Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0B042405.426ON1455145577190.0
NCAS0H020405.426ON1460146067070.0
NDAI0C016205.426ON1460146067060.0
KAFR0D050305.426ON1462146266290.0
TDEL0E019905.426ON1460146065880.0
Smik_15.2945.426ON1460146065730.0
Skud_15.2795.426ON1460146165310.0
YOR116C (RPO31)5.426ON1460146165270.0
Kpol_1016.95.426ON1460146065260.0
CAGL0L11660g5.426ON1459145765230.0
Suva_8.1695.426ON1460146165040.0
SAKL0G02354g5.426ON1458146164910.0
ZYRO0F09856g5.426ON1458146064490.0
KLTH0F16236g5.426ON1460146464380.0
TBLA0A037205.426ON1458146063630.0
AER252C5.426ON1459146363580.0
KLLA0E21253g5.426ON1457146063440.0
Ecym_55255.426ON1459146162950.0
TPHA0H017605.426ON1459145462910.0
Kwal_55.214595.426ON1148114550520.0
Ecym_80657.314ON1743149118700.0
ZYRO0F05918g7.314ON1744149818660.0
TPHA0A030707.314ON1719151018640.0
Suva_4.1047.314ON1733150318510.0
Smik_4.957.314ON1719149618450.0
ADR086C7.314ON1745149618460.0
TBLA0F021707.314ON1726150918410.0
KLLA0F05071g7.314ON1720149418410.0
YDL140C (RPO21)7.314ON1733149618410.0
Skud_4.1147.314ON1726149818340.0
KLTH0H02046g7.314ON1740150518310.0
SAKL0F10472g7.314ON1730150818250.0
Kwal_56.244897.314ON1728150018240.0
NDAI0A021307.314ON1729150618180.0
NCAS0A139007.314ON1716149617930.0
TDEL0C023207.314ON1727148317820.0
Kpol_162.1singletonON1311115816540.0
CAGL0I03828g7.314ON1715151616510.0
Kwal_55.21464singletonOFF32031213361e-172
KNAG0C039707.314ON172191614461e-172
KAFR0B010607.314ON168592514301e-170
CAGL0E05500g7.51ON164397111261e-128
Kwal_26.69797.51ON165497611091e-126
ZYRO0D04532g7.51ON166797711051e-125
KLLA0F23243g7.51ON165397511031e-125
YOR341W (RPA190)7.51ON166497511031e-125
TDEL0H040007.51ON166597410931e-123
Skud_15.5067.51ON166599810931e-123
Smik_15.5197.51ON166586710931e-123
TPHA0H028007.51ON1648104710911e-123
Suva_8.3917.51ON166586710901e-123
KNAG0D049707.51ON167190410891e-123
KLTH0D01628g7.51ON165497510861e-122
Kpol_1040.37.51ON165698610791e-122
KAFR0K005407.51ON166286510781e-121
NDAI0H012007.51ON166986810711e-120
TBLA0E019307.51ON165997310691e-120
NCAS0F007307.51ON167490610661e-120
ADR374C7.51ON164097010441e-117
SAKL0B10736g7.51ON165091210371e-116
Kpol_1019.277.314ON3642831913e-14
NCAS0I011603.346ON15561780.82
KLLA0D13068g5.359ON87756791.7
NCAS0F031705.405ON69589782.1
TPHA0H014405.359ON875136782.4
TDEL0A041305.550ON473116737.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0B04240
         (1455 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0B04240 Chr2 (806212..810579) [4368 bp, 1455 aa] {ON} Anc_5....  2977   0.0  
NCAS0H02040 Chr8 complement(393711..398093) [4383 bp, 1460 aa] {...  2588   0.0  
