Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0B045805.351ON72972938470.0
Kpol_339.125.351ON73372831440.0
Suva_15.2625.351ON73172331110.0
Skud_8.1315.351ON73172531100.0
YHR072W (ERG7)5.351ON73172330810.0
Smik_8.1485.351ON73172530720.0
TPHA0E011205.351ON73372730670.0
KAFR0D046705.351ON73172530390.0
NDAI0C019705.351ON73172330070.0
NCAS0H016405.351ON72872130020.0
TDEL0E027605.351ON73172629950.0
CAGL0J10824g5.351ON73371829670.0
TBLA0A031205.351ON74373129550.0
SAKL0G08844g5.351ON74672428900.0
ZYRO0D10164g5.351ON73272528500.0
KLLA0B10175g5.351ON73172428080.0
Kwal_34.159795.351ON72872628050.0
KLTH0H14850g5.351ON72672327700.0
AGR351W5.351ON72972526240.0
Ecym_81825.351ON73272726070.0
Kpol_416.85.719ON23656751.6
NDAI0D03540na 1ON110754709.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0B04580
         (729 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0B04580 Chr2 complement(884911..887100) [2190 bp, 729 aa] {O...  1486   0.0  
Kpol_339.12 s339 (18976..21177) [2202 bp, 733 aa] {ON} (18976..2...  1215   0.0  
Suva_15.262 Chr15 (440969..443164) [2196 bp, 731 aa] {ON} YHR072...  1202   0.0  
Skud_8.131 Chr8 (212610..214805) [2196 bp, 731 aa] {ON} YHR072W ...  1202   0.0  
YHR072W Chr8 (239098..241293) [2196 bp, 731 aa] {ON}  ERG7Lanost...  1191   0.0  
Smik_8.148 Chr8 (215426..217621) [2196 bp, 731 aa] {ON} YHR072W ...  1187   0.0  
TPHA0E01120 Chr5 complement(230336..232537) [2202 bp, 733 aa] {O...  1186   0.0  
KAFR0D04670 Chr4 (915691..917886) [2196 bp, 731 aa] {ON} Anc_5.3...  1175   0.0  
NDAI0C01970 Chr3 complement(442137..444332) [2196 bp, 731 aa] {O...  1162   0.0  
NCAS0H01640 Chr8 complement(313901..316087) [2187 bp, 728 aa] {O...  1160   0.0  
TDEL0E02760 Chr5 complement(531650..533845) [2196 bp, 731 aa] {O...  1158   0.0  
CAGL0J10824g Chr10 complement(1056204..1058405) [2202 bp, 733 aa...  1147   0.0  
TBLA0A03120 Chr1 (742618..744849) [2232 bp, 743 aa] {ON} Anc_5.3...  1142   0.0  
SAKL0G08844g Chr7 complement(757226..759466) [2241 bp, 746 aa] {...  1117   0.0  
ZYRO0D10164g Chr4 (854166..856364) [2199 bp, 732 aa] {ON} highly...  1102   0.0  
KLLA0B10175g Chr2 (889538..891733) [2196 bp, 731 aa] {ON} highly...  1086   0.0  
Kwal_34.15979 s34 complement(142874..145060) [2187 bp, 728 aa] {...  1085   0.0  
KLTH0H14850g Chr8 (1287375..1289555) [2181 bp, 726 aa] {ON} high...  1071   0.0  
AGR351W Chr7 (1381502..1383691) [2190 bp, 729 aa] {ON} Syntenic ...  1015   0.0  
Ecym_8182 Chr8 complement(379402..381600) [2199 bp, 732 aa] {ON}...  1008   0.0  
Kpol_416.8 s416 (31485..32195) [711 bp, 236 aa] {ON} (31485..321...    33   1.6  
NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {...    32   9.0  

>KNAG0B04580 Chr2 complement(884911..887100) [2190 bp, 729 aa] {ON}
           Anc_5.351 YHR072W
          Length = 729

 Score = 1486 bits (3847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 715/729 (98%), Positives = 715/729 (98%)

Query: 1   MADIVLYSEQLGLPRTDPKRWRLRTDELGRETWDYIPEDQCEMDPQSSFTQWLLQIRDTE 60
           MADIVLYSEQLGLPRTDPKRWRLRTDELGRETWDYIPEDQCEMDPQSSFTQWLLQIRDTE
Sbjct: 1   MADIVLYSEQLGLPRTDPKRWRLRTDELGRETWDYIPEDQCEMDPQSSFTQWLLQIRDTE 60

Query: 61  TSAPKEPVTAFDSCINGANFFKSLQDPHSGMFPCQYKGPMFMTIGYIAVNYIAGIEIPKH 120
           TSAPKEPVTAFDSCINGANFFKSLQDPHSGMFPCQYKGPMFMTIGYIAVNYIAGIEIPKH
Sbjct: 61  TSAPKEPVTAFDSCINGANFFKSLQDPHSGMFPCQYKGPMFMTIGYIAVNYIAGIEIPKH 120

Query: 121 ERLEIIRYIVNTSHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLQRDHPVCLKARDTLL 180
           ERLEIIRYIVNTSHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLQRDHPVCLKARDTLL
Sbjct: 121 ERLEIIRYIVNTSHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLQRDHPVCLKARDTLL 180

Query: 181 RLGGAIGAPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYELPIHPGKWWVHTRGVYLPIS 240
           RLGGAIGAPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYELPIHPGKWWVHTRGVYLPIS
Sbjct: 181 RLGGAIGAPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYELPIHPGKWWVHTRGVYLPIS 240

Query: 241 YLSLVHYSCELTPLLEEIRGEIYTKPFDSIDFSKHRNTVCGVDLYYPHSKVLDMANNAII 300
           YLSLVHYSCELTPLLEEIRGEIYTKPFDSIDFSKHRNTVCGVDLYYPHSKVLDMANNAII
Sbjct: 241 YLSLVHYSCELTPLLEEIRGEIYTKPFDSIDFSKHRNTVCGVDLYYPHSKVLDMANNAII 300

Query: 301 FYEKYLRPAWIYKKSKAKVYSLIQKEIQNTDYLCIAPVNQAFCALVTLIEEGVDSEAFTK 360
           FYEKYLRPAWIYKKSKAKVYSLIQKEIQNTDYLCIAPVNQAFCALVTLIEEGVDSEAFTK
Sbjct: 301 FYEKYLRPAWIYKKSKAKVYSLIQKEIQNTDYLCIAPVNQAFCALVTLIEEGVDSEAFTK 360

Query: 361 FRTRFKDALFHGPQGMTVMGTNGVQTWDCAFAVQYFFVAGLAERPEFYNFIVAAYRFLIR 420
           FRTRFKDALFHGPQGMTVMGTNGVQTWDCAFAVQYFFVAGLAERPEFYNFIVAAYRFLIR
Sbjct: 361 FRTRFKDALFHGPQGMTVMGTNGVQTWDCAFAVQYFFVAGLAERPEFYNFIVAAYRFLIR 420

Query: 421 SQFDTECVPGSFRDKRKGSWGFSTKTQGYTVSDCTAEAIKAIIMVKNAPQFSDVHDEIED 480
           SQFDTECVPGSFRDKRKGSWGFSTKTQGYTVSDCTAEAIKAIIMVKNAPQFSDVHDEIED
Sbjct: 421 SQFDTECVPGSFRDKRKGSWGFSTKTQGYTVSDCTAEAIKAIIMVKNAPQFSDVHDEIED 480

Query: 481 SRLYEGIDVLLSLQNTGSFEYGSFATYEKIKAPLIMEKLNPAEVFGNIMIEYPYVECTDS 540
           SRLYEGIDVLLSLQNTGSFEYGSFATYEKIKAPLIMEKLNPAEVFGNIMIEYPYVECTDS
Sbjct: 481 SRLYEGIDVLLSLQNTGSFEYGSFATYEKIKAPLIMEKLNPAEVFGNIMIEYPYVECTDS 540

Query: 541 SVLGLTFFHKYYKYXXXXXXXXXXXXXXYLKRAQEPDGSWYGCWGICYTYAGMFALEALH 600
           SVLGLTFFHKYYKY              YLKRAQEPDGSWYGCWGICYTYAGMFALEALH
Sbjct: 541 SVLGLTFFHKYYKYRTEEISERIRIAIEYLKRAQEPDGSWYGCWGICYTYAGMFALEALH 600

Query: 601 SVEENYANSAIVRKGCDFLVSKQLIDGGWGESMKSSELHSYVSTPESLVVQTAWAVIALL 660
           SVEENYANSAIVRKGCDFLVSKQLIDGGWGESMKSSELHSYVSTPESLVVQTAWAVIALL
Sbjct: 601 SVEENYANSAIVRKGCDFLVSKQLIDGGWGESMKSSELHSYVSTPESLVVQTAWAVIALL 660

Query: 661 LAEYPDKKVIERGIELLRSRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGLYN 720
           LAEYPDKKVIERGIELLRSRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGLYN
Sbjct: 661 LAEYPDKKVIERGIELLRSRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGLYN 720

Query: 721 KTYAIAPAV 729
           KTYAIAPAV
Sbjct: 721 KTYAIAPAV 729

>Kpol_339.12 s339 (18976..21177) [2202 bp, 733 aa] {ON}
           (18976..21177) [2202 nt, 734 aa]
          Length = 733

 Score = 1215 bits (3144), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 569/728 (78%), Positives = 636/728 (87%), Gaps = 7/728 (0%)

Query: 4   IVLYSEQLGLPRTDPKRWRLRTDELGRETWDYIPEDQCEMDPQSSFTQWLLQIRDTETSA 63
           +  YSE++GL +TDPK WRLRTD+LGRE+W+Y+  +  + DPQSS+TQWLLQ+ +  T +
Sbjct: 2   VEFYSEEIGLEKTDPKLWRLRTDKLGRESWEYLTPEDADKDPQSSYTQWLLQVPEFPTPS 61

Query: 64  P-------KEPVTAFDSCINGANFFKSLQDPHSGMFPCQYKGPMFMTIGYIAVNYIAGIE 116
           P        E  TA+D+C NGA+FFK LQD +SG+FPCQYKGPMFMTIGYIAVNYIAG++
Sbjct: 62  PLKNSSNKNENYTAYDACHNGASFFKLLQDENSGIFPCQYKGPMFMTIGYIAVNYIAGVK 121

Query: 117 IPKHERLEIIRYIVNTSHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLQRDHPVCLKAR 176
           IP HER+E+IRYIVNT+HPVDGGWGLHSVDKSTVFGTVLNYV LRLLGL +DHPVC+KAR
Sbjct: 122 IPDHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVNLRLLGLSKDHPVCVKAR 181

Query: 177 DTLLRLGGAIGAPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYELPIHPGKWWVHTRGVY 236
           DTL++LGGAIGAPHWGK WLS LNLYKWEGVNPAPPETWLLPY L IHPG+WWVHTRGVY
Sbjct: 182 DTLIKLGGAIGAPHWGKTWLSTLNLYKWEGVNPAPPETWLLPYSLSIHPGRWWVHTRGVY 241

Query: 237 LPISYLSLVHYSCELTPLLEEIRGEIYTKPFDSIDFSKHRNTVCGVDLYYPHSKVLDMAN 296
           LPISYLSLV YSCELTPLL E+R EIYTKPFDSIDFS+HRNTVCGVDLYYPHSKVLD+AN
Sbjct: 242 LPISYLSLVRYSCELTPLLAELREEIYTKPFDSIDFSRHRNTVCGVDLYYPHSKVLDVAN 301

Query: 297 NAIIFYEKYLRPAWIYKKSKAKVYSLIQKEIQNTDYLCIAPVNQAFCALVTLIEEGVDSE 356
           + I+FYEKYLRP W++ KSK  VY LI+KEI+NTDYLCIAPVNQAFCALVTLIEEG DS+
Sbjct: 302 DCIVFYEKYLRPQWVHDKSKETVYDLIKKEIENTDYLCIAPVNQAFCALVTLIEEGRDSQ 361

Query: 357 AFTKFRTRFKDALFHGPQGMTVMGTNGVQTWDCAFAVQYFFVAGLAERPEFYNFIVAAYR 416
           AF +F  RFKDALFHGPQGMTVMGTNGVQ WDCAFA+QYFFVAGLAE+PEFY+ IV AY 
Sbjct: 362 AFKRFEFRFKDALFHGPQGMTVMGTNGVQVWDCAFAIQYFFVAGLAEKPEFYDTIVRAYE 421

Query: 417 FLIRSQFDTECVPGSFRDKRKGSWGFSTKTQGYTVSDCTAEAIKAIIMVKNAPQFSDVHD 476
           FL RSQFDTECVPGSFRDKR G+WGFSTKTQGYTVSDCTAEAIKAIIMV+N+  F  VHD
Sbjct: 422 FLCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAEAIKAIIMVRNSDVFRAVHD 481

Query: 477 EIEDSRLYEGIDVLLSLQNTGSFEYGSFATYEKIKAPLIMEKLNPAEVFGNIMIEYPYVE 536
           +I D RL +GIDVL+SLQN GSFEYGSFATYEKIKAPL ME LNPAEVFGNIM+EYPYVE
Sbjct: 482 KISDERLNKGIDVLMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYVE 541

Query: 537 CTDSSVLGLTFFHKYYKYXXXXXXXXXXXXXXYLKRAQEPDGSWYGCWGICYTYAGMFAL 596
           CTDSSVLGLTFFHK+  Y              Y+K  Q+ DGSWYGCWGIC+TYAGMFA+
Sbjct: 542 CTDSSVLGLTFFHKHSSYRKEEIANRIKLAIDYIKSCQQEDGSWYGCWGICFTYAGMFAM 601

Query: 597 EALHSVEENYANSAIVRKGCDFLVSKQLIDGGWGESMKSSELHSYVSTPESLVVQTAWAV 656
           EAL++V ENY+NS  VRKGCDFLVSKQ+ DGGWGESMKSSELHSYV + +SLVVQTAW +
Sbjct: 602 EALYTVGENYSNSETVRKGCDFLVSKQMEDGGWGESMKSSELHSYVDSEKSLVVQTAWVL 661

Query: 657 IALLLAEYPDKKVIERGIELLRSRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKAL 716
           +ALLLAEYPDK VI+RGI+LL+ RQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKAL
Sbjct: 662 VALLLAEYPDKDVIDRGIQLLKDRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKAL 721

Query: 717 GLYNKTYA 724
           GLY K Y+
Sbjct: 722 GLYTKAYS 729

>Suva_15.262 Chr15 (440969..443164) [2196 bp, 731 aa] {ON} YHR072W
           (REAL)
          Length = 731

