} simil...    72   1e-15
KAFR0D00710 Chr4 complement(127819..128337) [519 bp, 172 aa] {ON...    70   3e-15
Suva_69.2 Chr69 (369..803) [435 bp, 145 aa] {ON} YCL066W (REAL)        65   9e-14
Suva_3.148 Chr3 (222811..223338) [528 bp, 175 aa] {ON} YCL066W (...    65   2e-13
Skud_71.1 Chr71 complement(3..467) [465 bp, 155 aa] {ON} YCR040W...    65   2e-13
Skud_3.119 Chr3 (184941..185465) [525 bp, 174 aa] {ON} YCR040W (...    65   3e-13
YCR040W Chr3 (200442..200969) [528 bp, 175 aa] {ON}  MATALPHA1Tr...    64   9e-13
YCL066W Chr3 (13282..13809) [528 bp, 175 aa] {ON}  HMLALPHA1Sile...    64   9e-13
TDEL0C07010 Chr3 (1274648..1275265) [618 bp, 205 aa] {ON} Anc_1....    61   1e-11
NCAS0B09150 Chr2 (1755595..1756047) [453 bp, 150 aa] {ON} Anc_1.1      59   3e-11
TPHA0E03620 Chr5 (766068..766655) [588 bp, 195 aa] {ON} Anc_1.12...    59   6e-11
TPHA0E04080 Chr5 (850045..850632) [588 bp, 195 aa] {ON}   silenc...    59   6e-11
KLLA0C00352g Chr3 complement(24124..24909) [786 bp, 261 aa] {ON}...    58   3e-10
TBLA0A07040 Chr1 complement(1727988..1728593) [606 bp, 201 aa] {...    57   5e-10
TBLA0A07590 Chr1 complement(1881757..1882362) [606 bp, 201 aa] {...    57   5e-10
CAGL0B01243g Chr2 complement(112831..113262) [432 bp, 143 aa] {O...    56   6e-10
CAGL0B00242g Chr2 complement(10582..11136) [555 bp, 184 aa] {ON}...    55   1e-09
Kwal_33.matalpha1 s33 complement(283160..283894) [735 bp, 244 aa...    56   2e-09
Kwal_33.12992 s33 complement(31018..31752) [735 bp, 244 aa] {OFF...    56   2e-09
Kwal_YGOB_matalpha1 s33 complement(283160..283894) [735 bp, 244 ...    56   2e-09
Kwal_YGOB_HMalpha1 s33 complement(31018..31752) [735 bp, 244 aa]...    56   2e-09
Kpol_2002.2 s2002 complement(3611..4240) [630 bp, 209 aa] {ON} c...    55   3e-09
KLTH0F00374g Chr6 complement(30927..31676) [750 bp, 249 aa] {ON}...    52   6e-08
Ecym_1003 Chr1 (6314..7105) [792 bp, 263 aa] {ON} similar to Sac...    44   3e-05
Ecym_1114 Chr1 complement(236238..237029) [792 bp, 263 aa] {ON} ...    44   3e-05
NDAI0A00100 Chr1 complement(783..1190) [408 bp, 135 aa] {ON} Anc...    42   4e-05
TDEL0E05300 Chr5 complement(970347..972101) [1755 bp, 584 aa] {O...    30   2.6  
TBLA0F02820 Chr6 complement(678658..680823) [2166 bp, 721 aa] {O...    29   4.4  
KLTH0B00550g Chr2 complement(57160..59163) [2004 bp, 667 aa] {ON...    29   5.5  
Skud_10.105 Chr10 complement(179830..185142) [5313 bp, 1770 aa] ...    28   8.8  

>KNAG0C00150 Chr3 complement(24902..25339) [438 bp, 145 aa] {ON}
           Anc_1.1 YCL066W silent copy of mating type alpha1 gene
           at HML locus
          Length = 145

 Score =  293 bits (751), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 145/145 (100%), Positives = 145/145 (100%)

Query: 1   MFSKKPLFKMNITQSHSSNKSIRKRTRRPNLNSFASTNAAKNTPKIPDPNIIRAVLFRNL 60
           MFSKKPLFKMNITQSHSSNKSIRKRTRRPNLNSFASTNAAKNTPKIPDPNIIRAVLFRNL
Sbjct: 1   MFSKKPLFKMNITQSHSSNKSIRKRTRRPNLNSFASTNAAKNTPKIPDPNIIRAVLFRNL 60

Query: 61  NDDRNIISHDDSSSLSAKTIRSPREICKHGSLNSFIAFRAYYSQFANGINQNKLSSILSK 120
           NDDRNIISHDDSSSLSAKTIRSPREICKHGSLNSFIAFRAYYSQFANGINQNKLSSILSK
Sbjct: 61  NDDRNIISHDDSSSLSAKTIRSPREICKHGSLNSFIAFRAYYSQFANGINQNKLSSILSK 120

Query: 121 FWKSNQSQQTFWDRLTEQYKQIDRL 145
           FWKSNQSQQTFWDRLTEQYKQIDRL
Sbjct: 121 FWKSNQSQQTFWDRLTEQYKQIDRL 145

>Smik_92.1 Chr92 complement(3..470) [468 bp, 156 aa] {ON} YCR040W
           (REAL)
          Length = 156