NDAI0C01620 Chr3 (346478..350860) [4383 bp, 1460 aa] {ON} Anc_5....  2587   0.0  
KAFR0D05030 Chr4 complement(988159..992547) [4389 bp, 1462 aa] {...  2558   0.0  
TDEL0E01990 Chr5 (373218..377600) [4383 bp, 1460 aa] {ON} Anc_5....  2542   0.0  
Smik_15.294 Chr15 complement(500962..505344) [4383 bp, 1460 aa] ...  2536   0.0  
Skud_15.279 Chr15 complement(496216..500598) [4383 bp, 1460 aa] ...  2520   0.0  
YOR116C Chr15 complement(539763..544145) [4383 bp, 1460 aa] {ON}...  2518   0.0  
Kpol_1016.9 s1016 (19972..24354) [4383 bp, 1460 aa] {ON} (19972....  2518   0.0  
CAGL0L11660g Chr12 (1245685..1250064) [4380 bp, 1459 aa] {ON} hi...  2517   0.0  
Suva_8.169 Chr8 complement(297556..301938) [4383 bp, 1460 aa] {O...  2509   0.0  
SAKL0G02354g Chr7 complement(193623..197999) [4377 bp, 1458 aa] ...  2504   0.0  
ZYRO0F09856g Chr6 complement(798821..803197) [4377 bp, 1458 aa] ...  2488   0.0  
KLTH0F16236g Chr6 (1316542..1320924) [4383 bp, 1460 aa] {ON} hig...  2484   0.0  
TBLA0A03720 Chr1 complement(929751..934127) [4377 bp, 1458 aa] {...  2455   0.0  
AER252C Chr5 complement(1101343..1105722) [4380 bp, 1459 aa] {ON...  2453   0.0  
KLLA0E21253g Chr5 (1896457..1900830) [4374 bp, 1457 aa] {ON} hig...  2448   0.0  
Ecym_5525 Chr5 complement(1063773..1068152) [4380 bp, 1459 aa] {...  2429   0.0  
TPHA0H01760 Chr8 complement(402254..406633) [4380 bp, 1459 aa] {...  2427   0.0  
Kwal_55.21459 s55 (846902..850348) [3447 bp, 1148 aa] {ON} YOR11...  1950   0.0  
Ecym_8065 Chr8 (139544..144775) [5232 bp, 1743 aa] {ON} similar ...   724   0.0  
ZYRO0F05918g Chr6 (487056..492290) [5235 bp, 1744 aa] {ON} highl...   723   0.0  
TPHA0A03070 Chr1 complement(671766..676925) [5160 bp, 1719 aa] {...   722   0.0  
Suva_4.104 Chr4 complement(193257..193711,193754..193782,194161....   717   0.0  
Smik_4.95 Chr4 complement(182198..187357) [5160 bp, 1719 aa] {ON...   715   0.0  
ADR086C Chr4 complement(860406..865643) [5238 bp, 1745 aa] {ON} ...   715   0.0  
TBLA0F02170 Chr6 (535350..540530) [5181 bp, 1726 aa] {ON} Anc_7....   713   0.0  
KLLA0F05071g Chr6 complement(496371..501533) [5163 bp, 1720 aa] ...   713   0.0  
YDL140C Chr4 complement(205360..210561) [5202 bp, 1733 aa] {ON} ...   713   0.0  
Skud_4.114 Chr4 complement(201053..206233) [5181 bp, 1726 aa] {O...   711   0.0  
KLTH0H02046g Chr8 complement(182788..188010) [5223 bp, 1740 aa] ...   709   0.0  
SAKL0F10472g Chr6 (808869..814061) [5193 bp, 1730 aa] {ON} highl...   707   0.0  
Kwal_56.24489 s56 (1018237..1023423) [5187 bp, 1728 aa] {ON} YDL...   707   0.0  
NDAI0A02130 Chr1 complement(477808..482997) [5190 bp, 1729 aa] {...   704   0.0  