 Score = 1202 bits (3111), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 560/723 (77%), Positives = 635/723 (87%), Gaps = 5/723 (0%)

Query: 6   LYSEQLGLPRTDPKRWRLRTDELGRETWDYIPEDQCEMDPQSSFTQWLLQIRDTETSAPK 65
            YSE++GLP+TDP+RWRLRTD+LGRE+W+Y+  +Q   DP S+FTQWLLQ  D     P 
Sbjct: 4   FYSEKIGLPKTDPRRWRLRTDKLGRESWEYLTPEQAANDPPSTFTQWLLQDPDFPQPHPA 63

Query: 66  E-----PVTAFDSCINGANFFKSLQDPHSGMFPCQYKGPMFMTIGYIAVNYIAGIEIPKH 120
           +       +AFD+C NGA+FFK LQ+P SG+FPCQYKGPMFMTIGY+AV+YIAGI+IP+H
Sbjct: 64  KNKHSPDFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVSYIAGIQIPEH 123

Query: 121 ERLEIIRYIVNTSHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLQRDHPVCLKARDTLL 180
           ER+E+IRYIVNT+HPVDGGWGLHSVDKSTVFGTVLNYVILRLLGL +DHPVC+KARDTLL
Sbjct: 124 ERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLSKDHPVCVKARDTLL 183

Query: 181 RLGGAIGAPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYELPIHPGKWWVHTRGVYLPIS 240
           RLGGAIGAPHWGK+WLS LNLYKWEGVNPAPPETWLLPY LPIHPG+WWVHTRGVY+P+S
Sbjct: 184 RLGGAIGAPHWGKVWLSALNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYIPVS 243

Query: 241 YLSLVHYSCELTPLLEEIRGEIYTKPFDSIDFSKHRNTVCGVDLYYPHSKVLDMANNAII 300
           YLSLV + C +TPLLEE+RGEIYTKPFD I+FS HRNTVCGVDLYYPHSK+L++ANN ++
Sbjct: 244 YLSLVKFVCPMTPLLEELRGEIYTKPFDKINFSNHRNTVCGVDLYYPHSKILNIANNFVV 303

Query: 301 FYEKYLRPAWIYKKSKAKVYSLIQKEIQNTDYLCIAPVNQAFCALVTLIEEGVDSEAFTK 360
           FYEKYLR  +IY  SK KVY L++KEI+NTD LCIAPVNQAFCALVTLIEEGVDS+AF  
Sbjct: 304 FYEKYLRNRFIYSLSKRKVYDLVKKEIENTDSLCIAPVNQAFCALVTLIEEGVDSQAFKD 363

Query: 361 FRTRFKDALFHGPQGMTVMGTNGVQTWDCAFAVQYFFVAGLAERPEFYNFIVAAYRFLIR 420
           F+ RFKDALFHGPQGMT+MGTNGVQTWDCAFA+QYFF AGLAERPEF++ IV+AY+FL R
Sbjct: 364 FQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFTAGLAERPEFHDTIVSAYKFLCR 423

Query: 421 SQFDTECVPGSFRDKRKGSWGFSTKTQGYTVSDCTAEAIKAIIMVKNAPQFSDVHDEIED 480
           SQFDTECVPGSFRDKRKG+WGFSTKTQGYTVSDCTAE+IKAIIMV+N+P FSDVH  I +
Sbjct: 424 SQFDTECVPGSFRDKRKGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPVFSDVHHLITN 483

Query: 481 SRLYEGIDVLLSLQNTGSFEYGSFATYEKIKAPLIMEKLNPAEVFGNIMIEYPYVECTDS 540
            RL+EGIDVLL+LQN GSFEYGSFATYEKIKAPL ME LNPAEVFGNIM+EYPYVECTDS
Sbjct: 484 ERLFEGIDVLLNLQNVGSFEYGSFATYEKIKAPLAMENLNPAEVFGNIMVEYPYVECTDS 543

Query: 541 SVLGLTFFHKYYKYXXXXXXXXXXXXXXYLKRAQEPDGSWYGCWGICYTYAGMFALEALH 600
           SVLGLT+FHK++ Y              Y+K++Q PDG WYG WGIC+TYAGMFALEALH
Sbjct: 544 SVLGLTYFHKFFDYKKEEISTCIRIAIEYIKKSQLPDGGWYGSWGICFTYAGMFALEALH 603

Query: 601 SVEENYANSAIVRKGCDFLVSKQLIDGGWGESMKSSELHSYVSTPESLVVQTAWAVIALL 660
           +V E Y NS+ VRKGCDFLVSKQ+ DGGWGESMKSSELHSYV + ESLVVQTAWA+IALL
Sbjct: 604 TVGETYENSSTVRKGCDFLVSKQMEDGGWGESMKSSELHSYVDSEESLVVQTAWALIALL 663

Query: 661 LAEYPDKKVIERGIELLRSRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGLYN 720
            AEYP ++VI+RGIELL+ RQ  SGEWKFE VEGVFNHSCAIEYPSYRFLFPIKALG+Y 
Sbjct: 664 FAEYPRREVIDRGIELLKHRQEESGEWKFEGVEGVFNHSCAIEYPSYRFLFPIKALGMYT 723

Query: 721 KTY 723
           K Y
Sbjct: 724 KAY 726

>Skud_8.131 Chr8 (212610..214805) [2196 bp, 731 aa] {ON} YHR072W
           (REAL)
          Length = 731

 Score = 1202 bits (3110), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 563/725 (77%), Positives = 635/725 (87%), Gaps = 9/725 (1%)

Query: 6   LYSEQLGLPRTDPKRWRLRTDELGRETWDYIPEDQCEMDPQSSFTQWLLQIRDTETSAPK 65
            YSE++GLP+TDP+ WRLRTDELGRE+W+Y+  +Q   +P S+FTQWLLQ  D   S P+
Sbjct: 4   FYSERIGLPKTDPRLWRLRTDELGRESWEYLTPEQAANEPPSTFTQWLLQ--DPNFSQPQ 61

Query: 66  E-------PVTAFDSCINGANFFKSLQDPHSGMFPCQYKGPMFMTIGYIAVNYIAGIEIP 118
                     +AFD+C NGA+FF+ LQDP SG+FPCQYKGPMF+TIGY+AVNYIAG++IP
Sbjct: 62  PGRNKHSPDFSAFDACHNGASFFQLLQDPKSGIFPCQYKGPMFLTIGYVAVNYIAGVQIP 121

Query: 119 KHERLEIIRYIVNTSHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLQRDHPVCLKARDT 178
           +HER+EIIRYIVNT+HPVDGGWGLHSVDKSTVFGTVLNYVILRLLGL +DHPVC KAR T
Sbjct: 122 EHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKDHPVCTKARGT 181

Query: 179 LLRLGGAIGAPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYELPIHPGKWWVHTRGVYLP 238
           LLRLGGAIG+PHWGKIWLS LNLYKWEGVNPAPPETWLLPY LP+HPG+WWVHTRGVY+P
Sbjct: 182 LLRLGGAIGSPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGVYIP 241

Query: 239 ISYLSLVHYSCELTPLLEEIRGEIYTKPFDSIDFSKHRNTVCGVDLYYPHSKVLDMANNA 298
           +SYLSLV +SC +TPLLEEIR EIYTKPFD IDFS HRNTVCGVDLYYPHS+ LD+ANN 
Sbjct: 242 VSYLSLVKFSCPMTPLLEEIRKEIYTKPFDKIDFSNHRNTVCGVDLYYPHSRTLDIANNF 301

Query: 299 IIFYEKYLRPAWIYKKSKAKVYSLIQKEIQNTDYLCIAPVNQAFCALVTLIEEGVDSEAF 358
           ++FYEKYLR  +IY  SK KVY LI+ EI+NTD LCIAPVNQAFCALVT IEEGVDS+AF
Sbjct: 302 VVFYEKYLRNRFIYSLSKRKVYDLIKTEIENTDSLCIAPVNQAFCALVTFIEEGVDSQAF 361

Query: 359 TKFRTRFKDALFHGPQGMTVMGTNGVQTWDCAFAVQYFFVAGLAERPEFYNFIVAAYRFL 418
            KF+ RFKDALFHGPQGMT+MGTNGVQTWDCAFA+QYFF+AGLAERPEFYN IV+AY+FL
Sbjct: 362 KKFQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFIAGLAERPEFYNTIVSAYKFL 421

Query: 419 IRSQFDTECVPGSFRDKRKGSWGFSTKTQGYTVSDCTAEAIKAIIMVKNAPQFSDVHDEI 478
            R+QFDTECVPGSFR+KRKGSWGFSTKTQGYTV+DCTAE+IKAIIMVKN+P FS+VH  I
Sbjct: 422 CRAQFDTECVPGSFREKRKGSWGFSTKTQGYTVADCTAESIKAIIMVKNSPVFSEVHHLI 481

Query: 479 EDSRLYEGIDVLLSLQNTGSFEYGSFATYEKIKAPLIMEKLNPAEVFGNIMIEYPYVECT 538
              RL+EGIDVLLSLQN GSFEYGSFATYEKIKAPL ME LNPAEVFGNIM+EYPYVECT
Sbjct: 482 TSERLFEGIDVLLSLQNVGSFEYGSFATYEKIKAPLAMEILNPAEVFGNIMVEYPYVECT 541

Query: 539 DSSVLGLTFFHKYYKYXXXXXXXXXXXXXXYLKRAQEPDGSWYGCWGICYTYAGMFALEA 598
           DSSVLGLT+FHK++ Y              Y+KRAQ PDGSWYG WGIC+TYAGMFA+EA
Sbjct: 542 DSSVLGLTYFHKFFDYKKEEIRRRIRIAIEYIKRAQSPDGSWYGSWGICFTYAGMFAMEA 601

Query: 599 LHSVEENYANSAIVRKGCDFLVSKQLIDGGWGESMKSSELHSYVSTPESLVVQTAWAVIA 658
           LH+V ENY NS+ VRKGCDFLVSKQ+ DGGWGESMKSSELHSYV + +SLVVQ+AWA+IA
Sbjct: 602 LHTVGENYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSGKSLVVQSAWALIA 661

Query: 659 LLLAEYPDKKVIERGIELLRSRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGL 718
           L  AEYP+K+VI+RGIELL++RQ  SGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG+
Sbjct: 662 LFFAEYPNKEVIDRGIELLKNRQEESGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGM 721

Query: 719 YNKTY 723
           Y K Y
Sbjct: 722 YAKAY 726

>YHR072W Chr8 (239098..241293) [2196 bp, 731 aa] {ON}
           ERG7Lanosterol synthase, an essential enzyme that
           catalyzes the cyclization of squalene 2,3-epoxide, a
           step in ergosterol biosynthesis
          Length = 731

 Score = 1191 bits (3081), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 556/723 (76%), Positives = 631/723 (87%), Gaps = 5/723 (0%)

Query: 6   LYSEQLGLPRTDPKRWRLRTDELGRETWDYIPEDQCEMDPQSSFTQWLLQIRDTETSAPK 65
            YS+ +GLP+TDP+ WRLRTDELGRE+W+Y+   Q   DP S+FTQWLLQ        P+
Sbjct: 4   FYSDTIGLPKTDPRLWRLRTDELGRESWEYLTPQQAANDPPSTFTQWLLQDPKFPQPHPE 63

Query: 66  E-----PVTAFDSCINGANFFKSLQDPHSGMFPCQYKGPMFMTIGYIAVNYIAGIEIPKH 120
                   +AFD+C NGA+FFK LQ+P SG+FPCQYKGPMFMTIGY+AVNYIAGIEIP+H
Sbjct: 64  RNKHSPDFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVNYIAGIEIPEH 123

Query: 121 ERLEIIRYIVNTSHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLQRDHPVCLKARDTLL 180
           ER+E+IRYIVNT+HPVDGGWGLHSVDKSTVFGTVLNYVILRLLGL +DHPVC KAR TLL
Sbjct: 124 ERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKDHPVCAKARSTLL 183

Query: 181 RLGGAIGAPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYELPIHPGKWWVHTRGVYLPIS 240
           RLGGAIG+PHWGKIWLS LNLYKWEGVNPAPPETWLLPY LP+HPG+WWVHTRGVY+P+S
Sbjct: 184 RLGGAIGSPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGVYIPVS 243

Query: 241 YLSLVHYSCELTPLLEEIRGEIYTKPFDSIDFSKHRNTVCGVDLYYPHSKVLDMANNAII 300
           YLSLV +SC +TPLLEE+R EIYTKPFD I+FSK+RNTVCGVDLYYPHS  L++AN+ ++
Sbjct: 244 YLSLVKFSCPMTPLLEELRNEIYTKPFDKINFSKNRNTVCGVDLYYPHSTTLNIANSLVV 303

Query: 301 FYEKYLRPAWIYKKSKAKVYSLIQKEIQNTDYLCIAPVNQAFCALVTLIEEGVDSEAFTK 360
           FYEKYLR  +IY  SK KVY LI+ E+QNTD LCIAPVNQAFCALVTLIEEGVDSEAF +
Sbjct: 304 FYEKYLRNRFIYSLSKKKVYDLIKTELQNTDSLCIAPVNQAFCALVTLIEEGVDSEAFQR 363

Query: 361 FRTRFKDALFHGPQGMTVMGTNGVQTWDCAFAVQYFFVAGLAERPEFYNFIVAAYRFLIR 420
            + RFKDALFHGPQGMT+MGTNGVQTWDCAFA+QYFFVAGLAERPEFYN IV+AY+FL  
Sbjct: 364 LQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFVAGLAERPEFYNTIVSAYKFLCH 423

Query: 421 SQFDTECVPGSFRDKRKGSWGFSTKTQGYTVSDCTAEAIKAIIMVKNAPQFSDVHDEIED 480
           +QFDTECVPGS+RDKRKG+WGFSTKTQGYTV+DCTAEAIKAIIMVKN+P FS+VH  I  
Sbjct: 424 AQFDTECVPGSYRDKRKGAWGFSTKTQGYTVADCTAEAIKAIIMVKNSPVFSEVHHMISS 483

Query: 481 SRLYEGIDVLLSLQNTGSFEYGSFATYEKIKAPLIMEKLNPAEVFGNIMIEYPYVECTDS 540
            RL+EGIDVLL+LQN GSFEYGSFATYEKIKAPL ME LNPAEVFGNIM+EYPYVECTDS
Sbjct: 484 ERLFEGIDVLLNLQNIGSFEYGSFATYEKIKAPLAMETLNPAEVFGNIMVEYPYVECTDS 543