 Score = 75.5 bits (184), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 51/152 (33%), Positives = 83/152 (54%), Gaps = 17/152 (11%)

Query: 1   MFSKKPLFKMN--ITQSHSS---NKSIRKR--TRRPNLNSFASTNAAKNTPKIPDPN--I 51
           MF+ KP F++N  I++SH +   +K I++R  T+    N F      K   +IP P+   
Sbjct: 1   MFTSKPAFRINNKISKSHRNPVVSKKIKERRITKHVKPNCFNVIRPLKKDIQIPIPSSRF 60

Query: 52  IRAVLFRNLNDDRNIISHDDSSSLSAKTIRSPREICKHGSLNSFIAFRAYYSQFANGINQ 111
           ++ +    +        H     L+  +I+S ++      LNSF+AFRAYYSQF +G+ Q
Sbjct: 61  LKKIQIHRIASGN---QHIQCRQLNKTSIKSTKKY-----LNSFMAFRAYYSQFGSGVKQ 112

Query: 112 NKLSSILSKFWKSNQSQQTFWDRLTEQYKQID 143
           N LSS+LS+ W ++++Q   WD   +QY  I+
Sbjct: 113 NILSSLLSEEWHADKTQHGIWDYFAQQYNFIN 144

>ZYRO0F18590g Chr6 (1533781..1534383) [603 bp, 200 aa] {ON} similar
           to uniprot|P01365 Saccharomyces cerevisiae YCR040W
           MATALPHA1 Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression
           targets the transcription factor Mcm1p to the promoters
           of alpha- specific genes one of two genes encoded by the
           alpha mating type cassette
          Length = 200

 Score = 71.6 bits (174), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 53/178 (29%), Positives = 78/178 (43%), Gaps = 52/178 (29%)

Query: 3   SKKPLFKMNITQSHSSNKSIRKRTRRPNLNSFASTN---AAKNTP--------------K 45
           S +PLFK+ + +        + R++RP L     T+   A K                 K
Sbjct: 11  SNQPLFKVKVEK--------KGRSKRPTLQDTTQTSKCIAGKCIEDQQVNVFMTVSKLIK 62

Query: 46  IPDPNIIRAVLFRNLNDDRNIISHDD------------------------SSSLSAKTIR 81
           IP P     VL R + ++++ +  DD                         SSL+  + +
Sbjct: 63  IPSPP---EVLLRKIEEEKHKLKKDDFNMDNILLWDPYVYWGEGYFFSIADSSLNNLSTK 119

Query: 82  SPREICKHGSLNSFIAFRAYYSQFANGINQNKLSSILSKFWKSNQSQQTFWDRLTEQY 139
             R+ C    LNSF+AFRAY SQF NG+ QN LSS+L+  W S+  QQ  WD   +Q+
Sbjct: 120 GSRKGCSEKPLNSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQQKIWDTFAQQF 177

>ZYRO0F15840g Chr6 (1303842..1304444) [603 bp, 200 aa] {ON} similar
           to uniprot|P01365 Saccharomyces cerevisiae YCR040W
           MATALPHA1 Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression
           targets the transcription factor Mcm1p to the promoters
           of alpha- specific genes one of two genes encoded by the
           alpha mating type cassette
          Length = 200

 Score = 71.6 bits (174), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 53/178 (29%), Positives = 78/178 (43%), Gaps = 52/178 (29%)

Query: 3   SKKPLFKMNITQSHSSNKSIRKRTRRPNLNSFASTN---AAKNTP--------------K 45
           S +PLFK+ + +        + R++RP L     T+   A K                 K
Sbjct: 11  SNQPLFKVKVEK--------KGRSKRPTLQDTTQTSKCIAGKCIEDQQVNVFMTVSKLIK 62

Query: 46  IPDPNIIRAVLFRNLNDDRNIISHDD------------------------SSSLSAKTIR 81
           IP P     VL R + ++++ +  DD                         SSL+  + +
Sbjct: 63  IPSPP---EVLLRKIEEEKHKLKKDDFNMDNILLWDPYVYWGEGYFFSIADSSLNNLSTK 119

Query: 82  SPREICKHGSLNSFIAFRAYYSQFANGINQNKLSSILSKFWKSNQSQQTFWDRLTEQY 139
             R+ C    LNSF+AFRAY SQF NG+ QN LSS+L+  W S+  QQ  WD   +Q+
Sbjct: 120 GSRKGCSEKPLNSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQQKIWDTFAQQF 177

>KAFR0D00710 Chr4 complement(127819..128337) [519 bp, 172 aa] {ON}
           mating type gene MATalpha1
          Length = 172

 Score = 70.5 bits (171), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 89/164 (54%), Gaps = 27/164 (16%)

Query: 1   MFSKKPLFKMNITQSHSSNKSIR--KRTRRP----------NLNSFASTNAAKNTPKIPD 48
           + +K+PLFK+ + ++    K+++  KR  +P          N+N F+      ++   P+
Sbjct: 5   VLNKQPLFKVKLKKTIRGTKTLQSSKRIGKPSLSKAKKRLNNVNVFSVMTEDLDSIA-PN 63