NCAS0A13900 Chr1 (2728572..2733722) [5151 bp, 1716 aa] {ON} Anc_...   695   0.0  
TDEL0C02320 Chr3 complement(403851..409034) [5184 bp, 1727 aa] {...   691   0.0  
Kpol_162.1 s162 complement(211..4146) [3936 bp, 1311 aa] {ON} co...   641   0.0  
CAGL0I03828g Chr9 complement(328922..334069) [5148 bp, 1715 aa] ...   640   0.0  
Kwal_55.21464 s55 (850323..851285) [963 bp, 320 aa] {OFF} YOR116...   519   e-172
KNAG0C03970 Chr3 complement(778936..784101) [5166 bp, 1721 aa] {...   561   e-172
KAFR0B01060 Chr2 complement(197351..202408) [5058 bp, 1685 aa] {...   555   e-170
CAGL0E05500g Chr5 (539213..544144) [4932 bp, 1643 aa] {ON} highl...   438   e-128
Kwal_26.6979 s26 complement(150350..155314) [4965 bp, 1654 aa] {...   431   e-126
ZYRO0D04532g Chr4 (374177..379180) [5004 bp, 1667 aa] {ON} highl...   430   e-125
KLLA0F23243g Chr6 (2165407..2170368) [4962 bp, 1653 aa] {ON} hig...   429   e-125
YOR341W Chr15 (960987..965981) [4995 bp, 1664 aa] {ON}  RPA190RN...   429   e-125
TDEL0H04000 Chr8 (680730..685727) [4998 bp, 1665 aa] {ON} Anc_7....   425   e-123
Skud_15.506 Chr15 (901437..906434) [4998 bp, 1665 aa] {ON} YOR34...   425   e-123
Smik_15.519 Chr15 (910592..915589) [4998 bp, 1665 aa] {ON} YOR34...   425   e-123
TPHA0H02800 Chr8 (659254..664200) [4947 bp, 1648 aa] {ON} Anc_7....   424   e-123
Suva_8.391 Chr8 (702691..707688) [4998 bp, 1665 aa] {ON} YOR341W...   424   e-123
KNAG0D04970 Chr4 (905179..910194) [5016 bp, 1671 aa] {ON} Anc_7....   424   e-123
KLTH0D01628g Chr4 complement(157597..162561) [4965 bp, 1654 aa] ...   422   e-122
Kpol_1040.3 s1040 complement(6642..11612) [4971 bp, 1656 aa] {ON...   420   e-122
KAFR0K00540 Chr11 complement(114196..119184) [4989 bp, 1662 aa] ...   419   e-121
NDAI0H01200 Chr8 complement(280165..285174) [5010 bp, 1669 aa] {...   417   e-120
TBLA0E01930 Chr5 (468692..473671) [4980 bp, 1659 aa] {ON} Anc_7....   416   e-120
NCAS0F00730 Chr6 complement(143500..148524) [5025 bp, 1674 aa] {...   415   e-120
ADR374C Chr4 complement(1372609..1377531) [4923 bp, 1640 aa] {ON...   406   e-117
SAKL0B10736g Chr2 (925889..930841) [4953 bp, 1650 aa] {ON} highl...   404   e-116
Kpol_1019.27 s1019 complement(51067..52161) [1095 bp, 364 aa] {O...    78   3e-14
NCAS0I01160 Chr9 (209900..210367) [468 bp, 155 aa] {ON} Anc_3.346      35   0.82 
KLLA0D13068g Chr4 complement(1117229..1119862) [2634 bp, 877 aa]...    35   1.7  
NCAS0F03170 Chr6 complement(644614..646701) [2088 bp, 695 aa] {O...    35   2.1  
TPHA0H01440 Chr8 complement(322547..325174) [2628 bp, 875 aa] {O...    35   2.4  
TDEL0A04130 Chr1 complement(735166..736587) [1422 bp, 473 aa] {O...    33   7.6  