Query: 541 SVLGLTFFHKYYKYXXXXXXXXXXXXXXYLKRAQEPDGSWYGCWGICYTYAGMFALEALH 600
           SVLGLT+FHKY+ Y              ++K++Q PDGSWYG WGIC+TYAGMFALEALH
Sbjct: 544 SVLGLTYFHKYFDYRKEEIRTRIRIAIEFIKKSQLPDGSWYGSWGICFTYAGMFALEALH 603

Query: 601 SVEENYANSAIVRKGCDFLVSKQLIDGGWGESMKSSELHSYVSTPESLVVQTAWAVIALL 660
           +V E Y NS+ VRKGCDFLVSKQ+ DGGWGESMKSSELHSYV + +SLVVQTAWA+IALL
Sbjct: 604 TVGETYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSEKSLVVQTAWALIALL 663

Query: 661 LAEYPDKKVIERGIELLRSRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGLYN 720
            AEYP+K+VI+RGI+LL++RQ  SGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG+Y+
Sbjct: 664 FAEYPNKEVIDRGIDLLKNRQEESGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGMYS 723

Query: 721 KTY 723
           + Y
Sbjct: 724 RAY 726

>Smik_8.148 Chr8 (215426..217621) [2196 bp, 731 aa] {ON} YHR072W
           (REAL)
          Length = 731

 Score = 1187 bits (3072), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 552/725 (76%), Positives = 632/725 (87%), Gaps = 9/725 (1%)

Query: 6   LYSEQLGLPRTDPKRWRLRTDELGRETWDYIPEDQCEMDPQSSFTQWLLQIRDTETSAPK 65
            YSE +GLP+TDP+ WRLRTDE+GRE+W+Y+  +Q   +P S+FTQWLLQ  D E   P+
Sbjct: 4   FYSETIGLPKTDPRLWRLRTDEIGRESWEYLTSEQAANEPPSTFTQWLLQ--DPEFPHPQ 61

Query: 66  EP-------VTAFDSCINGANFFKSLQDPHSGMFPCQYKGPMFMTIGYIAVNYIAGIEIP 118
                     +AFD+C NGA+FFK LQ+P SG+FPCQYKGPMFMTIGY+AVNYIAGI+IP
Sbjct: 62  PERNKHSPNFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVNYIAGIQIP 121

Query: 119 KHERLEIIRYIVNTSHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLQRDHPVCLKARDT 178
           +HER+EIIRYIVNT+HPVDGGWGLHSVDKSTVFGT LNYVILRLLGL +DHPVC+K+R+T
Sbjct: 122 EHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTALNYVILRLLGLPKDHPVCVKSRNT 181

Query: 179 LLRLGGAIGAPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYELPIHPGKWWVHTRGVYLP 238
           LLRLGGA+G+PHWGKIWLS LNLY+WEGVNPAPPETWLLPY LP+HPG+WWVHTR VY+P
Sbjct: 182 LLRLGGALGSPHWGKIWLSALNLYRWEGVNPAPPETWLLPYSLPMHPGRWWVHTRAVYIP 241

Query: 239 ISYLSLVHYSCELTPLLEEIRGEIYTKPFDSIDFSKHRNTVCGVDLYYPHSKVLDMANNA 298
           +SYLSLV ++C +TPLLEE+R EIYTKPFD I FSKHRNTVCGVDLYYPHSK L++ANN 
Sbjct: 242 VSYLSLVKFTCPMTPLLEELREEIYTKPFDKIKFSKHRNTVCGVDLYYPHSKTLNIANNF 301

Query: 299 IIFYEKYLRPAWIYKKSKAKVYSLIQKEIQNTDYLCIAPVNQAFCALVTLIEEGVDSEAF 358
           ++FYEKYLR  +IY  SK KVY L++KEIQNTD LCIAPVNQAFCALVTLIEEGVDS+AF
Sbjct: 302 VVFYEKYLRNRFIYSLSKRKVYDLVRKEIQNTDSLCIAPVNQAFCALVTLIEEGVDSQAF 361

Query: 359 TKFRTRFKDALFHGPQGMTVMGTNGVQTWDCAFAVQYFFVAGLAERPEFYNFIVAAYRFL 418
            KF+ RFKDALFHGPQGMT+MGTNGVQ+WDCAFA+QY F+AGLAER EFYN IV+AY+FL
Sbjct: 362 KKFQYRFKDALFHGPQGMTIMGTNGVQSWDCAFAIQYLFIAGLAERSEFYNTIVSAYKFL 421

Query: 419 IRSQFDTECVPGSFRDKRKGSWGFSTKTQGYTVSDCTAEAIKAIIMVKNAPQFSDVHDEI 478
            R+QFDTECVPGSFRDKRKG+WGFSTKTQGY VSDCTAEAIKAIIMVKN+P F++VH+ I
Sbjct: 422 CRAQFDTECVPGSFRDKRKGAWGFSTKTQGYVVSDCTAEAIKAIIMVKNSPVFTEVHNMI 481

Query: 479 EDSRLYEGIDVLLSLQNTGSFEYGSFATYEKIKAPLIMEKLNPAEVFGNIMIEYPYVECT 538
            + RL+EGIDVLL+LQN GSFEYGSFATYEKIKAPL ME LNPAEVFGNIM+EYPYVECT
Sbjct: 482 SNERLFEGIDVLLNLQNIGSFEYGSFATYEKIKAPLAMETLNPAEVFGNIMVEYPYVECT 541

Query: 539 DSSVLGLTFFHKYYKYXXXXXXXXXXXXXXYLKRAQEPDGSWYGCWGICYTYAGMFALEA 598
           DSSVLGLT+FHKY+ Y              ++K++Q P+GSWYG WGIC+TYAGMFALEA
Sbjct: 542 DSSVLGLTYFHKYFDYKKEEIRARIRIAIEFIKKSQLPNGSWYGSWGICFTYAGMFALEA 601

Query: 599 LHSVEENYANSAIVRKGCDFLVSKQLIDGGWGESMKSSELHSYVSTPESLVVQTAWAVIA 658
           LH+V E Y NS+ VRKGCDFLVSKQ+ DGGWGESMKSSELHSYV + +SLVVQTAW +IA
Sbjct: 602 LHTVGETYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSEKSLVVQTAWVLIA 661

Query: 659 LLLAEYPDKKVIERGIELLRSRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGL 718
           LL AEYP K VI+RGIELL++RQ  SGEWKFE VEGVFNHSCAIEYPSYRFLFPIKALG+
Sbjct: 662 LLFAEYPGKDVIDRGIELLKNRQEESGEWKFEGVEGVFNHSCAIEYPSYRFLFPIKALGM 721

Query: 719 YNKTY 723
           Y+K Y
Sbjct: 722 YSKAY 726

>TPHA0E01120 Chr5 complement(230336..232537) [2202 bp, 733 aa] {ON}
           Anc_5.351 YHR072W
          Length = 733

 Score = 1186 bits (3067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 552/727 (75%), Positives = 624/727 (85%), Gaps = 6/727 (0%)

Query: 4   IVLYSEQLGLPRTDPKRWRLRTDELGRETWDYIPEDQCEM-DPQSSFTQWLLQIRDTETS 62
           I  YSEQ+GLP+TDPK WRLRTDELGRE+W+Y+ E + ++ D QS++T+WLLQ+ D    
Sbjct: 3   IEFYSEQIGLPKTDPKSWRLRTDELGRESWEYLKEGEVDLNDEQSTYTKWLLQVPDFPAP 62

Query: 63  AP-----KEPVTAFDSCINGANFFKSLQDPHSGMFPCQYKGPMFMTIGYIAVNYIAGIEI 117
            P          A ++C NGA+F+K LQDP SGMFPCQYKGPMFM IGYIAVNYIAGIEI
Sbjct: 63  NPAINSESANFKAENACHNGASFYKLLQDPTSGMFPCQYKGPMFMAIGYIAVNYIAGIEI 122

Query: 118 PKHERLEIIRYIVNTSHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLQRDHPVCLKARD 177
           P HER+E+IRYIVNTSHPVDGGWGLHSVDKSTVFGT LNYV LRLLGL +DHPVC+KARD
Sbjct: 123 PDHERIEMIRYIVNTSHPVDGGWGLHSVDKSTVFGTALNYVNLRLLGLSKDHPVCVKARD 182

Query: 178 TLLRLGGAIGAPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYELPIHPGKWWVHTRGVYL 237
           TL+RLGGAIGAPHWGKIWLS LNLYKWEGVNPAPPETWLLPY LPIHPG+WWVHTRGVY+
Sbjct: 183 TLMRLGGAIGAPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYI 242

Query: 238 PISYLSLVHYSCELTPLLEEIRGEIYTKPFDSIDFSKHRNTVCGVDLYYPHSKVLDMANN 297
           P+SYLSL  Y+CELTPLL EIR EIYTK F+SIDFSKHRNTVCGVDLYYPHSK+LD+AN+
Sbjct: 243 PVSYLSLTKYTCELTPLLAEIRTEIYTKDFESIDFSKHRNTVCGVDLYYPHSKLLDVAND 302

Query: 298 AIIFYEKYLRPAWIYKKSKAKVYSLIQKEIQNTDYLCIAPVNQAFCALVTLIEEGVDSEA 357
            ++FYE YLRP W+Y+KS+  VY LI+KEI+NTDYLCIAPVNQAFCALVTLIEEG +S+ 
Sbjct: 303 CLVFYENYLRPEWVYEKSRKSVYELIKKEIENTDYLCIAPVNQAFCALVTLIEEGKNSKQ 362

Query: 358 FTKFRTRFKDALFHGPQGMTVMGTNGVQTWDCAFAVQYFFVAGLAERPEFYNFIVAAYRF 417
           F +F+ R KDALFHGPQGMTVMGTNG Q WDCAF +QY+FVAGLAE+PEFY+ I AAY+F
Sbjct: 363 FERFQYRMKDALFHGPQGMTVMGTNGTQVWDCAFFIQYYFVAGLAEKPEFYDAISAAYKF 422

Query: 418 LIRSQFDTECVPGSFRDKRKGSWGFSTKTQGYTVSDCTAEAIKAIIMVKNAPQFSDVHDE 477
           L RSQFDTEC PGSFRDKR G+WGFSTKTQGYTVSDCTAE+IKAIIMV+N+P F+ +H+E
Sbjct: 423 LCRSQFDTECEPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPTFAKIHNE 482

Query: 478 IEDSRLYEGIDVLLSLQNTGSFEYGSFATYEKIKAPLIMEKLNPAEVFGNIMIEYPYVEC 537
             D RLY+GID+L+SLQN GSFEYGSFATYEKIKAPL ME LNPAEVFGNIM+EYPYVEC
Sbjct: 483 FSDERLYKGIDILMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYVEC 542

Query: 538 TDSSVLGLTFFHKYYKYXXXXXXXXXXXXXXYLKRAQEPDGSWYGCWGICYTYAGMFALE 597
           TDSSVLGLT+FHK+Y Y              Y+K  Q+ DGSWYGCWGIC+TYAGMFA+E
Sbjct: 543 TDSSVLGLTYFHKHYDYKKEEISKRIKLAIDYIKSCQQKDGSWYGCWGICFTYAGMFAME 602

Query: 598 ALHSVEENYANSAIVRKGCDFLVSKQLIDGGWGESMKSSELHSYVSTPESLVVQTAWAVI 657
           AL +V ENY NS +VRKGCDFLV KQ+ DGGW ESMKSSELH+YVS+  SLVVQTAW +I
Sbjct: 603 ALETVGENYKNSEVVRKGCDFLVKKQMEDGGWSESMKSSELHTYVSSERSLVVQTAWVLI 662

Query: 658 ALLLAEYPDKKVIERGIELLRSRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG 717
           ALLLA+YP K VI+RGI+LL+SRQ PSGEWKFE VEGVFNHSCAIEY SYRFLFPIKALG
Sbjct: 663 ALLLAKYPHKDVIDRGIQLLKSRQQPSGEWKFEEVEGVFNHSCAIEYQSYRFLFPIKALG 722

Query: 718 LYNKTYA 724
           LY K Y 
Sbjct: 723 LYVKNYG 729

>KAFR0D04670 Chr4 (915691..917886) [2196 bp, 731 aa] {ON} Anc_5.351
           YHR072W
          Length = 731

 Score = 1175 bits (3039), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 549/725 (75%), Positives = 622/725 (85%), Gaps = 5/725 (0%)

Query: 5   VLYSEQLGLPRTDPKRWRLRTDELGRETWDYIPEDQCEMDPQSSFTQWLLQIRDTETSAP 64
             YS+++GL +TDP+ WRLRTD+LGR+TWDYI +   E DPQ++F QWLLQ+    +  P
Sbjct: 3   TFYSDEVGLEKTDPRLWRLRTDDLGRQTWDYIDQLDAESDPQTTFVQWLLQLPGFPSPNP 62

Query: 65  K-----EPVTAFDSCINGANFFKSLQDPHSGMFPCQYKGPMFMTIGYIAVNYIAGIEIPK 119
                 +  TA D+C NGA FFK LQD +SG+FPCQYKGPMFMTIGY+AVNYIAGIEIP+
Sbjct: 63  DIKNGDDSFTAKDACYNGATFFKLLQDGNSGIFPCQYKGPMFMTIGYVAVNYIAGIEIPE 122

Query: 120 HERLEIIRYIVNTSHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLQRDHPVCLKARDTL 179
           HE++E+IRYIVNT+HPVDGGWGLHSVDKST FGT +NYVILRLLGL + H VC++ARDTL
Sbjct: 123 HEKIELIRYIVNTAHPVDGGWGLHSVDKSTAFGTAINYVILRLLGLSKHHTVCVRARDTL 182

Query: 180 LRLGGAIGAPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYELPIHPGKWWVHTRGVYLPI 239
           LRLGGAIG PHWGKIWLSVLNLY WEGVNPAPPETWLLPY LPIHPG+WWVHTRGVYLPI
Sbjct: 183 LRLGGAIGVPHWGKIWLSVLNLYSWEGVNPAPPETWLLPYYLPIHPGRWWVHTRGVYLPI 242

Query: 240 SYLSLVHYSCELTPLLEEIRGEIYTKPFDSIDFSKHRNTVCGVDLYYPHSKVLDMANNAI 299
           SYLSLV YS E TPLLEEIR EIY KPFD I+FS+HRNTVCGVDLYYPHS +LD AN AI
Sbjct: 243 SYLSLVRYSTECTPLLEEIRKEIYVKPFDDINFSQHRNTVCGVDLYYPHSTLLDTANKAI 302