Query: 49  PNIIRAV-LFRNLNDDRNIISHDDSSSLSAK-------------TIRSPREICKHGSLNS 94
            +II+ + + +N   D N + +  + +L                 +++P EIC++ +LN 
Sbjct: 64  LDIIQMIDIAKNRTQDTNDLLYYWNYALPFGLDPLLVPFNDIPIALKNPIEICQNRNLNP 123

Query: 95  FIAFRAYYSQFANGINQNKLSSILSKFWKSNQSQQTFWDRLTEQ 138
           F+AFR+YYSQ+A G+ Q +LS +L+K W S+  +Q +W  LT++
Sbjct: 124 FMAFRSYYSQYAQGLKQIELSEVLAKAWHSDTKEQNYWISLTQK 167

>Suva_69.2 Chr69 (369..803) [435 bp, 145 aa] {ON} YCL066W (REAL)
          Length = 145

 Score = 65.5 bits (158), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 77/153 (50%), Gaps = 19/153 (12%)

Query: 1   MFSKKPLFKMNITQSHSSNKS-IRKRT------RRPNLNSFASTNAAKNTPKIPDPNII- 52
           MF+ KP F++    S S  K+ I K+       +  N + F      K   +IP P+ + 
Sbjct: 1   MFTSKPAFRIKNKTSKSHRKTDIAKKVEGKRIAKLINPSCFNIIRPLKKNIQIPAPSPLF 60

Query: 53  --RAVLFRNLNDDRNIISHDDSSSLSAKTIRSPREICKHGSLNSFIAFRAYYSQFANGIN 110
             +  L+R  + ++NI         S K   +P +      LNSF+AFRAYYSQF  G+ 
Sbjct: 61  LKKIQLYRIASGNQNIQCRQ-----SRKASITPSK----KYLNSFMAFRAYYSQFGAGVK 111

Query: 111 QNKLSSILSKFWKSNQSQQTFWDRLTEQYKQID 143
           QN LSS+LS+ W +++ Q   WD   +QY  I+
Sbjct: 112 QNILSSLLSEEWHADKMQHGIWDYFAQQYNFIN 144

>Suva_3.148 Chr3 (222811..223338) [528 bp, 175 aa] {ON} YCL066W
           (REAL)
          Length = 175

 Score = 65.5 bits (158), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 77/153 (50%), Gaps = 19/153 (12%)

Query: 1   MFSKKPLFKMNITQSHSSNKS-IRKRT------RRPNLNSFASTNAAKNTPKIPDPNII- 52
           MF+ KP F++    S S  K+ I K+       +  N + F      K   +IP P+ + 
Sbjct: 1   MFTSKPAFRIKNKTSKSHRKTDIAKKVEGKRIAKLINPSCFNIIRPLKKNIQIPAPSPLF 60

Query: 53  --RAVLFRNLNDDRNIISHDDSSSLSAKTIRSPREICKHGSLNSFIAFRAYYSQFANGIN 110
             +  L+R  + ++NI         S K   +P +      LNSF+AFRAYYSQF  G+ 
Sbjct: 61  LKKIQLYRIASGNQNIQCRQ-----SRKASITPSK----KYLNSFMAFRAYYSQFGAGVK 111

Query: 111 QNKLSSILSKFWKSNQSQQTFWDRLTEQYKQID 143
           QN LSS+LS+ W +++ Q   WD   +QY  I+
Sbjct: 112 QNILSSLLSEEWHADKMQHGIWDYFAQQYNFIN 144

>Skud_71.1 Chr71 complement(3..467) [465 bp, 155 aa] {ON} YCR040W
           (REAL)
          Length = 155

 Score = 65.1 bits (157), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 74/149 (49%), Gaps = 12/149 (8%)

Query: 1   MFSKKPLFKMNITQSHSSNKSIRKRT------RRPNLNSFASTNAAKNTPKIPDPNIIRA 54
           MF+ KP F++    S S  K++  +       +R + + F      K   +IP P    A
Sbjct: 1   MFTSKPAFRIKKKTSKSYRKTVISKVEGNGIVKRISPSCFNVIRPLKKDIQIPAP----A 56

Query: 55  VLFRNLNDDRNIISHDDSSSLSAKTIRSPREICKHGSLNSFIAFRAYYSQFANGINQNKL 114
             F        I S + ++     +  S +   KH  +NSF+AFRAYYSQF +G+ QN L
Sbjct: 57  SRFLKKIQIHRISSGNQTTQCRQLSKASIKSSKKH--INSFMAFRAYYSQFGSGVKQNIL 114

Query: 115 SSILSKFWKSNQSQQTFWDRLTEQYKQID 143
           SS+LS+ W +++ Q   WD   +QY  I+
Sbjct: 115 SSLLSEEWHADKMQHGIWDYFAQQYNFIN 143

>Skud_3.119 Chr3 (184941..185465) [525 bp, 174 aa] {ON} YCR040W
           (REAL)
          Length = 174