>KNAG0B04240 Chr2 (806212..810579) [4368 bp, 1455 aa] {ON} Anc_5.426
            YOR116C
          Length = 1455

 Score = 2977 bits (7719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1438/1455 (98%), Positives = 1438/1455 (98%)

Query: 1    MKEVVVGETQKKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGV 60
            MKEVVVGETQKKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGV
Sbjct: 1    MKEVVVGETQKKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGV 60

Query: 61   SSSSQECMTCHGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDR 120
            SSSSQECMTCHGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDR
Sbjct: 61   SSSSQECMTCHGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDR 120

Query: 121  RDFLKELRRPGIDNLRKMSILKKVIDQCKKQRRCLKCXXXXXXXXXXXXXXXXXSLKIIH 180
            RDFLKELRRPGIDNLRKMSILKKVIDQCKKQRRCLKC                 SLKIIH
Sbjct: 121  RDFLKELRRPGIDNLRKMSILKKVIDQCKKQRRCLKCGGLNGVVKKAAAGAGTASLKIIH 180

Query: 181  DTFRWVGKKMVPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCE 240
            DTFRWVGKKMVPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCE
Sbjct: 181  DTFRWVGKKMVPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCE 240

Query: 241  LLGINSTVRSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGINSTVRSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGINSTVRSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLAKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360
            AGLAKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK
Sbjct: 301  AGLAKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLI
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLI 420

Query: 421  INGPTVHPGANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSL 480
            INGPTVHPGANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  INGPTVHPGANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFDIPPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFDIPPPAIMKP 600

Query: 601  YYLWTGKQVFSLLIRPNKKSPVVINLDAKNKVYIPPKDKSFPNEMSINDGFVIIRGSEIL 660
            YYLWTGKQVFSLLIRPNKKSPVVINLDAKNKVYIPPKDKSFPNEMSINDGFVIIRGSEIL
Sbjct: 601  YYLWTGKQVFSLLIRPNKKSPVVINLDAKNKVYIPPKDKSFPNEMSINDGFVIIRGSEIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPS 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPS
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPS 720

Query: 721  SDLRDKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
            SDLRDKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV
Sbjct: 721  SDLRDKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840
            CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840

Query: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DDTVRTSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIV 960
            DDTVRTSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIV
Sbjct: 901  DDTVRTSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIV 960

Query: 961  RETDNVLKPLEEKLIRYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAARLA 1020
            RETDNVLKPLEEKLIRYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAARLA
Sbjct: 961  RETDNVLKPLEEKLIRYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAARLA 1020

Query: 1021 QIRNTRGLLEMTQNGGDTSMEVVSSELQASVDQVYKITKKNVNAFLTIALHKYHRAKVEP 1080
            QIRNTRGLLEMTQNGGDTSMEVVSSELQASVDQVYKITKKNVNAFLTIALHKYHRAKVEP
Sbjct: 1021 QIRNTRGLLEMTQNGGDTSMEVVSSELQASVDQVYKITKKNVNAFLTIALHKYHRAKVEP 1080

Query: 1081 GTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVL 1140
            GTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVL
Sbjct: 1081 GTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVL 1140

Query: 1141 VNEGDERAARVVKGRIEKTLLSDLAFYIQDVYRGNMSYLEIRVDLATIEKLQLELTMEDI 1200
            VNEGDERAARVVKGRIEKTLLSDLAFYIQDVYRGNMSYLEIRVDLATIEKLQLELTMEDI
Sbjct: 1141 VNEGDERAARVVKGRIEKTLLSDLAFYIQDVYRGNMSYLEIRVDLATIEKLQLELTMEDI 1200

Query: 1201 AVALSRAPKLKIQTTDIHILGKDKIHVNVYPEGMKAKSISTSAKEPSENEVFYKMQTLRR 1260
            AVALSRAPKLKIQTTDIHILGKDKIHVNVYPEGMKAKSISTSAKEPSENEVFYKMQTLRR
Sbjct: 1201 AVALSRAPKLKIQTTDIHILGKDKIHVNVYPEGMKAKSISTSAKEPSENEVFYKMQTLRR 1260

Query: 1261 SLPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTITNHVLEVNSV 1320
            SLPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTITNHVLEVNSV
Sbjct: 1261 SLPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTITNHVLEVNSV 1320

Query: 1321 LGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQ 1380
            LGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQ
Sbjct: 1321 LGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQ 1380

Query: 1381 LASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVVKYNDVSERDLKVRP 1440
            LASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVVKYNDVSERDLKVRP
Sbjct: 1381 LASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVVKYNDVSERDLKVRP 1440

Query: 1441 TLFESLASETAIKAN 1455
            TLFESLASETAIKAN
Sbjct: 1441 TLFESLASETAIKAN 1455

>NCAS0H02040 Chr8 complement(393711..398093) [4383 bp, 1460 aa] {ON}
            Anc_5.426
          Length = 1460