Query: 300 IFYEKYLRPAWIYKKSKAKVYSLIQKEIQNTDYLCIAPVNQAFCALVTLIEEGVDSEAFT 359
           + YEK+LRP W+ +KS+  +Y LI+KE QNTDYLCIAPVNQAFCAL TLIEEGV+S+ F 
Sbjct: 303 VLYEKFLRPTWLAEKSRKAIYELIEKEAQNTDYLCIAPVNQAFCALATLIEEGVESKPFR 362

Query: 360 KFRTRFKDALFHGPQGMTVMGTNGVQTWDCAFAVQYFFVAGLAERPEFYNFIVAAYRFLI 419
           K++ RFKDALFHGPQGMTV GTNGVQTWDCAFA+QY F+AGLAE+PEFY+ + AA++FL 
Sbjct: 363 KYQERFKDALFHGPQGMTVTGTNGVQTWDCAFAIQYLFIAGLAEQPEFYDAVSAAFKFLC 422

Query: 420 RSQFDTECVPGSFRDKRKGSWGFSTKTQGYTVSDCTAEAIKAIIMVKNAPQFSDVHDEIE 479
           RSQFDTECVPGSFRDKR G+WGFSTKTQGYTVSDCTAE+IKAIIMV+N+P F+ +HDEI 
Sbjct: 423 RSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPVFAKIHDEIT 482

Query: 480 DSRLYEGIDVLLSLQNTGSFEYGSFATYEKIKAPLIMEKLNPAEVFGNIMIEYPYVECTD 539
           D RL +GID+LL LQN GSFE+GSFATYEKIKAPLI+EKLNPAEVFGNIM+EYPYVECTD
Sbjct: 483 DERLCKGIDILLDLQNMGSFEFGSFATYEKIKAPLILEKLNPAEVFGNIMVEYPYVECTD 542

Query: 540 SSVLGLTFFHKYYKYXXXXXXXXXXXXXXYLKRAQEPDGSWYGCWGICYTYAGMFALEAL 599
           SSVLGLT+FH++YKY              Y+K AQ+ DGSWYG WGIC+TYAGMFA+EAL
Sbjct: 543 SSVLGLTYFHRHYKYRHEEISDRIQLAIRYIKNAQQDDGSWYGSWGICFTYAGMFAMEAL 602

Query: 600 HSVEENYANSAIVRKGCDFLVSKQLIDGGWGESMKSSELHSYVSTPESLVVQTAWAVIAL 659
            SV E Y NS  V KGCDFLVSKQ+ DGGW ESMKSSELH+YVST ESLVVQTAW +IAL
Sbjct: 603 QSVGELYENSDAVHKGCDFLVSKQMPDGGWSESMKSSELHTYVSTKESLVVQTAWVLIAL 662

Query: 660 LLAEYPDKKVIERGIELLRSRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGLY 719
           LLA+YPDK+VI+RGI LL+SRQ PSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGLY
Sbjct: 663 LLAKYPDKQVIDRGISLLKSRQEPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGLY 722

Query: 720 NKTYA 724
            K Y 
Sbjct: 723 VKEYG 727

>NDAI0C01970 Chr3 complement(442137..444332) [2196 bp, 731 aa] {ON}
           Anc_5.351 YHR072W
          Length = 731

 Score = 1162 bits (3007), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/723 (76%), Positives = 619/723 (85%), Gaps = 7/723 (0%)

Query: 6   LYSEQLGLPRTDPKRWRLRTDELGRETWDYIPEDQCEMDPQSSFTQWLLQIRDTETSAPK 65
           LYSE+LGL +TDP  WRLRT+  GR++W+YI +DQ   DPQS+FT+WLLQ+ D  T  P+
Sbjct: 5   LYSEELGLEKTDPLLWRLRTNIDGRQSWEYITKDQSPNDPQSNFTKWLLQLPDFPT--PQ 62

Query: 66  EP-----VTAFDSCINGANFFKSLQDPHSGMFPCQYKGPMFMTIGYIAVNYIAGIEIPKH 120
            P     V+A   C+ GA FF+ LQD  SG FPCQYKGPMFMTIGY+AVNY+A I+IP+ 
Sbjct: 63  YPDNIKDVSAEAICLKGAKFFRLLQDETSGTFPCQYKGPMFMTIGYVAVNYVADIKIPES 122

Query: 121 ERLEIIRYIVNTSHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLQRDHPVCLKARDTLL 180
           ER+EIIRYIVNT+HPVDGGWGLHS DKSTVFGTVLNY+ILRLLGL  +HPVC+KARDTLL
Sbjct: 123 ERIEIIRYIVNTAHPVDGGWGLHSEDKSTVFGTVLNYIILRLLGLDANHPVCMKARDTLL 182

Query: 181 RLGGAIGAPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYELPIHPGKWWVHTRGVYLPIS 240
           RLGGAI APHWGK+WLSVLNLYKWEGVNPAPPETWLLPY +PIHPG+WWVHTRGVYLPIS
Sbjct: 183 RLGGAISAPHWGKVWLSVLNLYKWEGVNPAPPETWLLPYWMPIHPGRWWVHTRGVYLPIS 242

Query: 241 YLSLVHYSCELTPLLEEIRGEIYTKPFDSIDFSKHRNTVCGVDLYYPHSKVLDMANNAII 300
           YLSLVHY CELT LL+EIR EIY KPFDSIDFSKHRNTVCGVDLYYPHSK LD AN+ I+
Sbjct: 243 YLSLVHYQCELTDLLKEIRSEIYVKPFDSIDFSKHRNTVCGVDLYYPHSKTLDFANSLIV 302

Query: 301 FYEKYLRPAWIYKKSKAKVYSLIQKEIQNTDYLCIAPVNQAFCALVTLIEEGVDSEAFTK 360
            YEKYLRP  +   SK KVY LI+KEI+NTDYLCIAPVNQAFCALVTL+EEG DS+AF +
Sbjct: 303 PYEKYLRPNALRDYSKHKVYDLIKKEIENTDYLCIAPVNQAFCALVTLLEEGADSKAFER 362

Query: 361 FRTRFKDALFHGPQGMTVMGTNGVQTWDCAFAVQYFFVAGLAERPEFYNFIVAAYRFLIR 420
           F+ RFKDALF GPQGMTVMGTNGVQTWDCAFA+QY FVAGLA+RPEFYN I  AY+FL R
Sbjct: 363 FQYRFKDALFLGPQGMTVMGTNGVQTWDCAFAIQYLFVAGLAKRPEFYNTISNAYKFLCR 422

Query: 421 SQFDTECVPGSFRDKRKGSWGFSTKTQGYTVSDCTAEAIKAIIMVKNAPQFSDVHDEIED 480
           SQFDT+CV GSFRDKR G+WGFSTKTQGYTVSDCTAE+IKAIIMV+N+  F D+HDEI D
Sbjct: 423 SQFDTDCVTGSFRDKRDGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSVIFKDIHDEISD 482

Query: 481 SRLYEGIDVLLSLQNTGSFEYGSFATYEKIKAPLIMEKLNPAEVFGNIMIEYPYVECTDS 540
            RLY+ +D+LL LQNTGSFE+GSFATYEKIKAPL +E LNPAEVFGNIM+EYPYVECTDS
Sbjct: 483 ERLYKAVDILLDLQNTGSFEFGSFATYEKIKAPLFLEALNPAEVFGNIMVEYPYVECTDS 542

Query: 541 SVLGLTFFHKYYKYXXXXXXXXXXXXXXYLKRAQEPDGSWYGCWGICYTYAGMFALEALH 600
           SVLGLT FHK+Y Y              Y+K+ QE DGSWYG WGICYTYAGMFA+EALH
Sbjct: 543 SVLGLTSFHKHYNYRKDEISKRINIAIEYIKKVQEDDGSWYGSWGICYTYAGMFAMEALH 602

Query: 601 SVEENYANSAIVRKGCDFLVSKQLIDGGWGESMKSSELHSYVSTPESLVVQTAWAVIALL 660
           SV E Y NS +V+KGCDFLV++QL DGGWGESMKSSELH+YVST ESLVVQTAW V+ALL
Sbjct: 603 SVGETYGNSFVVKKGCDFLVARQLEDGGWGESMKSSELHTYVSTKESLVVQTAWVVLALL 662

Query: 661 LAEYPDKKVIERGIELLRSRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGLYN 720
           LA+YP+K +I++GI LL+ RQ  SGEWKFES EGVFNHSCAIEYPSYRFLFPIKALGLY+
Sbjct: 663 LAQYPNKNIIDKGIALLKKRQQVSGEWKFESPEGVFNHSCAIEYPSYRFLFPIKALGLYS 722

Query: 721 KTY 723
           + Y
Sbjct: 723 QIY 725

>NCAS0H01640 Chr8 complement(313901..316087) [2187 bp, 728 aa] {ON}
           Anc_5.351 YHR072W
          Length = 728

 Score = 1160 bits (3002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/721 (76%), Positives = 617/721 (85%), Gaps = 3/721 (0%)

Query: 6   LYSEQLGLPRTDPKRWRLRTDELGRETWDYIPEDQCEMDPQSSFTQWLLQIRDTETSAP- 64
           LYS++LGL +TDP RWRLRT+ LGR TW+YI  +Q   DPQS+FT+WLLQ+ D     P 
Sbjct: 5   LYSDELGLQKTDPTRWRLRTNPLGRHTWEYINSEQKTNDPQSTFTKWLLQLPDFPAPTPT 64

Query: 65  -KEPVTAFDSCINGANFFKSLQDPHSGMFPCQYKGPMFMTIGYIAVNYIAGIEIPKHERL 123
            +EP TA ++C +GA+FF+ LQD  SG FPCQYKGPMFMTIGY+AVNYIAG+EIP HER+
Sbjct: 65  TEEPRTAREACYDGASFFRLLQDKESGTFPCQYKGPMFMTIGYVAVNYIAGLEIPNHERI 124

Query: 124 EIIRYIVNTSHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLQRDHPVCLKARDTLLRLG 183
           EIIRY+VNT+HPVDGGWGLHS DKSTVFGTV+NYVILRLLG+ +DH VC +AR TLL LG
Sbjct: 125 EIIRYLVNTAHPVDGGWGLHSTDKSTVFGTVINYVILRLLGMSKDHIVCRRARKTLLSLG 184

Query: 184 GAIGAPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYELPIHPGKWWVHTRGVYLPISYLS 243
           GAIGAPHWGK+WLSVLNLYKWEGVNPAPPETWLLPY LPIHPG+WWVHTRGVYLPISYLS
Sbjct: 185 GAIGAPHWGKVWLSVLNLYKWEGVNPAPPETWLLPYCLPIHPGRWWVHTRGVYLPISYLS 244

Query: 244 LVHYSCELTPLLEEIRGEIYT-KPFDSIDFSKHRNTVCGVDLYYPHSKVLDMANNAIIFY 302
           LVH+SCELTPLL+EIR EIYT +PF++I F+++RN VCGVDLYYPHS+VLD+AN  I+ Y
Sbjct: 245 LVHFSCELTPLLKEIREEIYTAQPFEAIKFAQNRNNVCGVDLYYPHSQVLDVANACIVKY 304

Query: 303 EKYLRPAWIYKKSKAKVYSLIQKEIQNTDYLCIAPVNQAFCALVTLIEEGVDSEAFTKFR 362
           E+YLRP W+ K SK KVY LI+KEI NTDYLCIAPVNQAFCALVTLIEEGVDS AF KF 
Sbjct: 305 EEYLRPTWLKKLSKRKVYELIKKEISNTDYLCIAPVNQAFCALVTLIEEGVDSNAFQKFS 364

Query: 363 TRFKDALFHGPQGMTVMGTNGVQTWDCAFAVQYFFVAGLAERPEFYNFIVAAYRFLIRSQ 422
            RFKD+LFHGPQGMTVMGTNGVQ WDCAFA+QYFFVAGLAE+ EFY+ I +AY FL RSQ
Sbjct: 365 YRFKDSLFHGPQGMTVMGTNGVQVWDCAFAIQYFFVAGLAEKSEFYDTIASAYAFLCRSQ 424

Query: 423 FDTECVPGSFRDKRKGSWGFSTKTQGYTVSDCTAEAIKAIIMVKNAPQFSDVHDEIEDSR 482
           FDTECV GSFRDKR GSWGFSTKTQGYTVSDCTAE+IKAIIMVKN+P F  +H  I D +
Sbjct: 425 FDTECVRGSFRDKRVGSWGFSTKTQGYTVSDCTAESIKAIIMVKNSPVFKAIHHLITDEK 484

Query: 483 LYEGIDVLLSLQNTGSFEYGSFATYEKIKAPLIMEKLNPAEVFGNIMIEYPYVECTDSSV 542
           +Y+GIDVLLSLQN GSFEYGSFATYEKIKAPL +EKLNPAEVFGNIM+EYPYVECTDSSV
Sbjct: 485 IYQGIDVLLSLQNVGSFEYGSFATYEKIKAPLFLEKLNPAEVFGNIMVEYPYVECTDSSV 544

Query: 543 LGLTFFHKYYKYXXXXXXXXXXXXXXYLKRAQEPDGSWYGCWGICYTYAGMFALEALHSV 602
           LGLT+FH YY Y              Y+K  Q  DGSWYG WGICYTYAGMFA+EALHSV
Sbjct: 545 LGLTYFHNYYNYRGNEISQRIKVAVDYIKHLQASDGSWYGSWGICYTYAGMFAMEALHSV 604

Query: 603 EENYANSAIVRKGCDFLVSKQLIDGGWGESMKSSELHSYVSTPESLVVQTAWAVIALLLA 662
            E YANS +V+KGCDFLV++Q+ DGGWGE MKSSELH+YV++  S VVQTAW VIALLLA
Sbjct: 605 GECYANSIVVKKGCDFLVNRQMTDGGWGEPMKSSELHTYVNSERSQVVQTAWVVIALLLA 664

Query: 663 EYPDKKVIERGIELLRSRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGLYNKT 722
           +YP K VI +G+ELL+SRQ PSGEWKFES EGVFNHSCAIEYPSYR LFPIKALGLY + 
Sbjct: 665 KYPRKDVIIKGVELLKSRQEPSGEWKFESPEGVFNHSCAIEYPSYRHLFPIKALGLYAEI 724

Query: 723 Y 723
           Y
Sbjct: 725 Y 725

>TDEL0E02760 Chr5 complement(531650..533845) [2196 bp, 731 aa] {ON}
           Anc_5.351 YHR072W
          Length = 731

 Score = 1158 bits (2995), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/726 (74%), Positives = 614/726 (84%), Gaps = 5/726 (0%)