 Score = 64.7 bits (156), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 74/149 (49%), Gaps = 12/149 (8%)

Query: 1   MFSKKPLFKMNITQSHSSNKSIRKRT------RRPNLNSFASTNAAKNTPKIPDPNIIRA 54
           MF+ KP F++    S S  K++  +       +R + + F      K   +IP P    A
Sbjct: 1   MFTSKPAFRIKKKTSKSYRKTVISKVEGNGIVKRISPSCFNVIRPLKKDIQIPAP----A 56

Query: 55  VLFRNLNDDRNIISHDDSSSLSAKTIRSPREICKHGSLNSFIAFRAYYSQFANGINQNKL 114
             F        I S + ++     +  S +   KH  +NSF+AFRAYYSQF +G+ QN L
Sbjct: 57  SRFLKKIQIHRISSGNQTTQCRQLSKASIKSSKKH--INSFMAFRAYYSQFGSGVKQNIL 114

Query: 115 SSILSKFWKSNQSQQTFWDRLTEQYKQID 143
           SS+LS+ W +++ Q   WD   +QY  I+
Sbjct: 115 SSLLSEEWHADKMQHGIWDYFAQQYNFIN 143

>YCR040W Chr3 (200442..200969) [528 bp, 175 aa] {ON}
           MATALPHA1Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression;
           targets the transcription factor Mcm1p to the promoters
           of alpha-specific genes; one of two genes encoded by the
           MATalpha mating type cassette
          Length = 175

 Score = 63.5 bits (153), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 27/52 (51%), Positives = 38/52 (73%)

Query: 92  LNSFIAFRAYYSQFANGINQNKLSSILSKFWKSNQSQQTFWDRLTEQYKQID 143
           LNSF+AFRAYYSQF +G+ QN LSS+L++ W +++ Q   WD   +QY  I+
Sbjct: 93  LNSFMAFRAYYSQFGSGVKQNVLSSLLAEEWHADKMQHGIWDYFAQQYNFIN 144

>YCL066W Chr3 (13282..13809) [528 bp, 175 aa] {ON}
           HMLALPHA1Silenced copy of ALPHA1 at HML, encoding a
           transcriptional coactivator involved in the regulation
           of mating-type alpha-specific gene expression
          Length = 175

 Score = 63.5 bits (153), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 27/52 (51%), Positives = 38/52 (73%)

Query: 92  LNSFIAFRAYYSQFANGINQNKLSSILSKFWKSNQSQQTFWDRLTEQYKQID 143
           LNSF+AFRAYYSQF +G+ QN LSS+L++ W +++ Q   WD   +QY  I+
Sbjct: 93  LNSFMAFRAYYSQFGSGVKQNVLSSLLAEEWHADKMQHGIWDYFAQQYNFIN 144

>TDEL0C07010 Chr3 (1274648..1275265) [618 bp, 205 aa] {ON} Anc_1.121
           YCR040W silenced copy of alpha1 gene at T. delbrueckii
           HML locus
          Length = 205

 Score = 61.2 bits (147), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 44/78 (56%)

Query: 62  DDRNIISHDDSSSLSAKTIRSPREICKHGSLNSFIAFRAYYSQFANGINQNKLSSILSKF 121
           D+ +++    S  L     +  RE   +  LNSF+AFRAY SQF  G+ QN LSS+L+  
Sbjct: 107 DNEDLLFSIASDVLGNIYKKPARETASNKPLNSFMAFRAYNSQFGYGLKQNILSSLLASA 166

Query: 122 WKSNQSQQTFWDRLTEQY 139
           W S+  QQ  WD   +Q+
Sbjct: 167 WHSHPEQQGIWDTFAQQF 184

>NCAS0B09150 Chr2 (1755595..1756047) [453 bp, 150 aa] {ON} Anc_1.1
          Length = 150

 Score = 59.3 bits (142), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 66/143 (46%), Gaps = 14/143 (9%)

Query: 5   KPLFKMNITQSHSSNKSIRKRTRRPNLNSFAST-NAAKNTPK---IPDPNIIRAVLFRNL 60
           KPLFK+NI +   +  S  K+  +P   ++ +  N     PK   IP P      + + L
Sbjct: 11  KPLFKVNIPRRVRNRNS--KQPLKPKPVTYDTCFNIFLKDPKNITIPQPP---NWVLQEL 65

Query: 61  NDDRNIISHDDSSSLSAKTIRSPREICKHGSLNSFIAFRAYYSQFANGINQNKLSSILSK 120
              R I           +   +P +      +N FI FR+YYS++  GI Q  LS +L+K
Sbjct: 66  ETIRIIYPSKQKPKPRKQVTSNPSK-----PINGFILFRSYYSRWGYGIKQTMLSQLLAK 120

Query: 121 FWKSNQSQQTFWDRLTEQYKQID 143
           FWKS+ + Q  WD    QY  + 
Sbjct: 121 FWKSSDTDQALWDYFALQYSTVG 143

>TPHA0E03620 Chr5 (766068..766655) [588 bp, 195 aa] {ON} Anc_1.121
           YCR040W MATalpha1 gene at MAT locus
          Length = 195