 Score = 2588 bits (6707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1230/1460 (84%), Positives = 1341/1460 (91%), Gaps = 5/1460 (0%)

Query: 1    MKEVVVGETQKKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGV 60
            MKEVVV E  K+ISG+EFSAL+AADIVAQSE+E+++RDLFDLEKGRE K GGALDR+MGV
Sbjct: 1    MKEVVVSENPKRISGLEFSALSAADIVAQSEIEVSSRDLFDLEKGREPKIGGALDRKMGV 60

Query: 61   SSSSQECMTCHGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDR 120
            SSSS EC TCHGNLASCHGHFGHIKLALPVFHVGYFK+TIQILQ +CK CSA+LL+D+D+
Sbjct: 61   SSSSLECETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKTCSAILLNDQDK 120

Query: 121  RDFLKELRRPGIDNLRKMSILKKVIDQCKKQRRCLKCXXXXXXXXXXXXXXXXXSLKIIH 180
            R FL ELRRPG+DNLR+M ILKKV+DQCKKQRRCL+C                 SLKIIH
Sbjct: 121  RQFLTELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCGALNGVVKKAAAGAGPASLKIIH 180

Query: 181  DTFRWVGKKMVPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCE 240
            DTFRWVGKK  PEKD+W+G+W E+L+HHPELERF+KRCSDDLNPLKTL LFKQ+K EDCE
Sbjct: 181  DTFRWVGKKSAPEKDKWVGDWKEVLSHHPELERFMKRCSDDLNPLKTLNLFKQIKPEDCE 240

Query: 241  LLGINSTVRSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGI+STV+SGRPETYIWRYLPAPPVCIRPSV MQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLAKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360
            AGL KGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAKVLTFPEKVTRYNK+KLQQLI
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKQKLQQLI 420

Query: 421  INGPTVHPGANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSL 480
            INGP VHPGANYLLKKNE+ARRNLRYGD++KLAKNLQ+GDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  INGPNVHPGANYLLKKNEDARRNLRYGDRIKLAKNLQHGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFD  +LTQLLSMMS+  L+FDIPPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSNGTLRFDIPPPAIMKP 600

Query: 601  YYLWTGKQVFSLLIRPNKKSPVVINLDAKNKVYIPPKDKSFPNEMSINDGFVIIRGSEIL 660
            YY+WTGKQVFSLLIRPNK+SPVVINLDAKNKV++PPK K +PNEMS NDG+V+IRGS IL
Sbjct: 601  YYMWTGKQVFSLLIRPNKESPVVINLDAKNKVFMPPKYKDYPNEMSRNDGYVVIRGSNIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPS 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAAN MNRM+KLCARYLGNRGFSIGISDVTP+
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARYLGNRGFSIGISDVTPA 720

Query: 721  SDLRDKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
             DL+ KKEE+V  AYAKCDELID F  GKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV
Sbjct: 721  DDLKQKKEELVEIAYAKCDELIDQFHKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840
            CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840

Query: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DDTVRTSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIV 960
            D+TVRTS+NGIVQFTYGGDGLDP++MEGNAKPVNF RSWDHA NITF+  E GLLPYEI+
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAKPVNFNRSWDHAINITFSNLEKGLLPYEIM 960

Query: 961  RETDNVLKPLEEKLIRYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAARLA 1020
             +T+ +LKPLEE+LIRYDN+G +VPK+  +   Y D+ DAER FY+SLR Y+QEKA  LA
Sbjct: 961  EKTNEILKPLEERLIRYDNVGELVPKKDNEKAEYVDQFDAERDFYRSLRDYIQEKADILA 1020

Query: 1021 QIRNTRGLLEMTQNGGDTSM-----EVVSSELQASVDQVYKITKKNVNAFLTIALHKYHR 1075
            ++R +RG+LEM+   G+        E ++  ++ SVDQ+YKIT+K+V  FL IAL+KY +
Sbjct: 1021 RVRKSRGMLEMSSEPGEELRKLDPDERITESIKHSVDQLYKITEKSVQTFLEIALYKYRK 1080