Query: 4   IVLYSEQLGLPRTDPKRWRLRTDELGRETWDYIPEDQCEMDPQSSFTQWLLQIRDTETSA 63
           +  YSE+LGL RTDP  WRLRTDELGRETW Y+  +Q + D Q +FTQWLLQ       +
Sbjct: 2   VQFYSEELGLERTDPDLWRLRTDELGRETWVYLTPEQAKNDEQCTFTQWLLQSEKFPKPS 61

Query: 64  PKE-----PVTAFDSCINGANFFKSLQDPHSGMFPCQYKGPMFMTIGYIAVNYIAGIEIP 118
           P          A D+C NGA+FFK LQDP SG+FPCQYKGPMF+TIGY+AV+YI+G  IP
Sbjct: 62  PNRHSGTTDFKAADACENGASFFKLLQDPRSGIFPCQYKGPMFLTIGYVAVHYISGTTIP 121

Query: 119 KHERLEIIRYIVNTSHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLQRDHPVCLKARDT 178
           +HER+EIIRYIVNT+HPVDGGWGLHSVDKST FGTV+NYVILRLLGL +DHPVCLKAR  
Sbjct: 122 EHERIEIIRYIVNTAHPVDGGWGLHSVDKSTAFGTVVNYVILRLLGLPKDHPVCLKARAL 181

Query: 179 LLRLGGAIGAPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYELPIHPGKWWVHTRGVYLP 238
           L++LGGAIGAPHWGKIWLSVLNLYKWEGVNPAPPE WLLPY LPIHPG+WWVHTR +YLP
Sbjct: 182 LMKLGGAIGAPHWGKIWLSVLNLYKWEGVNPAPPEMWLLPYALPIHPGRWWVHTRAIYLP 241

Query: 239 ISYLSLVHYSCELTPLLEEIRGEIYTKPFDSIDFSKHRNTVCGVDLYYPHSKVLDMANNA 298
           +SYLSL+ YSC L  LL E+R EIY KPFDSI+FS +RNTVCG+DLYYPH+ VL+MANN 
Sbjct: 242 VSYLSLIRYSCPLNDLLRELRSEIYVKPFDSINFSSNRNTVCGIDLYYPHTTVLNMANNV 301

Query: 299 IIFYEKYLRPAWIYKKSKAKVYSLIQKEIQNTDYLCIAPVNQAFCALVTLIEEGVDSEAF 358
           ++FYEK+LRP W+ KK+K +VY LI+KEI NTDYLCIAPVNQAFCALVT IEEG +S AF
Sbjct: 302 MVFYEKHLRPNWLGKKAKDRVYGLIKKEIANTDYLCIAPVNQAFCALVTYIEEGKESSAF 361

Query: 359 TKFRTRFKDALFHGPQGMTVMGTNGVQTWDCAFAVQYFFVAGLAERPEFYNFIVAAYRFL 418
            KF  R KDALFHGPQGMT+MGTNGVQTWDCAFA+QYFFVAGLAE+PE+Y+ I AAY+FL
Sbjct: 362 KKFEDRLKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFVAGLAEKPEYYDTICAAYKFL 421

Query: 419 IRSQFDTECVPGSFRDKRKGSWGFSTKTQGYTVSDCTAEAIKAIIMVKNAPQFSDVHDEI 478
            R+QFDTECV GSFRDKR G+W FSTK QGYTVSDCTAEAIKAIIMV+N+P+F+ + +EI
Sbjct: 422 CRTQFDTECVEGSFRDKRVGAWPFSTKAQGYTVSDCTAEAIKAIIMVRNSPKFASIRNEI 481

Query: 479 EDSRLYEGIDVLLSLQNTGSFEYGSFATYEKIKAPLIMEKLNPAEVFGNIMIEYPYVECT 538
            D RL +GIDVLLSLQN  SFEYGSFATYEKIKAPL MEKLNPAEVFGNIM+E+PYVECT
Sbjct: 482 TDERLCKGIDVLLSLQNITSFEYGSFATYEKIKAPLSMEKLNPAEVFGNIMVEFPYVECT 541

Query: 539 DSSVLGLTFFHKYYKYXXXXXXXXXXXXXXYLKRAQEPDGSWYGCWGICYTYAGMFALEA 598
           DSSVLGLT+FH +Y Y              Y+KR Q+ DGSWYGCWG+CY+YAGMFA+EA
Sbjct: 542 DSSVLGLTYFHTFYDYRKEEISKRIKLAIDYIKRDQDEDGSWYGCWGVCYSYAGMFAMEA 601

Query: 599 LHSVEENYANSAIVRKGCDFLVSKQLIDGGWGESMKSSELHSYVSTPESLVVQTAWAVIA 658
           LHSV ENY+NS  VRKGCDFLVS+Q+ DGGWGESMKSSELHSYVST ESLVVQTAW +IA
Sbjct: 602 LHSVGENYSNSEYVRKGCDFLVSRQISDGGWGESMKSSELHSYVSTRESLVVQTAWVLIA 661

Query: 659 LLLAEYPDKKVIERGIELLRSRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGL 718
           LLL +YP+K VI+ GI+LL+ RQL +GEWKFE +EGVFNHSCAIEYPSYRFLFPIKALGL
Sbjct: 662 LLLGKYPNKSVIDAGIKLLKKRQLETGEWKFEGIEGVFNHSCAIEYPSYRFLFPIKALGL 721

Query: 719 YNKTYA 724
           Y  TY 
Sbjct: 722 YTATYG 727

>CAGL0J10824g Chr10 complement(1056204..1058405) [2202 bp, 733 aa]
           {ON} highly similar to uniprot|P38604 Saccharomyces
           cerevisiae YHR072w ERG7 lanosterol synthase
          Length = 733

 Score = 1147 bits (2967), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/718 (76%), Positives = 617/718 (85%), Gaps = 3/718 (0%)

Query: 6   LYSEQLGLPRTDPKRWRLRTDELGRETWDYIPEDQCEMDPQSSFTQWLLQIRDTETSAPK 65
            YS+ +G+PRTDPKRWRLRT ELGRE W+YI +D+ + DPQS+F QWLLQ  +  T +P+
Sbjct: 4   FYSDTVGIPRTDPKRWRLRTTELGREAWEYIEQDKVDADPQSTFVQWLLQDEEFPTPSPR 63

Query: 66  ---EPVTAFDSCINGANFFKSLQDPHSGMFPCQYKGPMFMTIGYIAVNYIAGIEIPKHER 122
              + +++  +C  GA+F+K LQD  SG+FPCQYKGPMFMTIGY+AVNYIAG+++P+HER
Sbjct: 64  KEGDDLSSEQACYYGASFYKLLQDQKSGIFPCQYKGPMFMTIGYVAVNYIAGVKLPEHER 123

Query: 123 LEIIRYIVNTSHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLQRDHPVCLKARDTLLRL 182
           +E+IRYIVNT+HPVDGGWGLHSVDKSTVFGTVLNYV LRLLGL +DH VC++AR TL RL
Sbjct: 124 IELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVCLRLLGLPKDHIVCVRARHTLHRL 183

Query: 183 GGAIGAPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYELPIHPGKWWVHTRGVYLPISYL 242
           GGA GAPHWGKIWLS+LNLYKWEGVNPAPPETWLLPY LPIHPG+WWVHTR VYLP+SYL
Sbjct: 184 GGATGAPHWGKIWLSILNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRAVYLPVSYL 243

Query: 243 SLVHYSCELTPLLEEIRGEIYTKPFDSIDFSKHRNTVCGVDLYYPHSKVLDMANNAIIFY 302
           SL+ YSC LT LL EIR EIYTK FD I+FS+HRNTVCGVDLYYPHSK+LD AN+ I+FY
Sbjct: 244 SLIKYSCPLTDLLSEIRQEIYTKSFDKINFSQHRNTVCGVDLYYPHSKILDTANDVIVFY 303

Query: 303 EKYLRPAWIYKKSKAKVYSLIQKEIQNTDYLCIAPVNQAFCALVTLIEEGVDSEAFTKFR 362
           EKYLRP  +   SK  VY+LI+KEIQNTD LCIAPVNQAFCALVT +EEG DS+AF +F+
Sbjct: 304 EKYLRPRLVSMASKKVVYNLIKKEIQNTDSLCIAPVNQAFCALVTYLEEGKDSKAFERFQ 363

Query: 363 TRFKDALFHGPQGMTVMGTNGVQTWDCAFAVQYFFVAGLAERPEFYNFIVAAYRFLIRSQ 422
            RFKD LFHGPQGMTVMGTNGVQTWDCAF +QYFFVAGLAE+PEF   I+ AY+FL RSQ
Sbjct: 364 YRFKDGLFHGPQGMTVMGTNGVQTWDCAFMIQYFFVAGLAEKPEFREMIINAYKFLCRSQ 423

Query: 423 FDTECVPGSFRDKRKGSWGFSTKTQGYTVSDCTAEAIKAIIMVKNAPQFSDVHDEIEDSR 482
           FDTECV GSFRDKR G+WGFSTKTQGYTVSDCTAEAIKAIIMV+N+P FS VHDEI D R
Sbjct: 424 FDTECVEGSFRDKRVGAWGFSTKTQGYTVSDCTAEAIKAIIMVRNSPVFSSVHDEITDER 483

Query: 483 LYEGIDVLLSLQNTGSFEYGSFATYEKIKAPLIMEKLNPAEVFGNIMIEYPYVECTDSSV 542
           L +GIDVLLSLQN G FEYGSFATYEKIKAPL MEKLNPAEVFGNIM+EYPYVECTDSSV
Sbjct: 484 LCKGIDVLLSLQNIGKFEYGSFATYEKIKAPLSMEKLNPAEVFGNIMVEYPYVECTDSSV 543

Query: 543 LGLTFFHKYYKYXXXXXXXXXXXXXXYLKRAQEPDGSWYGCWGICYTYAGMFALEALHSV 602
           LGLT+FHKYY Y              Y+K+AQ+ DG WYGCWGIC+TYAGMFA+EALHSV
Sbjct: 544 LGLTYFHKYYDYRKDEISHRIRIAIDYIKQAQQDDGGWYGCWGICFTYAGMFAMEALHSV 603

Query: 603 EENYANSAIVRKGCDFLVSKQLIDGGWGESMKSSELHSYVSTPESLVVQTAWAVIALLLA 662
            E Y NS  VRKGCDFL+SKQ+ DGGWGESMKSSELH YV +P+SLVVQTAWA+IALLLA
Sbjct: 604 GETYDNSLTVRKGCDFLLSKQMPDGGWGESMKSSELHDYVDSPKSLVVQTAWALIALLLA 663

Query: 663 EYPDKKVIERGIELLRSRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGLYN 720
           + P++  IERGI LL+SRQ PSGEWKFES EGVFNHSCAIEYPSYRFLFPIKALGLYN
Sbjct: 664 KCPNEDAIERGINLLKSRQQPSGEWKFESAEGVFNHSCAIEYPSYRFLFPIKALGLYN 721

>TBLA0A03120 Chr1 (742618..744849) [2232 bp, 743 aa] {ON} Anc_5.351
           YHR072W
          Length = 743

 Score = 1142 bits (2955), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/731 (73%), Positives = 619/731 (84%), Gaps = 8/731 (1%)

Query: 5   VLYSEQLGLPRTDPKRWRLRTDELGRETWDYIPEDQCEMDPQSSFTQWLLQIRDTETSAP 64
           +LYS++L LP+TDP+RWRL TD+LGRE+W+Y+ E+  +  PQS+F +WLLQI D  T  P
Sbjct: 13  ILYSDELKLPKTDPRRWRLITDKLGRESWEYLSEEDSKKIPQSTFVKWLLQIPDFPTPKP 72

Query: 65  K-----EPVTAFDSCINGANFFKSLQDPHSGMFPCQYKGPMFMTIGYIAVNYIAGIEIPK 119
           K     +  T  D+ +NGANFFK LQDP SG+FPCQYKGPMF+TIGY+AV YIAGI+IP+
Sbjct: 73  KIKQGDKNFTTHDALLNGANFFKLLQDPESGIFPCQYKGPMFLTIGYVAVQYIAGIKIPE 132

Query: 120 HERLEIIRYIVNTSHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLQRDHPVCLKARDTL 179
           HERLEIIRYIVNT+HPVDGGWGLHSVDKSTVFGTVLNYVILRLLGL + HPVC+KAR TL
Sbjct: 133 HERLEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKTHPVCVKARKTL 192

Query: 180 LRLGGAIGAPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYELPIHPGKWWVHTRGVYLPI 239
           +RLGGAIG+PHWGKIWLSVLNLYKWEGVNPAPPETWLLPY LPIHPG+WWVHTRGVYLP+
Sbjct: 193 IRLGGAIGSPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYLPV 252

Query: 240 SYLSLVHYSCELTPLLEEIRGEIYTKPFDSIDFSKHRNTVCGVDLYYPHSKVLDMANNAI 299
           SYL L  ++C  TPL+EEIR EIY   +D+IDFSKHRNTVCGVDLYYPHSK+LD+ANN +
Sbjct: 253 SYLGLTKFACPPTPLIEEIRKEIYATEYDTIDFSKHRNTVCGVDLYYPHSKILDVANNIL 312

Query: 300 IFYEKYLRPAWIYKKSKAKVYSLIQKEIQNTDYLCIAPVNQAFCALVTLIEEGVDSEAFT 359
           +FYEK++RP +IY KSK KV  LI+KEI NTDYLCIAPVNQAFC+LV L+E+GV+S+ F 
Sbjct: 313 VFYEKWIRPNFIYNKSKEKVLDLIEKEIANTDYLCIAPVNQAFCSLVILVEKGVNSKEFE 372

Query: 360 KFRTRFKDALFHGPQGMTVMGTNGVQTWDCAFAVQYFFVAGLAERPEFYNFIVAAYRFLI 419
           + + RFKDALFHGPQGMTVMGTNGVQTWDCAFAVQYFF+AGLAERPEF + I+ +Y+FL 
Sbjct: 373 RCQYRFKDALFHGPQGMTVMGTNGVQTWDCAFAVQYFFMAGLAERPEFKDLIIRSYKFLC 432

Query: 420 RSQFDTECVPGSFRDKRKGSWGFSTKTQGYTVSDCTAEAIKAIIMVKNAPQFSDVHDEIE 479
           RSQFDTECVPGSFRDKR G WGFSTKTQGYTVSDCTAE+IKAIIMV+N+P F +VHDEI 
Sbjct: 433 RSQFDTECVPGSFRDKRIGGWGFSTKTQGYTVSDCTAESIKAIIMVRNSPAFKEVHDEIS 492