 Score = 59.3 bits (142), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 50/167 (29%), Positives = 83/167 (49%), Gaps = 31/167 (18%)

Query: 2   FSKKPLFKMNITQSHSSNKSIRKRTRRPNL-------NSFASTNAAKNTPKIPDP----- 49
           +SK+PLFK+++ +     +SI+ +T + N+       + F + N     P  P       
Sbjct: 7   WSKQPLFKVSLNKKRI--RSIKIKTHKNNVQLKKQRSHQFIAENFKLKIPYPPTCLLRSI 64

Query: 50  -------NIIRAVLFRNLN---------DDRNIISHDD-SSSLSAKTIRSPREICKHGSL 92
                   I ++++ +++N         D+ N++S DD +  ++     S  E+    SL
Sbjct: 65  DAELRRIEIKKSIVAQDVNSLFNVELTWDEDNVLSDDDINDDIAYINYSSEEELLFKKSL 124

Query: 93  NSFIAFRAYYSQFANGINQNKLSSILSKFWKSNQSQQTFWDRLTEQY 139
           NSFIAFRAY +QF NG+NQ+ LS +LS  W S   Q   WD   +Q+
Sbjct: 125 NSFIAFRAYNAQFGNGLNQHLLSHLLSLAWHSAPEQHHVWDVFAQQF 171

>TPHA0E04080 Chr5 (850045..850632) [588 bp, 195 aa] {ON}   silenced
           copy of alpha1 at HMLalpha locus
          Length = 195

 Score = 59.3 bits (142), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 50/167 (29%), Positives = 83/167 (49%), Gaps = 31/167 (18%)

Query: 2   FSKKPLFKMNITQSHSSNKSIRKRTRRPNL-------NSFASTNAAKNTPKIPDP----- 49
           +SK+PLFK+++ +     +SI+ +T + N+       + F + N     P  P       
Sbjct: 7   WSKQPLFKVSLNKKRI--RSIKIKTHKNNVQLKKQRSHQFIAENFKLKIPYPPTCLLRSI 64

Query: 50  -------NIIRAVLFRNLN---------DDRNIISHDD-SSSLSAKTIRSPREICKHGSL 92
                   I ++++ +++N         D+ N++S DD +  ++     S  E+    SL
Sbjct: 65  DAELRRIEIKKSIVAQDVNSLFNVELTWDEDNVLSDDDINDDIAYINYSSEEELLFKKSL 124

Query: 93  NSFIAFRAYYSQFANGINQNKLSSILSKFWKSNQSQQTFWDRLTEQY 139
           NSFIAFRAY +QF NG+NQ+ LS +LS  W S   Q   WD   +Q+
Sbjct: 125 NSFIAFRAYNAQFGNGLNQHLLSHLLSLAWHSAPEQHHVWDVFAQQF 171

>KLLA0C00352g Chr3 complement(24124..24909) [786 bp, 261 aa] {ON}
           uniprot|Q08398 Kluyveromyces lactis HMLAPLHA1 Mating-
           type protein ALPHA1
          Length = 261

 Score = 58.2 bits (139), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 85/159 (53%), Gaps = 25/159 (15%)

Query: 1   MFSKKPLFKMNITQSHSSNKSIRKRT--------RRPNLNS------FASTNAAKNTPK- 45
           M S  P FK+ +++   S  S+RK +        R+P+++S        +   +K TP  
Sbjct: 1   MKSNAPTFKVAVSKRSCS--SVRKTSKKIRSGMIRKPSVSSRYRKHEGVNLYMSKVTPTS 58

Query: 46  IPDP-NIIRAVL---FRNLNDDRNIISHDDSSSLSAKTIRSPREICKHGSLNSFIAFRAY 101
           IP P  ++ A +    + LN    ++S  +S+ LS++ +++     K   +N FIAFR+Y
Sbjct: 59  IPAPPQVLVAYIKEKVKTLNKSEVLMSLGNSNQLSSRDVKTK---TKKKQINDFIAFRSY 115

Query: 102 YSQFANGI-NQNKLSSILSKFWKSNQSQQTFWDRLTEQY 139
           YS+  NGI  Q +LS+I+SK W  ++  +  W+ + ++Y
Sbjct: 116 YSRLLNGILTQTELSTIISKHWTVDKQTRKNWELIAQEY 154

>TBLA0A07040 Chr1 complement(1727988..1728593) [606 bp, 201 aa] {ON}
            MATalpha1 gene at MAT locus
          Length = 201

 Score = 57.0 bits (136), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 33/48 (68%)

Query: 92  LNSFIAFRAYYSQFANGINQNKLSSILSKFWKSNQSQQTFWDRLTEQY 139
           LN FIAFRAY SQF  G+ QN LSS+LS  W  N +QQ  W+  +++Y
Sbjct: 129 LNGFIAFRAYNSQFGYGLKQNILSSLLSTAWHENPNQQNVWNFFSQEY 176