Query: 1076 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1135
            A+VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1136 INAVLVNEGDERAARVVKGRIEKTLLSDLAFYIQDVYRGNMSYLEIRVDLATIEKLQLEL 1195
            INAVLVNE DERAARVVKGRIEKTLLSD+A+YIQDVY+ N+S++++RVDL TIEKLQLEL
Sbjct: 1141 INAVLVNENDERAARVVKGRIEKTLLSDIAYYIQDVYKDNLSFIQVRVDLGTIEKLQLEL 1200

Query: 1196 TMEDIAVALSRAPKLKIQTTDIHILGKDKIHVNVYPEGMKAKSISTSAKEPSENEVFYKM 1255
            T+EDIAVA+++APKLKIQT+D++ILGKDKI +NVYP+G KAKSIST AKEPS N VFY+M
Sbjct: 1201 TIEDIAVAITKAPKLKIQTSDVNILGKDKIAINVYPDGYKAKSISTMAKEPSNNAVFYRM 1260

Query: 1256 QTLRRSLPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTITNHVL 1315
            Q LRR LP +VVKG  DISRAVINIRDDGKRELLVEGYGLR+VMCTDGVIG KT TNH+L
Sbjct: 1261 QHLRRVLPSIVVKGFGDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGMKTTTNHIL 1320

Query: 1316 EVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1375
            EVN+VLGIEAAR+SI+GEIDYTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKMR
Sbjct: 1321 EVNNVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1380

Query: 1376 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVVKYNDVSERD 1435
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMS+GTGSFKVVK  ++SE D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEAD 1440

Query: 1436 LKVRPTLFESLASETAIKAN 1455
            LK +PTLFE L++    K N
Sbjct: 1441 LKPKPTLFEKLSNCGTHKLN 1460

>NDAI0C01620 Chr3 (346478..350860) [4383 bp, 1460 aa] {ON} Anc_5.426
          Length = 1460

 Score = 2587 bits (6706), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1234/1460 (84%), Positives = 1334/1460 (91%), Gaps = 5/1460 (0%)

Query: 1    MKEVVVGETQKKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGV 60
            MKEVVV E  K+ISG+EFSAL+AADIVAQSEVEI++RDLFDLEKGRE KTGGALD+RMGV
Sbjct: 1    MKEVVVSENPKRISGLEFSALSAADIVAQSEVEISSRDLFDLEKGREPKTGGALDKRMGV 60

Query: 61   SSSSQECMTCHGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDR 120
            SSSS EC TCHGNLASCHGHFGHIKLALPVFHVGYFK+TIQILQ ICK CSA+LLSDKDR
Sbjct: 61   SSSSLECETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSDKDR 120

Query: 121  RDFLKELRRPGIDNLRKMSILKKVIDQCKKQRRCLKCXXXXXXXXXXXXXXXXXSLKIIH 180
            R FL ELRRPG+DNLR+M ILKKV+DQCKKQRRCL+C                 SLKIIH
Sbjct: 121  RQFLNELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCGALNGVVKKAAAGAGSASLKIIH 180

Query: 181  DTFRWVGKKMVPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCE 240
            D FRWVGKK  PEKD+W+G+W E+L+HHPELERFVKRCSDDLNPLKTL LFKQ+K EDCE
Sbjct: 181  DNFRWVGKKSAPEKDKWVGDWKEVLSHHPELERFVKRCSDDLNPLKTLNLFKQIKPEDCE 240

Query: 241  LLGINSTVRSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLG+NSTV+SGRPETYIWRYLPAPPVCIRPSV MQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGVNSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLAKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360
            AGL KGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAKVLTFPEKVTRYN++KLQQLI
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNRQKLQQLI 420

Query: 421  INGPTVHPGANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSL 480
            INGP VHPGANYLLK NE+ARRNLRYGD++KLAKNLQ+GDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  INGPNVHPGANYLLKNNEDARRNLRYGDRVKLAKNLQFGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFD  +LTQLLSMM DA LQFDIPPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMCDANLQFDIPPPAIMKP 600

Query: 601  YYLWTGKQVFSLLIRPNKKSPVVINLDAKNKVYIPPKDKSFPNEMSINDGFVIIRGSEIL 660
            +YLWTGKQ+FSLLI+PNK SPVVINLDAKNKVYIPPK K++PNEMS NDG+VIIRGS+IL
Sbjct: 601  HYLWTGKQLFSLLIKPNKDSPVVINLDAKNKVYIPPKTKAYPNEMSRNDGYVIIRGSQIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPS 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAA  MNRMAKLCAR+LGNRGFSIGISDVTP+
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAATAMNRMAKLCARFLGNRGFSIGISDVTPA 720

Query: 721  SDLRDKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
             DL+ KKEE+V  AYAKCDELID F  GKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV
Sbjct: 721  DDLKQKKEELVEIAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840
            CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840

Query: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DDTVRTSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIV 960
            D+TVRTS+NGIVQFTYGGDGLDP++MEGNAKPVNF RSWDHA NITF+ ++ GLLPY+I+
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAKPVNFNRSWDHATNITFSPDQHGLLPYQIM 960

Query: 961  RETDNVLKPLEEKLIRYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAARLA 1020
              T+ +LKPLE++LIRYDNLG +VP E      Y D+ DAER FYKSLR YM EKA  L 
Sbjct: 961  ETTNAILKPLEDRLIRYDNLGEIVPNEDSTKAEYVDQFDAERDFYKSLRDYMDEKAKVLG 1020

Query: 1021 QIRNTRGLLEMTQNGGD-----TSMEVVSSELQASVDQVYKITKKNVNAFLTIALHKYHR 1075
             +R +RG+L M     +        E V   ++ SVDQ+YKIT+  V  FL IAL+KY +
Sbjct: 1021 SVRKSRGMLPMVDEPAEELKKMNPDEQVPETIRYSVDQLYKITEDLVKKFLEIALYKYRK 1080

Query: 1076 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1135
            A+VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1136 INAVLVNEGDERAARVVKGRIEKTLLSDLAFYIQDVYRGNMSYLEIRVDLATIEKLQLEL 1195
            INAVLVNE DERAARVVKGRIEKTLLSD+A+YIQDVY+ N+S++++R+DL TIEKLQLEL
Sbjct: 1141 INAVLVNENDERAARVVKGRIEKTLLSDVAYYIQDVYKDNLSFIQVRIDLNTIEKLQLEL 1200

Query: 1196 TMEDIAVALSRAPKLKIQTTDIHILGKDKIHVNVYPEGMKAKSISTSAKEPSENEVFYKM 1255
            T+EDIAVAL+RAPKLKI T+D++I+GKDKI +NV+PEG KAKSIST+AKEP+EN VFY+M
Sbjct: 1201 TIEDIAVALTRAPKLKILTSDVNIIGKDKIAINVFPEGYKAKSISTAAKEPTENAVFYRM 1260

Query: 1256 QTLRRSLPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTITNHVL 1315
            Q LRR+LP +VVKGLP+I+RAVINIRDDGKRELLVEGYGLR+VMCTDGVIG KT TNH+L
Sbjct: 1261 QHLRRALPSIVVKGLPEIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGMKTTTNHIL 1320

Query: 1316 EVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1375
            EVN+VLGIEAAR+SIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1321 EVNTVLGIEAARSSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1376 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVVKYNDVSERD 1435
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMS+GTGSFKVVK  ++++  
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTEIAKES 1440

Query: 1436 LKVRPTLFESLASETAIKAN 1455
            LK +PTLFE+L S  +IK N
Sbjct: 1441 LKPKPTLFENLTSSRSIKMN 1460

>KAFR0D05030 Chr4 complement(988159..992547) [4389 bp, 1462 aa] {ON}
            Anc_5.426 YOR116C
          Length = 1462

 Score = 2558 bits (6629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1220/1462 (83%), Positives = 1330/1462 (90%), Gaps = 7/1462 (0%)

Query: 1    MKEVVVGETQKKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGV 60
            MKEVV+ E  KKISGIEFSAL+A+DIVAQSEVEI++RDLFDLE+ R+QK  GALD RMGV
Sbjct: 1    MKEVVISEAPKKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGV 60