Query: 480 DSRLYEGIDVLLSLQNTGSFEYGSFATYEKIKAPLIMEKLNPAEVFGNIMIEYPYVECTD 539
           D RLY+GI++L+SLQN G FEYGSFATYEKIKAPL ME LNPAEVF NIM+EYPYVECTD
Sbjct: 493 DERLYQGIEILMSLQNLGKFEYGSFATYEKIKAPLSMELLNPAEVFCNIMVEYPYVECTD 552

Query: 540 SSVLGLTFFHKYYKYXXXXXXXXXXXXXXYLKRAQEPDGSWYGCWGICYTYAGMFALEAL 599
           SSVLGLT+FHK+Y Y              Y+KRAQ  DGSWYG WGIC+TYA MFALEAL
Sbjct: 553 SSVLGLTYFHKHYDYKYDEIGKRIRLAIDYIKRAQNNDGSWYGSWGICFTYASMFALEAL 612

Query: 600 HSVEENYANSAIVRKGCDFLVSKQLIDGGWGESMKSSELHSYVSTPE---SLVVQTAWAV 656
            ++ E+Y NS  V+KGCDF+VSKQ  DGGW E+MKSSE+H YV + +   S VVQT+W+V
Sbjct: 613 ETIGEDYNNSETVKKGCDFIVSKQNKDGGWSETMKSSEIHYYVDSGDLEGSYVVQTSWSV 672

Query: 657 IALLLAEYPDKKVIERGIELLRSRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKAL 716
           I L+LA YPDK V+ RGIE ++S+QLPSGEW+F++VEGVFNHSC IEYPSYRFLFPIKAL
Sbjct: 673 IGLILANYPDKDVVYRGIEYIKSQQLPSGEWEFQNVEGVFNHSCGIEYPSYRFLFPIKAL 732

Query: 717 GLYNKTYAIAP 727
           GLY   Y   P
Sbjct: 733 GLYRTRYCQKP 743

>SAKL0G08844g Chr7 complement(757226..759466) [2241 bp, 746 aa] {ON}
           highly similar to uniprot|P38604 Saccharomyces
           cerevisiae YHR072W ERG7 Lanosterol synthase an essential
           enzyme that catalyzes the cyclization of squalene 2 3-
           epoxide a step in ergosterol biosynthesis
          Length = 746

 Score = 1117 bits (2890), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/724 (72%), Positives = 602/724 (83%), Gaps = 6/724 (0%)

Query: 6   LYSEQLGLPRTDPKRWRLRTDELGRETWDYIPEDQCEMDPQSSFTQWLLQIRDTETSAPK 65
           LYS+QLGLP+TDP RWRL TDELGRETW+Y+  +Q   +PQSS+ ++LLQ+ D     P+
Sbjct: 20  LYSDQLGLPKTDPTRWRLHTDELGRETWEYLSTEQAAKEPQSSYVKYLLQLPDFPAPKPE 79

Query: 66  EP-----VTAFDSCINGANFFKSLQDPHSGMFPCQYKGPMFMTIGYIAVNYIAGIEIPKH 120
                   TA+D+  NGA F + LQ+  SG+FPCQYKGPMF+TIGY+A  Y AGIEIP+H
Sbjct: 80  RTSEDPEFTAYDAAYNGAQFLQLLQE-ESGIFPCQYKGPMFITIGYVATCYAAGIEIPEH 138

Query: 121 ERLEIIRYIVNTSHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLQRDHPVCLKARDTLL 180
           ER EI+RYIVN +HPVDGGWGLHS DKST FGT +NYVILRLLGL  DH VC +AR TLL
Sbjct: 139 ERHEIVRYIVNMAHPVDGGWGLHSEDKSTAFGTSINYVILRLLGLPSDHIVCRRARSTLL 198

Query: 181 RLGGAIGAPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYELPIHPGKWWVHTRGVYLPIS 240
           +LGGAIGAPHWGKIWLS+LNLY WEGVNPAPPE WLLPY LPIHPG+WWVHTR VY+P+ 
Sbjct: 199 KLGGAIGAPHWGKIWLSILNLYGWEGVNPAPPELWLLPYALPIHPGRWWVHTRAVYMPVG 258

Query: 241 YLSLVHYSCELTPLLEEIRGEIYTKPFDSIDFSKHRNTVCGVDLYYPHSKVLDMANNAII 300
           YLS   + CELTPLL+EIR EIYTK +D+IDFSKHRNTVCG+DLYYPH+K+LD+AN  ++
Sbjct: 259 YLSAKKFCCELTPLLKEIRTEIYTKEYDTIDFSKHRNTVCGIDLYYPHTKLLDVANWGMV 318

Query: 301 FYEKYLRPAWIYKKSKAKVYSLIQKEIQNTDYLCIAPVNQAFCALVTLIEEGVDSEAFTK 360
           FYEKYLRP W    +  KVY LI+KEI NTDYLCIAPVN AFCA+VTLIEEGVDS  F +
Sbjct: 319 FYEKYLRPNWFLNYTNKKVYELIKKEITNTDYLCIAPVNMAFCAVVTLIEEGVDSHEFNR 378

Query: 361 FRTRFKDALFHGPQGMTVMGTNGVQTWDCAFAVQYFFVAGLAERPEFYNFIVAAYRFLIR 420
           FR RFKD LFHGPQGMT+MGTNGVQ WDCAFAVQY F+A LAE PEF   IV AY+FL R
Sbjct: 379 FRDRFKDVLFHGPQGMTLMGTNGVQVWDCAFAVQYLFLAELAELPEFRGIIVKAYKFLCR 438

Query: 421 SQFDTECVPGSFRDKRKGSWGFSTKTQGYTVSDCTAEAIKAIIMVKNAPQFSDVHDEIED 480
           SQFDTEC PGSFRDKR G W FSTKTQGYTVSDCTAEA+KAIIMV+N+P F +  +EI D
Sbjct: 439 SQFDTECEPGSFRDKRVGGWPFSTKTQGYTVSDCTAEAVKAIIMVRNSPAFVEYRNEISD 498

Query: 481 SRLYEGIDVLLSLQNTGSFEYGSFATYEKIKAPLIMEKLNPAEVFGNIMIEYPYVECTDS 540
            RLY+ +D+LL+LQN GSFEYGSFA+YEKIKA  ++EKLNPAEVFGNIM+E+PYVECTDS
Sbjct: 499 ERLYKAMDILLNLQNVGSFEYGSFASYEKIKASTLIEKLNPAEVFGNIMVEFPYVECTDS 558

Query: 541 SVLGLTFFHKYYKYXXXXXXXXXXXXXXYLKRAQEPDGSWYGCWGICYTYAGMFALEALH 600
           SVLGLT+FHK+Y Y              Y+KR+Q  +GSWYG WG+C+TYAGMFALEAL+
Sbjct: 559 SVLGLTYFHKHYDYRKDDIAHAIKIAIDYIKRSQAKNGSWYGSWGVCFTYAGMFALEALY 618

Query: 601 SVEENYANSAIVRKGCDFLVSKQLIDGGWGESMKSSELHSYVSTPESLVVQTAWAVIALL 660
           +V ENY NS +VRKGCDFLVS+Q+ DGGWGES KSSELH+YVS+ +SLVVQTAW+VI LL
Sbjct: 619 TVGENYENSEVVRKGCDFLVSRQMEDGGWGESPKSSELHNYVSSEQSLVVQTAWSVIGLL 678

Query: 661 LAEYPDKKVIERGIELLRSRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGLYN 720
           LAEYPDKKVI+RGI+LL+SRQLPSGEWKFES+EGVFNHSC IEYPSY+FLFPIKALGLY 
Sbjct: 679 LAEYPDKKVIDRGIQLLKSRQLPSGEWKFESIEGVFNHSCMIEYPSYKFLFPIKALGLYA 738

Query: 721 KTYA 724
           K Y 
Sbjct: 739 KRYG 742

>ZYRO0D10164g Chr4 (854166..856364) [2199 bp, 732 aa] {ON} highly
           similar to uniprot|P38604 Saccharomyces cerevisiae
           YHR072W ERG7 Lanosterol synthase an essential enzyme
           that catalyzes the cyclization of squalene 2 3- epoxide
           a step in ergosterol biosynthesis
          Length = 732

 Score = 1102 bits (2850), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 510/725 (70%), Positives = 598/725 (82%), Gaps = 6/725 (0%)

Query: 6   LYSEQLGLPRTDPKRWRLRTDELGRETWDYIPEDQCEMDPQSSFTQWLLQIRDTETSAPK 65
           LYSE+L L RTDP  WRLR D+LGRE+W+YI ++  + DPQS + QWLLQ+      +PK
Sbjct: 4   LYSEELQLERTDPNLWRLRVDKLGRESWEYISKEDAKNDPQSKYVQWLLQLPSFPKPSPK 63

Query: 66  ------EPVTAFDSCINGANFFKSLQDPHSGMFPCQYKGPMFMTIGYIAVNYIAGIEIPK 119
                 +   A ++C NGA+F++ LQDP SG+FPCQYKGPMFMTIGY+ V+Y+AGIEIPK
Sbjct: 64  IHSGNAKKFNALEACKNGASFYQLLQDPDSGIFPCQYKGPMFMTIGYVVVHYVAGIEIPK 123

Query: 120 HERLEIIRYIVNTSHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLQRDHPVCLKARDTL 179
            +RLE+IRYIVNTSHPVDGGWGLHS DKSTVFGT +NYV LRLLGL RDHPVC+KAR TL
Sbjct: 124 PKRLEMIRYIVNTSHPVDGGWGLHSTDKSTVFGTAINYVNLRLLGLPRDHPVCVKARRTL 183

Query: 180 LRLGGAIGAPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYELPIHPGKWWVHTRGVYLPI 239
            +LGGA+GAPHWGKIWLSVLNLYKWEGVNPAPPETWLLPY LPIHPG+WWVHTR +YLP+
Sbjct: 184 HKLGGALGAPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYFLPIHPGRWWVHTRAIYLPV 243

Query: 240 SYLSLVHYSCELTPLLEEIRGEIYTKPFDSIDFSKHRNTVCGVDLYYPHSKVLDMANNAI 299
           SYLSL+ Y C LTPLL+E+R E+Y KPF+SIDF  +RNTVCGVDLYYPHSKVLD+ N+ +
Sbjct: 244 SYLSLIRYQCPLTPLLQELREELYVKPFNSIDFGSNRNTVCGVDLYYPHSKVLDLMNSVL 303

Query: 300 IFYEKYLRPAWIYKKSKAKVYSLIQKEIQNTDYLCIAPVNQAFCALVTLIEEGVDSEAFT 359
           +FYEK+LR  WI   +K +VY LI+KEI NTDYLCIAPVNQAFCALVTLIEEGV+S  F 
Sbjct: 304 VFYEKHLRFNWINTMAKNRVYGLIKKEIANTDYLCIAPVNQAFCALVTLIEEGVNSPQFK 363

Query: 360 KFRTRFKDALFHGPQGMTVMGTNGVQTWDCAFAVQYFFVAGLAERPEFYNFIVAAYRFLI 419
           +F+ RF DALFHGPQGMT+MGTNGVQTWDCAF +Q  F AGLAE+ ++Y  +V AY FL 
Sbjct: 364 RFQFRFNDALFHGPQGMTMMGTNGVQTWDCAFTIQSLFTAGLAEKEQYYETVVRAYEFLN 423

Query: 420 RSQFDTECVPGSFRDKRKGSWGFSTKTQGYTVSDCTAEAIKAIIMVKNAPQFSDVHDEIE 479
           R+QF  ECVPGSFRD RKG+WGFSTKTQGYTVSDCTAE+IKAIIMVK +P ++ VH  I+
Sbjct: 424 RAQFQDECVPGSFRDLRKGAWGFSTKTQGYTVSDCTAESIKAIIMVKKSPFYAKVHSLID 483

Query: 480 DSRLYEGIDVLLSLQNTGSFEYGSFATYEKIKAPLIMEKLNPAEVFGNIMIEYPYVECTD 539
           D RL + IDVLLSLQN G FEYGSFATYE IKAPL+MEKLNPAEVFGNIM+EYPYVECTD
Sbjct: 484 DERLCQAIDVLLSLQNVGPFEYGSFATYEMIKAPLLMEKLNPAEVFGNIMVEYPYVECTD 543

Query: 540 SSVLGLTFFHKYYKYXXXXXXXXXXXXXXYLKRAQEPDGSWYGCWGICYTYAGMFALEAL 599
           S+VLGLT FH Y  Y              Y+K+ Q  DGSWYGCWG+C+TYAGMFALEAL
Sbjct: 544 SAVLGLTSFHDYCDYRRDEISDRINIAVDYIKKCQNEDGSWYGCWGVCFTYAGMFALEAL 603

Query: 600 HSVEENYANSAIVRKGCDFLVSKQLIDGGWGESMKSSELHSYVSTPESLVVQTAWAVIAL 659
           HSV E+Y NS IV+KGCDFLV +Q+ DGGWGE+MKS ELH+YV + ES+VVQT+W +IAL
Sbjct: 604 HSVGEDYHNSKIVQKGCDFLVDRQMADGGWGETMKSCELHTYVESQESMVVQTSWVIIAL 663

Query: 660 LLAEYPDKKVIERGIELLRSRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGLY 719
           LL++YP+K VI+R ++ L +RQ  SGEWKF+ VEGVFNHSCAIEYP+YRF+FPIKALGLY
Sbjct: 664 LLSKYPNKSVIDRAVKFLETRQERSGEWKFDGVEGVFNHSCAIEYPNYRFIFPIKALGLY 723

Query: 720 NKTYA 724
              + 
Sbjct: 724 VNAFG 728

>KLLA0B10175g Chr2 (889538..891733) [2196 bp, 731 aa] {ON} highly
           similar to uniprot|P38604 Saccharomyces cerevisiae
           YHR072W ERG7 Lanosterol synthase an essential enzyme
           that catalyzes the cyclization of squalene 2 3- epoxide
           a step in ergosterol biosynthesis
          Length = 731

 Score = 1086 bits (2808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/724 (69%), Positives = 590/724 (81%), Gaps = 5/724 (0%)

Query: 6   LYSEQLGLPRTDPKRWRLRTDELGRETWDYIPEDQCEMDPQSSFTQWLLQIRD-----TE 60
           LYSE +GLPRTDPKRWRL TD+LGR+TW+Y+ E+  +  PQS+F +WLL+  D      E
Sbjct: 4   LYSETIGLPRTDPKRWRLITDDLGRQTWEYLSENDSKKVPQSTFARWLLKCEDFPEPHPE 63