>TBLA0A07590 Chr1 complement(1881757..1882362) [606 bp, 201 aa] {ON}
           Anc_1.1 YCL066W silenced copy of alpha1 gene at HML
           locus
          Length = 201

 Score = 57.0 bits (136), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 33/48 (68%)

Query: 92  LNSFIAFRAYYSQFANGINQNKLSSILSKFWKSNQSQQTFWDRLTEQY 139
           LN FIAFRAY SQF  G+ QN LSS+LS  W  N +QQ  W+  +++Y
Sbjct: 129 LNGFIAFRAYNSQFGYGLKQNILSSLLSTAWHENPNQQNVWNFFSQEY 176

>CAGL0B01243g Chr2 complement(112831..113262) [432 bp, 143 aa] {ON}
           some similarities with uniprot|P01365 Saccharomyces
           cerevisiae YCR040w MATALPHA1 expressed copy at MAT locus
           or uniprot|P01365 Saccharomyces cerevisiae YCL066w
           HMLALPHA1 silenced copy at HML
          Length = 143

 Score = 55.8 bits (133), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 32/48 (66%)

Query: 92  LNSFIAFRAYYSQFANGINQNKLSSILSKFWKSNQSQQTFWDRLTEQY 139
           +N+F+AFR YY+Q   G+ QN LS ILS+ W + ++ Q  WD   +Q+
Sbjct: 75  MNAFMAFRTYYAQLGTGLKQNTLSVILSEAWNAPETDQNIWDIFAQQF 122

>CAGL0B00242g Chr2 complement(10582..11136) [555 bp, 184 aa] {ON}
           some similarities with uniprot|P01365 Saccharomyces
           cerevisiae YCR040w MATALPHA1 mating type regulatory
           protein or uniprot|P01365 Saccharomyces cerevisiae
           YCL066w HMLALPHA1
          Length = 184

 Score = 55.5 bits (132), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 32/48 (66%)

Query: 92  LNSFIAFRAYYSQFANGINQNKLSSILSKFWKSNQSQQTFWDRLTEQY 139
           +N+F+AFR YY+Q   G+ QN LS ILS+ W + ++ Q  WD   +Q+
Sbjct: 116 MNAFMAFRTYYAQLGTGLKQNTLSVILSEAWNAPETDQNIWDIFAQQF 163

>Kwal_33.matalpha1 s33 complement(283160..283894) [735 bp, 244 aa]
           {OFF} (matalpha1) - mating type alpha1 protein [contig
           MAT] FULL
          Length = 244

 Score = 55.8 bits (133), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 68/145 (46%), Gaps = 13/145 (8%)

Query: 5   KPLFKMNITQSHS-------SNKSIRKRTRRPNLNSFASTNAAKNTPKIPDP--NIIRAV 55
           KP FK+++ + H        S KS+++      +N + S +  +  PK P     I+ + 
Sbjct: 5   KPSFKVSVNKRHGAKLKPKISKKSLKRNYVSEGVNLYMSYSKQELIPKPPKAVMKILGSD 64

Query: 56  LFRNLNDDRNIISHDDSSSLSAKTIRSPREICKHGSLNSFIAFRAYYSQFANG-INQNKL 114
             + L+   +   H D  S   +T     +      +N FI FR+YY++   G I Q +L
Sbjct: 65  HGKGLSKGLSKGIHKDQKS---QTFLGSGKCTSKKKINPFIGFRSYYARIVKGRIRQQEL 121

Query: 115 SSILSKFWKSNQSQQTFWDRLTEQY 139
           S+ILS++W S+      W+  TE Y
Sbjct: 122 STILSQYWLSHHQVHKTWEFFTEHY 146

>Kwal_33.12992 s33 complement(31018..31752) [735 bp, 244 aa] {OFF}
           YCR040W (MATALPHA1) - transcription factor involved in
           the regulation of alpha-specific genes [contig 123] FULL
          Length = 244

 Score = 55.8 bits (133), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 68/145 (46%), Gaps = 13/145 (8%)

Query: 5   KPLFKMNITQSHS-------SNKSIRKRTRRPNLNSFASTNAAKNTPKIPDP--NIIRAV 55
           KP FK+++ + H        S KS+++      +N + S +  +  PK P     I+ + 
Sbjct: 5   KPSFKVSVNKRHGAKLKPKISKKSLKRNYVSEGVNLYMSYSKQELIPKPPKAVMKILGSD 64

Query: 56  LFRNLNDDRNIISHDDSSSLSAKTIRSPREICKHGSLNSFIAFRAYYSQFANG-INQNKL 114
             + L+   +   H D  S   +T     +      +N FI FR+YY++   G I Q +L
Sbjct: 65  HGKGLSKGLSKGIHKDQKS---QTFLGSGKCTSKKKINPFIGFRSYYARIVKGRIRQQEL 121

Query: 115 SSILSKFWKSNQSQQTFWDRLTEQY 139
           S+ILS++W S+      W+  TE Y
Sbjct: 122 STILSQYWLSHHQVHKTWEFFTEHY 146

>Kwal_YGOB_matalpha1 s33 complement(283160..283894) [735 bp, 244 aa]
           {ON} (matalpha1) - mating type alpha1 protein [contig
           MAT] FULL
          Length = 244