Query: 61  TSAPKEPVTAFDSCINGANFFKSLQDPHSGMFPCQYKGPMFMTIGYIAVNYIAGIEIPKH 120
            ++     TA+++  NGA FF+ LQDP SG FPCQYKGPMFMTIGY+   YIA IEIP+H
Sbjct: 64  INSKTSGFTAWNAAHNGAKFFELLQDPDSGTFPCQYKGPMFMTIGYVVTMYIAKIEIPEH 123

Query: 121 ERLEIIRYIVNTSHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLQRDHPVCLKARDTLL 180
           E+ E+IRY+ N +HPVDGGWGLH VDKSTV GTVLNYV++RLLGL +DH VC++ARDTLL
Sbjct: 124 EKAEMIRYVANYAHPVDGGWGLHHVDKSTVLGTVLNYVMMRLLGLPKDHEVCVRARDTLL 183

Query: 181 RLGGAIGAPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYELPIHPGKWWVHTRGVYLPIS 240
           RLGGAI +PHW KIWLS+LNLYKWEGVNPAPPE W+LPY L IHP +WWVHTRG+YLP+S
Sbjct: 184 RLGGAIASPHWAKIWLSILNLYKWEGVNPAPPELWMLPYGLNIHPARWWVHTRGIYLPVS 243

Query: 241 YLSLVHYSCELTPLLEEIRGEIYTKPFDSIDFSKHRNTVCGVDLYYPHSKVLDMANNAII 300
           YLS   YSCEL PLLEEIR EIYT+PF++IDF KHRNTVCGVDLYYPH+KVLD  N  I 
Sbjct: 244 YLSSTQYSCELDPLLEEIRTEIYTQPFETIDFKKHRNTVCGVDLYYPHTKVLDTMNYFIS 303

Query: 301 FYEKYLRPAWIYKKSKAKVYSLIQKEIQNTDYLCIAPVNQAFCALVTLIEEGVDSEAFTK 360
            YE+Y+RP W+ KKS  +VY L++KEI NTDYLCIAPVN AFCA+VTLIEEG DSE F +
Sbjct: 304 KYERYVRPNWLLKKSTNRVYELVKKEIANTDYLCIAPVNNAFCAIVTLIEEGKDSEEFGR 363

Query: 361 FRTRFKDALFHGPQGMTVMGTNGVQTWDCAFAVQYFFVAGLAERPEFYNFIVAAYRFLIR 420
           F  RFKD LFHGPQG+TVMGTNGVQ WDCAF +QY F+AGLAE PEF+  IV +++FL R
Sbjct: 364 FLYRFKDVLFHGPQGLTVMGTNGVQVWDCAFYIQYMFMAGLAELPEFHETIVRSFKFLCR 423

Query: 421 SQFDTECVPGSFRDKRKGSWGFSTKTQGYTVSDCTAEAIKAIIMVKNAPQFSDVHDEIED 480
           SQF  +CV GSFRDKR G+W FSTKTQGYTVSDCTAEAIKAIIMV N+ ++ DV    + 
Sbjct: 424 SQFTEDCVEGSFRDKRLGAWPFSTKTQGYTVSDCTAEAIKAIIMVLNSDKYRDVWGVYDT 483

Query: 481 SRLYEGIDVLLSLQNTGSFEYGSFATYEKIKAPLIMEKLNPAEVFGNIMIEYPYVECTDS 540
            +L  GIDVLL LQN  SFEYGSFATYEKIKAPL+MEKLNPAEVFGNIM+E+PYVECTDS
Sbjct: 484 EKLKNGIDVLLGLQNLSSFEYGSFATYEKIKAPLLMEKLNPAEVFGNIMVEFPYVECTDS 543

Query: 541 SVLGLTFFHKYYKYXXXXXXXXXXXXXXYLKRAQEPDGSWYGCWGICYTYAGMFALEALH 600
           SVLGLT+F +Y+ Y              Y+K++Q+P+GSWYGCWGICYTYAGMFALEAL+
Sbjct: 544 SVLGLTYFRRYFNYRKKDIDHAIDSAIAYIKKSQQPNGSWYGCWGICYTYAGMFALEALN 603

Query: 601 SVEENYANSAIVRKGCDFLVSKQLIDGGWGESMKSSELHSYVSTPESLVVQTAWAVIALL 660
           ++ E Y NS +VRKGCDF V+KQL DGGW E MKSSELH+YVS  ES VVQTAW +I L+
Sbjct: 604 TIGETYENSEVVRKGCDFFVTKQLPDGGWSEKMKSSELHTYVSDKESYVVQTAWVLIGLI 663

Query: 661 LAEYPDKKVIERGIELLRSRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGLYN 720
           LA++PDK VI+R I LL+ RQ PSGEWK+E+VEGVFNHSCAIEYPSYRFLFPIKALGLY 
Sbjct: 664 LAKFPDKSVIDRAINLLKQRQQPSGEWKYEAVEGVFNHSCAIEYPSYRFLFPIKALGLYV 723

Query: 721 KTYA 724
           K Y 
Sbjct: 724 KEYG 727

>Kwal_34.15979 s34 complement(142874..145060) [2187 bp, 728 aa] {ON}
           YHR072W (ERG7) - 2,3-oxidosqualene-lanosterol cyclase
           [contig 272] FULL
          Length = 728

 Score = 1085 bits (2805), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/726 (70%), Positives = 595/726 (81%), Gaps = 10/726 (1%)

Query: 5   VLYSEQLGLPRTDPKRWRLRTDELGRETWDYIPEDQCEMDPQSSFTQWLLQIRDTETSAP 64
           +LYSE+LGLP+TD KRWRL+TD LG E W+Y+ E + +  PQS++ ++LLQ+ D E  AP
Sbjct: 1   MLYSEELGLPKTDSKRWRLKTDALGSEKWEYLSEIEAKQQPQSAYVKYLLQLPDFE--AP 58

Query: 65  KEPV-------TAFDSCINGANFFKSLQDPHSGMFPCQYKGPMFMTIGYIAVNYIAGIEI 117
           K  V       TA D+  NGA FF  LQ+  SG+FPCQYKGPMFMTIGY+A  Y A + I
Sbjct: 59  KPAVNKNSAHFTAKDAAFNGAQFFSLLQE-DSGIFPCQYKGPMFMTIGYVAALYCAEVPI 117

Query: 118 PKHERLEIIRYIVNTSHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLQRDHPVCLKARD 177
           P   + EIIRYIVN+SHPVDGGWGLH VDKST FGTV+NYVILRLLGL+ D+ VC +AR 
Sbjct: 118 PTPVKQEIIRYIVNSSHPVDGGWGLHEVDKSTTFGTVINYVILRLLGLKPDNIVCQRARR 177

Query: 178 TLLRLGGAIGAPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYELPIHPGKWWVHTRGVYL 237
           TL RLGGA+GAPHWGK WLS+LNLYKWEGVNPAPPE WLLPY LPIHPG+WWVHTR +Y 
Sbjct: 178 TLHRLGGAVGAPHWGKAWLSILNLYKWEGVNPAPPELWLLPYALPIHPGRWWVHTRAIYQ 237

Query: 238 PISYLSLVHYSCELTPLLEEIRGEIYTKPFDSIDFSKHRNTVCGVDLYYPHSKVLDMANN 297
            + YLS   YSC +TPLLEEIR EIYT+PF+SIDFSK +N VCGVDLYYPH+++L++AN 
Sbjct: 238 ALGYLSAAKYSCPVTPLLEEIRNEIYTQPFESIDFSKQKNNVCGVDLYYPHTRLLNIANA 297

Query: 298 AIIFYEKYLRPAWIYKKSKAKVYSLIQKEIQNTDYLCIAPVNQAFCALVTLIEEGVDSEA 357
           ++IFYEKYL+P W  K S  KVY LI+KEI+NTDYLCIAPV+ AFCA+VTLIEEG DS  
Sbjct: 298 SMIFYEKYLKPDWFLKYSNRKVYELIKKEIKNTDYLCIAPVSMAFCAIVTLIEEGRDSYE 357

Query: 358 FTKFRTRFKDALFHGPQGMTVMGTNGVQTWDCAFAVQYFFVAGLAERPEFYNFIVAAYRF 417
           F +F  RF+D LF GPQGMTVMGTNGVQ WDCAFA+QY+FVAGLAE PEF+  I  AY+F
Sbjct: 358 FKRFLERFEDVLFLGPQGMTVMGTNGVQVWDCAFAIQYYFVAGLAELPEFHETIEKAYKF 417

Query: 418 LIRSQFDTECVPGSFRDKRKGSWGFSTKTQGYTVSDCTAEAIKAIIMVKNAPQFSDVHDE 477
           L RSQFDTEC PGSFRDKR G+W FSTKTQGYTVSDCTAE++KAIIMV+N+P F+++ DE
Sbjct: 418 LCRSQFDTECEPGSFRDKRIGAWPFSTKTQGYTVSDCTAESVKAIIMVRNSPSFANLRDE 477

Query: 478 IEDSRLYEGIDVLLSLQNTGSFEYGSFATYEKIKAPLIMEKLNPAEVFGNIMIEYPYVEC 537
           I D RLY+ +DVLL+LQNTGSFEYGSFATYEKIKA   +EKLNPAEVFGNIM+E+PYVEC
Sbjct: 478 ISDERLYKAMDVLLALQNTGSFEYGSFATYEKIKATTKLEKLNPAEVFGNIMVEFPYVEC 537

Query: 538 TDSSVLGLTFFHKYYKYXXXXXXXXXXXXXXYLKRAQEPDGSWYGCWGICYTYAGMFALE 597
           TDSSVLGLT+F K+Y Y              Y+K AQ+PDGSWYGCWGIC+TYAGMFALE
Sbjct: 538 TDSSVLGLTYFSKHYTYRQEEIKKAIEIAIQYIKNAQKPDGSWYGCWGICFTYAGMFALE 597

Query: 598 ALHSVEENYANSAIVRKGCDFLVSKQLIDGGWGESMKSSELHSYVSTPESLVVQTAWAVI 657
           ALH+V+E Y NS +V+KGCDFLVSKQ  DGGW ESMKSSELHSYV +  S  VQTAWA+I
Sbjct: 598 ALHTVDETYENSEVVQKGCDFLVSKQRPDGGWSESMKSSELHSYVESANSQAVQTAWALI 657

Query: 658 ALLLAEYPDKKVIERGIELLRSRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG 717
            LLLAEYP+K++I++GI LL+ RQL SGEWKFE VEGVFNHSCAIEYPSY+FLFPIKALG
Sbjct: 658 GLLLAEYPNKEIIDKGINLLKKRQLESGEWKFEEVEGVFNHSCAIEYPSYKFLFPIKALG 717

Query: 718 LYNKTY 723
           LY K Y
Sbjct: 718 LYAKKY 723

>KLTH0H14850g Chr8 (1287375..1289555) [2181 bp, 726 aa] {ON} highly
           similar to uniprot|P38604 Saccharomyces cerevisiae
           YHR072W ERG7 Lanosterol synthase an essential enzyme
           that catalyzes the cyclization of squalene 2 3- epoxide
           a step in ergosterol biosynthesis
          Length = 726

 Score = 1071 bits (2770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/723 (69%), Positives = 585/723 (80%), Gaps = 6/723 (0%)

Query: 6   LYSEQLGLPRTDPKRWRLRTDELGRETWDYIPEDQCEMDPQSSFTQWLLQIRDTETSAPK 65
           LY+++LGLP TD   WRLRTDELG E W+Y+ E++ + DPQSS+ ++LLQ  D E   P 
Sbjct: 3   LYADELGLPTTDKTLWRLRTDELGSEKWEYLSEEEAKADPQSSYVKYLLQNPDFEAPEPL 62

Query: 66  -----EPVTAFDSCINGANFFKSLQDPHSGMFPCQYKGPMFMTIGYIAVNYIAGIEIPKH 120
                +  TA D+  NGA FF  LQ+  +G+FPCQYKGPMF+TIGY+A  Y A I +P+H
Sbjct: 63  RSSKCDEFTAGDAAFNGAQFFSLLQE-DTGIFPCQYKGPMFLTIGYVATLYCARIPVPEH 121

Query: 121 ERLEIIRYIVNTSHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLQRDHPVCLKARDTLL 180
            ++EIIRYIVN++HPVDGGWGLH VDKST FGT +NYVILRLLGL+ DH VC +AR TL 
Sbjct: 122 IKIEIIRYIVNSAHPVDGGWGLHEVDKSTTFGTAINYVILRLLGLEADHIVCQRARKTLH 181

Query: 181 RLGGAIGAPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYELPIHPGKWWVHTRGVYLPIS 240
           RLGGAIGAPHWGK WLS+LNLY+WEGVNPAPPE WLLPY LPIHPG+WWVHTR VY  + 
Sbjct: 182 RLGGAIGAPHWGKAWLSILNLYRWEGVNPAPPELWLLPYALPIHPGRWWVHTRAVYQALG 241

Query: 241 YLSLVHYSCELTPLLEEIRGEIYTKPFDSIDFSKHRNTVCGVDLYYPHSKVLDMANNAII 300
           YLS   Y CELTPLL+EIR EIY KPF+SIDFSKH+NTV GVDLYYPH+K+L++AN A+ 
Sbjct: 242 YLSAAKYCCELTPLLQEIRKEIYVKPFESIDFSKHKNTVGGVDLYYPHTKLLNIANVALT 301

Query: 301 FYEKYLRPAWIYKKSKAKVYSLIQKEIQNTDYLCIAPVNQAFCALVTLIEEGVDSEAFTK 360
            YE YL+P W  K S  KVY LI+KEI+NTDYLCIAPV+ AFCA+VTLIEEG DS  F +
Sbjct: 302 LYENYLKPNWFLKYSNRKVYELIKKEIKNTDYLCIAPVSMAFCAVVTLIEEGRDSYEFKR 361

Query: 361 FRTRFKDALFHGPQGMTVMGTNGVQTWDCAFAVQYFFVAGLAERPEFYNFIVAAYRFLIR 420
           F   F++ LF GPQGMTVMGTNGVQ WDCAFA+QY+FVAGLAE PEF + I  AY+FL R
Sbjct: 362 FVDGFQEVLFMGPQGMTVMGTNGVQVWDCAFAIQYYFVAGLAELPEFRDTIEKAYKFLCR 421

Query: 421 SQFDTECVPGSFRDKRKGSWGFSTKTQGYTVSDCTAEAIKAIIMVKNAPQFSDVHDEIED 480
           SQFDTEC PGSFRDKR G+W FSTKTQGYTVSDCTAEA+KAIIMV+N+P+F+ +  EI D
Sbjct: 422 SQFDTECEPGSFRDKRVGAWPFSTKTQGYTVSDCTAEAVKAIIMVRNSPKFTYLRGEISD 481

Query: 481 SRLYEGIDVLLSLQNTGSFEYGSFATYEKIKAPLIMEKLNPAEVFGNIMIEYPYVECTDS 540
            RLY+ +D+LL LQNTGSFEYGSFATYEKIKA   +EKLNPAEVFGNIM+E+PYVECTDS
Sbjct: 482 ERLYKAVDILLGLQNTGSFEYGSFATYEKIKATTALEKLNPAEVFGNIMVEFPYVECTDS 541

Query: 541 SVLGLTFFHKYYKYXXXXXXXXXXXXXXYLKRAQEPDGSWYGCWGICYTYAGMFALEALH 600
           SVLGLT+F KYY Y              Y+KR Q PDGSWYGCWG+C+TYAGMFALEAL+
Sbjct: 542 SVLGLTYFAKYYNYRKDEITKAIEIAIQYIKRVQNPDGSWYGCWGVCFTYAGMFALEALY 601

Query: 601 SVEENYANSAIVRKGCDFLVSKQLIDGGWGESMKSSELHSYVSTPESLVVQTAWAVIALL 660
           +V ENY NS +VRKGCDF  S+Q  DGGW ESMKSSELH+YV    S VVQTAWA+I LL
Sbjct: 602 TVGENYENSEVVRKGCDFFASRQRSDGGWSESMKSSELHTYVEADNSQVVQTAWALIGLL 661

Query: 661 LAEYPDKKVIERGIELLRSRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGLYN 720
           LA+YP++ VI+RGI LL+ RQLPSGEWKFE VEGVFNHSCAIEYPSY+FLFPIKALGLY+
Sbjct: 662 LAKYPNRDVIDRGIALLKKRQLPSGEWKFEDVEGVFNHSCAIEYPSYKFLFPIKALGLYS 721

Query: 721 KTY 723
           K Y
Sbjct: 722 KRY 724

>AGR351W Chr7 (1381502..1383691) [2190 bp, 729 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR072W (ERG7)
          Length = 729

 Score = 1015 bits (2624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/725 (64%), Positives = 570/725 (78%), Gaps = 5/725 (0%)

Query: 5   VLYSEQLGLPRTDPKRWRLRTDELGRETWDYIPEDQCEMDPQSSFTQWLLQIR-----DT 59
           +LYS++LGLP TD +RWRL  DE+G E W+Y+ E +    PQ++  QWLL +      + 
Sbjct: 1   MLYSDELGLPTTDSRRWRLFCDEVGAERWEYMDEQETSKVPQTTCVQWLLNVPSFPTPEP 60

Query: 60  ETSAPKEPVTAFDSCINGANFFKSLQDPHSGMFPCQYKGPMFMTIGYIAVNYIAGIEIPK 119
           E S+  +  TA ++  NGA F   LQD  SG FPC Y+GPMFMTIGY+   ++ G+ IP+
Sbjct: 61  EVSSKDQGFTAANAAYNGARFLGLLQDEASGTFPCSYRGPMFMTIGYVVAMHVGGVVIPE 120

Query: 120 HERLEIIRYIVNTSHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLQRDHPVCLKARDTL 179
            +R E++RY+VNT+HPVDGGWGLHS DKSTV GT LNYV+LRLLG++R+H V  +AR TL
Sbjct: 121 PQRRELVRYVVNTAHPVDGGWGLHSEDKSTVMGTALNYVLLRLLGMEREHIVMQRARKTL 180

Query: 180 LRLGGAIGAPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYELPIHPGKWWVHTRGVYLPI 239
           LR+GGAIG+P+WGK+WLSVLNLYKWEGVNPAPPE WLLPY+ P HP +WWVHTR ++LP+
Sbjct: 181 LRMGGAIGSPYWGKVWLSVLNLYKWEGVNPAPPELWLLPYQFPYHPARWWVHTRAIFLPM 240

Query: 240 SYLSLVHYSCELTPLLEEIRGEIYTKPFDSIDFSKHRNTVCGVDLYYPHSKVLDMANNAI 299
           SYL+ V Y C LTPLLEEIR EI+T+PF+ IDF+ +RN VCG+DLYYPH+ VL+  N  I
Sbjct: 241 SYLAGVRYQCALTPLLEEIRSEIFTRPFEEIDFAANRNNVCGIDLYYPHTTVLNTLNKCI 300

Query: 300 IFYEKYLRPAWIYKKSKAKVYSLIQKEIQNTDYLCIAPVNQAFCALVTLIEEGVDSEAFT 359
           + YEKYLRP W+ K S  ++Y LI+ EIQNTDYLCIAPVN A  A+VT IEEG DS  F 
Sbjct: 301 VGYEKYLRPNWLLKYSLNRIYELIKMEIQNTDYLCIAPVNNALNAIVTCIEEGPDSAEFG 360

Query: 360 KFRTRFKDALFHGPQGMTVMGTNGVQTWDCAFAVQYFFVAGLAERPEFYNFIVAAYRFLI 419
           +F  RFK+ LF GPQGM VMGTNGVQ WDCAF +Q  F A L ++PEFY  IV AYRFL 
Sbjct: 361 RFLDRFKEVLFLGPQGMLVMGTNGVQVWDCAFYIQSMFAANLQDKPEFYENIVRAYRFLC 420

Query: 420 RSQFDTECVPGSFRDKRKGSWGFSTKTQGYTVSDCTAEAIKAIIMVKNAPQFSDVHDEIE 479
           RSQ   +CVPGS+RD R G+W FSTKTQGY VSDCTAEA K++++V+N+P F +V DEI 
Sbjct: 421 RSQITDDCVPGSYRDPRIGAWPFSTKTQGYAVSDCTAEAAKSVLLVRNSPVFKEVRDEIS 480

Query: 480 DSRLYEGIDVLLSLQNTGSFEYGSFATYEKIKAPLIMEKLNPAEVFGNIMIEYPYVECTD 539
             +L + ID LL LQN GSF+YGSFA+YEKI+APL +E LN AEVF NIM+E+PYVECTD
Sbjct: 481 SEKLQKAIDALLGLQNLGSFKYGSFASYEKIRAPLSIESLNSAEVFANIMVEHPYVECTD 540

Query: 540 SSVLGLTFFHKYYKYXXXXXXXXXXXXXXYLKRAQEPDGSWYGCWGICYTYAGMFALEAL 599
           SSVLGL+F+ KY+ Y              ++K AQE DGSWYGCWGICYTYAGMFALEAL
Sbjct: 541 SSVLGLSFYRKYHDYRQDEVDHAIKIAVKFIKSAQEKDGSWYGCWGICYTYAGMFALEAL 600

Query: 600 HSVEENYANSAIVRKGCDFLVSKQLIDGGWGESMKSSELHSYVSTPESLVVQTAWAVIAL 659
           H+  E+YA+S +V+KGC+FLVSKQL DGGW E+MKSSELH+YVS   S VVQTAWA+I L
Sbjct: 601 HNAGESYADSEVVKKGCEFLVSKQLPDGGWSETMKSSELHTYVSDKRSYVVQTAWALIGL 660

Query: 660 LLAEYPDKKVIERGIELLRSRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGLY 719
           LLA+YPD+KVI+RGI+LL+ RQLPSGEWK+ES+EGVFNHSCAIEYPSYRF+FPIKALG+Y
Sbjct: 661 LLADYPDRKVIDRGIQLLKERQLPSGEWKYESIEGVFNHSCAIEYPSYRFVFPIKALGIY 720

Query: 720 NKTYA 724
           +K YA
Sbjct: 721 SKKYA 725

>Ecym_8182 Chr8 complement(379402..381600) [2199 bp, 732 aa] {ON}
           similar to Ashbya gossypii AGR351W
          Length = 732

 Score = 1008 bits (2607), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/727 (65%), Positives = 564/727 (77%), Gaps = 6/727 (0%)

Query: 4   IVLYSEQLGLPRTDPKRWRLRTDELGRETWDYIPEDQCEMDPQSSFTQWLLQIRDTETSA 63
           + LYS+ LGLP TDP RWRL    LG  +W YI E   +  PQ + T+WLL   +  T  
Sbjct: 2   VELYSDYLGLPSTDPSRWRLNCTSLGETSWKYISEADSKKIPQCNCTKWLLNADNFSTPE 61

Query: 64  PK-----EPVTAFDSCINGANFFKSLQDPHSGMFPCQYKGPMFMTIGYIAVNYIAGIEIP 118
           P          A+++  NGA+F K LQ+  SG FP QYKGPMFMTI Y+   Y+   EIP
Sbjct: 62  PDVGNGDANFKAYNAAYNGASFLKLLQNQDSGTFPNQYKGPMFMTICYVGSMYVGRKEIP 121

Query: 119 KHERLEIIRYIVNTSHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLQRDHPVCLKARDT 178
           + E++EIIRYIVNT+HPVDGGWGLH+  KSTVFGTVLNY++LRLLG+ +DH VC +AR T
Sbjct: 122 ECEKIEIIRYIVNTAHPVDGGWGLHTTGKSTVFGTVLNYIVLRLLGMSKDHVVCRRARST 181

Query: 179 LLRLGGAIGAPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYELPIHPGKWWVHTRGVYLP 238
           L RLGGAIGAPHWGKIWLS+LNLYKWEGVNPAP E W LPY +PIHP +WW+HTR +YLP
Sbjct: 182 LHRLGGAIGAPHWGKIWLSILNLYKWEGVNPAPAEFWTLPYIVPIHPARWWIHTRAIYLP 241

Query: 239 ISYLSLVHYSCELTPLLEEIRGEIYTKPFDSIDFSKHRNTVCGVDLYYPHSKVLDMANNA 298
           +SYL  + Y+CELTPLL+EIR EIYT  FD I FSKHRNTVC VDLY+PHS +L++ N+A
Sbjct: 242 MSYLCGISYACELTPLLQEIRNEIYTTNFDEIQFSKHRNTVCQVDLYFPHSTILNVINSA 301

Query: 299 IIFYEKYLRPAWIYKKSKAKVYSLIQKEIQNTDYLCIAPVNQAFCALVTLIEEGVDSEAF 358
           I++Y+ YLRP W+ K S  KVY LI+KEI NT+YLC+APV+ AFC++VT IEEG DS  F
Sbjct: 302 IVWYQNYLRPDWLVKYSNKKVYELIRKEIVNTEYLCVAPVSAAFCSIVTCIEEGADSPEF 361

Query: 359 TKFRTRFKDALFHGPQGMTVMGTNGVQTWDCAFAVQYFFVAGLAERPEFYNFIVAAYRFL 418
            +    F   +FHGPQGMTVMGTNG Q WDC+F VQY F+A LAE PEF + +  AY+FL
Sbjct: 362 ERLMEAFAGNVFHGPQGMTVMGTNGSQVWDCSFFVQYLFMANLAELPEFQDAVTNAYKFL 421

Query: 419 IRSQFDTECVPGSFRDKRKGSWGFSTKTQGYTVSDCTAEAIKAIIMVKNAPQFSDVHDEI 478
            RSQF  ECV GS+RDKR G W FSTKTQGYTVSDCTAEA+KA+IMVK +P F+ +HDEI
Sbjct: 422 CRSQFTHECVSGSYRDKRVGGWPFSTKTQGYTVSDCTAEALKAVIMVKRSPVFAAIHDEI 481

Query: 479 EDSRLYEGIDVLLSLQNTGSFEYGSFATYEKIKAPLIMEKLNPAEVFGNIMIEYPYVECT 538
            +  L + IDVLLSLQN GS EYGSFATYEKI+APLIMEKLNPAEVF NIM+EYPYVECT
Sbjct: 482 SEEALQKAIDVLLSLQNVGSIEYGSFATYEKIRAPLIMEKLNPAEVFENIMVEYPYVECT 541

Query: 539 DSSVLGLTFFHKYYKYXXXXXXXXXXXXXXYLKRAQEPDGSWYGCWGICYTYAGMFALEA 598
           DS +LGLT+F +YY Y              Y+K+ Q  DGSWYGCWGICYTYAGMFALEA
Sbjct: 542 DSCILGLTYFSEYYDYRKDDIDHSVKIAADYIKKVQGKDGSWYGCWGICYTYAGMFALEA 601

Query: 599 LHSVEENYANSAIVRKGCDFLVSKQLIDGGWGESMKSSELHSYVSTPE-SLVVQTAWAVI 657
           L+++ ENY NS +VR+GCDFLV KQL DGGW ES+KS+EL  Y++  + SLVV T+WA+I
Sbjct: 602 LYTIGENYENSEVVRRGCDFLVKKQLSDGGWSESIKSAELMCYINDDKGSLVVPTSWALI 661

Query: 658 ALLLAEYPDKKVIERGIELLRSRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG 717
            LLLA+YPDK+VI+RGI+LL+SRQL SGEWKFE +EG+FNHSCAIEYP+YRFLFPIKALG
Sbjct: 662 GLLLADYPDKEVIDRGIQLLKSRQLRSGEWKFEQIEGIFNHSCAIEYPTYRFLFPIKALG 721

Query: 718 LYNKTYA 724
           +Y K Y 
Sbjct: 722 IYAKKYG 728

>Kpol_416.8 s416 (31485..32195) [711 bp, 236 aa] {ON} (31485..32195)
           [711 nt, 237 aa]
          Length = 236

 Score = 33.5 bits (75), Expect = 1.6,   Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 421 SQFDTECVPGSFRDKRKGSWGFSTKTQGYTVSDCTAEAIKAIIMVKNAPQFSDVHD 476
           ++ + +  P S  DKRKG+ G+S +T+  ++S      IK +  VKN  +  ++ D
Sbjct: 56  NKINNKISPKSLNDKRKGNQGYSKRTKAKSISSDKNGGIKPV--VKNENKEREIDD 109

>NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {ON} 
          Length = 1107

 Score = 31.6 bits (70), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 1/54 (1%)

Query: 224  HPGKWWVHTRGVYLPISYLSLVHYSCELTPLLEEIRGEIYTKPFDSIDFSKHRN 277
            +P    + + G Y P +Y  L  Y  + TP L EI G++  +P D +  S H N
Sbjct: 1010 YPSFPSLKSDGTYTP-TYSPLAPYLKQGTPQLPEIEGQVKPQPQDQLPLSDHTN 1062

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.138    0.440 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 77,915,164
Number of extensions: 3353217
Number of successful extensions: 6627
Number of sequences better than 10.0: 23
Number of HSP's gapped: 6690
Number of HSP's successfully gapped: 23
Length of query: 729
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 612
Effective length of database: 40,065,477
Effective search space: 24520071924
Effective search space used: 24520071924
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 70 (31.6 bits)