 Score = 55.8 bits (133), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 68/145 (46%), Gaps = 13/145 (8%)

Query: 5   KPLFKMNITQSHS-------SNKSIRKRTRRPNLNSFASTNAAKNTPKIPDP--NIIRAV 55
           KP FK+++ + H        S KS+++      +N + S +  +  PK P     I+ + 
Sbjct: 5   KPSFKVSVNKRHGAKLKPKISKKSLKRNYVSEGVNLYMSYSKQELIPKPPKAVMKILGSD 64

Query: 56  LFRNLNDDRNIISHDDSSSLSAKTIRSPREICKHGSLNSFIAFRAYYSQFANG-INQNKL 114
             + L+   +   H D  S   +T     +      +N FI FR+YY++   G I Q +L
Sbjct: 65  HGKGLSKGLSKGIHKDQKS---QTFLGSGKCTSKKKINPFIGFRSYYARIVKGRIRQQEL 121

Query: 115 SSILSKFWKSNQSQQTFWDRLTEQY 139
           S+ILS++W S+      W+  TE Y
Sbjct: 122 STILSQYWLSHHQVHKTWEFFTEHY 146

>Kwal_YGOB_HMalpha1 s33 complement(31018..31752) [735 bp, 244 aa]
           {ON} ANNOTATED BY YGOB - This is Kwal_33.12992
          Length = 244

 Score = 55.8 bits (133), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 68/145 (46%), Gaps = 13/145 (8%)

Query: 5   KPLFKMNITQSHS-------SNKSIRKRTRRPNLNSFASTNAAKNTPKIPDP--NIIRAV 55
           KP FK+++ + H        S KS+++      +N + S +  +  PK P     I+ + 
Sbjct: 5   KPSFKVSVNKRHGAKLKPKISKKSLKRNYVSEGVNLYMSYSKQELIPKPPKAVMKILGSD 64

Query: 56  LFRNLNDDRNIISHDDSSSLSAKTIRSPREICKHGSLNSFIAFRAYYSQFANG-INQNKL 114
             + L+   +   H D  S   +T     +      +N FI FR+YY++   G I Q +L
Sbjct: 65  HGKGLSKGLSKGIHKDQKS---QTFLGSGKCTSKKKINPFIGFRSYYARIVKGRIRQQEL 121

Query: 115 SSILSKFWKSNQSQQTFWDRLTEQY 139
           S+ILS++W S+      W+  TE Y
Sbjct: 122 STILSQYWLSHHQVHKTWEFFTEHY 146

>Kpol_2002.2 s2002 complement(3611..4240) [630 bp, 209 aa] {ON}
           complement(3611..4240) [630 nt, 210 aa]
          Length = 209

 Score = 55.1 bits (131), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 34/49 (69%)

Query: 91  SLNSFIAFRAYYSQFANGINQNKLSSILSKFWKSNQSQQTFWDRLTEQY 139
           SLN F+AFRAY SQF  G+ Q  LSS+LS+ W S+  QQ  W  L++Q+
Sbjct: 136 SLNGFMAFRAYNSQFGYGLKQEILSSLLSEAWHSDPEQQKKWTVLSQQF 184

>KLTH0F00374g Chr6 complement(30927..31676) [750 bp, 249 aa] {ON}
           weakly similar to uniprot|P01365 Saccharomyces
           cerevisiae YCR040W MATALPHA1 Transcriptional
           co-activator involved in regulation of
           mating-type-specific gene expression targets the
           transcription factor Mcm1p to the promoters of
           alpha-specific genes one of two genes encoded by the
           alpha mating type cassette
          Length = 249

 Score = 51.6 bits (122), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 46/150 (30%), Positives = 73/150 (48%), Gaps = 15/150 (10%)

Query: 1   MFSKKPLFKMNITQSHSS-NKSIR---KRTRRPNLNSFASTNAAKNTPKIPDP--NIIRA 54
           M S KP FK+ I +   + N+ ++   K  R    N + S +  +  PK P+   N++R+
Sbjct: 1   MNSTKPSFKVLIKKKGKTLNRRLKNSSKSYRENGANLYMSYSKPQAIPKPPNTLINLVRS 60

Query: 55  VLF----RNLNDDRNIISHDDSSSLSAKTIRSPREICKHGSLNSFIAFRAYYSQFANG-I 109
                  R    +  I+   D   LS   I S   + K   +N FI FR+YY++FA G +
Sbjct: 61  KKTSQSSRKCLKNDYILKELDVKKLS---IYSNNTVLKK-KINPFIGFRSYYAKFAKGRV 116

Query: 110 NQNKLSSILSKFWKSNQSQQTFWDRLTEQY 139
            Q +LS ILS++W  N    + W+  T+ Y
Sbjct: 117 RQQELSKILSEYWTKNSKIHSVWEFFTQHY 146

>Ecym_1003 Chr1 (6314..7105) [792 bp, 263 aa] {ON} similar to
           Saccharomyces cerevisiae YCL066W HMLALPHA1
          Length = 263

 Score = 43.9 bits (102), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 88  KHGSLNSFIAFRAYYSQFANGI-NQNKLSSILSKFWKSNQSQQTFWDRLTEQY 139
           K   +N F+AFR+YYS+F  GI  Q +LS IL++ W      +  W+   E Y
Sbjct: 109 KRKKINEFMAFRSYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAEHY 161

>Ecym_1114 Chr1 complement(236238..237029) [792 bp, 263 aa] {ON}
           similar to YCL066W HMLALPHA1
          Length = 263

 Score = 43.9 bits (102), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 88  KHGSLNSFIAFRAYYSQFANGI-NQNKLSSILSKFWKSNQSQQTFWDRLTEQY 139
           K   +N F+AFR+YYS+F  GI  Q +LS IL++ W      +  W+   E Y
Sbjct: 109 KRKKINEFMAFRSYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAEHY 161

>NDAI0A00100 Chr1 complement(783..1190) [408 bp, 135 aa] {ON}
           Anc_1.1  silent copy of MATalpha1 gene at HMLalpha
           possible pseudogene; contains 2 copies of a 20 bp direct
           repeat, causing a frameshft; synthetic translation made
           by ignoring one copy.
          Length = 135

 Score = 42.4 bits (98), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 36/58 (62%)

Query: 87  CKHGSLNSFIAFRAYYSQFANGINQNKLSSILSKFWKSNQSQQTFWDRLTEQYKQIDR 144
           C   S+N F+ FR+YYSQ+  G+ Q+ LS +LSK W ++++ Q  WD+  +Q   I  
Sbjct: 58  CYAKSINGFMLFRSYYSQYGKGLKQSLLSPLLSKLWNAHETDQLLWDQFAQQCNAIGH 115

>TDEL0E05300 Chr5 complement(970347..972101) [1755 bp, 584 aa] {ON}
           Anc_6.221 YPL208W
          Length = 584

 Score = 29.6 bits (65), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 26/50 (52%)

Query: 96  IAFRAYYSQFANGINQNKLSSILSKFWKSNQSQQTFWDRLTEQYKQIDRL 145
           +AFR   +   N  N++ L+ +LS F   N+S    WD LT  +K +  L
Sbjct: 342 LAFRDGVTYLLNKTNESPLNDMLSLFSYLNKSDNERWDELTPLFKGLHSL 391

>TBLA0F02820 Chr6 complement(678658..680823) [2166 bp, 721 aa] {ON}
           Anc_7.498 YJR106W
          Length = 721

 Score = 29.3 bits (64), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 21/38 (55%)

Query: 23  RKRTRRPNLNSFASTNAAKNTPKIPDPNIIRAVLFRNL 60
           +++   PN NS+  T+   N P    PNII A+ F NL
Sbjct: 207 QEQGNIPNANSYEVTDDEGNFPSYVKPNIITAMDFNNL 244

>KLTH0B00550g Chr2 complement(57160..59163) [2004 bp, 667 aa] {ON}
           similar to uniprot|P33413 Saccharomyces cerevisiae
           YHL016C DUR3 Plasma membrane urea transporter expression
           is highly sensitive to nitrogen catabolite repression
           and induced by allophanate the last intermediate of the
           allantoin degradative pathway
          Length = 667

 Score = 28.9 bits (63), Expect = 5.5,   Method: Composition-based stats.
 Identities = 14/43 (32%), Positives = 26/43 (60%)

Query: 91  SLNSFIAFRAYYSQFANGINQNKLSSILSKFWKSNQSQQTFWD 133
           SL+  +AF  + S F++GI    LS + S+ W  N+  +T+++
Sbjct: 490 SLSEPLAFGNFISVFSSGIFVWILSQVKSQSWNFNEMNETYFE 532

>Skud_10.105 Chr10 complement(179830..185142) [5313 bp, 1770 aa]
           {ON} YJL109C (REAL)
          Length = 1770

 Score = 28.5 bits (62), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 44/105 (41%), Gaps = 34/105 (32%)

Query: 56  LFRNLNDDRNIISHDDSSSLSAKTIRSPREICKHGSLNSFIAFRAYYSQFANGINQNKL- 114
           LF N++ + +I+          K +  P E  ++G++ SF AF   +S F N  N + L 
Sbjct: 437 LFTNVDTNADIV----------KQLCDPMEATRNGTVPSFQAFLDIHSNFINTTNMSILA 486

Query: 115 -----------------------SSILSKFWKSNQSQQTFWDRLT 136
                                  SS L+ F+ + +S+ TF  R+T
Sbjct: 487 ESGERFKKVLSLFTEAIGKGYQASSFLTSFFTTLESRITFLLRVT 531

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.128    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 15,648,921
Number of extensions: 647447
Number of successful extensions: 3171
Number of sequences better than 10.0: 93
Number of HSP's gapped: 3152
Number of HSP's successfully gapped: 93
Length of query: 145
Length of database: 53,481,399
Length adjustment: 99
Effective length of query: 46
Effective length of database: 42,129,465
Effective search space: 1937955390
Effective search space used: 1937955390
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 60 (27.7 bits)