Query: 61   SSSSQECMTCHGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDR 120
            SSSS  C TCHGNLASCHGHFGHIKLALPVFHVGYFK+TIQILQ ICK+CS+VLLSD+D+
Sbjct: 61   SSSSLTCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDK 120

Query: 121  RDFLKELRRPG-IDNLRKMSILKKVIDQCKKQRRCLKCXXXXXXXXXXXXXXXXXSLKII 179
            + +L ELR  G IDNL+KM ILKKV+DQCKKQRRCL C                 SLKII
Sbjct: 121  KKYLHELRTSGRIDNLKKMGILKKVMDQCKKQRRCLHCGALNGVVKKAAAGSGTASLKII 180

Query: 180  HDTFRWVGKKMVPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDC 239
            HDTFRWVGKK  PEKD WIG+WNE+L+HHPELERFVKRC+DDLNPLKTL LFKQ++ EDC
Sbjct: 181  HDTFRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDC 240

Query: 240  ELLGINSTVRSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLI 299
            ELLGI+STV+SGRPETYIWRYLPAPPVCIRPSV MQDSPASNEDDLT+KLTEIVWTSSLI
Sbjct: 241  ELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLI 300

Query: 300  KAGLAKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKG 359
            KAGL KGISINNMMEHWDYLQLTVAMYIN+DSVNPAMLPGASSGGGKVKPIRGFCQRLKG
Sbjct: 301  KAGLEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKG 360

Query: 360  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQL 419
            KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAKVLT+PEKVTRYN++KLQ+L
Sbjct: 361  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQEL 420

Query: 420  IINGPTVHPGANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPS 479
            ++NGP +HPGANYLLKKNEEARRNLRYGD+LKLAKNLQYGD+VERHLEDGDVVLFNRQPS
Sbjct: 421  VMNGPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPS 480

Query: 480  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 539
            LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN
Sbjct: 481  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 540

Query: 540  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFDIPPPAIMK 599
            NLLTPKSGEPIIAATQDFITGSYLISHKDSFFD  + TQLLSMMSD  LQFDIPPPAIMK
Sbjct: 541  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPAIMK 600

Query: 600  PYYLWTGKQVFSLLIRPNKKSPVVINLDAKNKVYIPPKDKSFPNEMSINDGFVIIRGSEI 659
            PYYLWTGKQ+FSLLI+PN KSPVVINLDAKNKVYIPPK KS PNEMS NDGFVIIRGS I
Sbjct: 601  PYYLWTGKQLFSLLIKPNHKSPVVINLDAKNKVYIPPKSKSLPNEMSRNDGFVIIRGSNI 660

Query: 660  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTP 719
            LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAAN MNRM+KLCAR+LGNRGFSIGISDVTP
Sbjct: 661  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVTP 720

Query: 720  SSDLRDKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGD 779
            + DL+ KKEE+V  AYAKCD+LID +  GKLETQPGCNEE+TLEAKIGGLLSKVREEVGD
Sbjct: 721  ADDLKIKKEELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVGD 780

Query: 780  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNS 839
            VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNS
Sbjct: 781  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 840

Query: 840  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 899
            KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ
Sbjct: 841  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 900

Query: 900  YDDTVRTSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEI 959
            YD+TVRTS+NGIVQFTYGGDGLDP++MEG+A+PVNF RSWDHA NITFN NE GLLPY++
Sbjct: 901  YDNTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPVNFNRSWDHALNITFNNNERGLLPYQV 960

Query: 960  VRETDNVLKPLEEKLIRYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAARL 1019
            +++T+ VL PLEE+L+RYDNLG  V KE +D   YAD+ DAER FYK+LR Y+Q K+  L
Sbjct: 961  MKKTNEVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYIQSKSDHL 1020

Query: 1020 AQIRNTRGLLEMTQNGGDTSMEVVSSEL-----QASVDQVYKITKKNVNAFLTIALHKYH 1074
            A +R +RGLLE+    G+    +   E      ++SVDQ+ KIT+K V  FL IAL KY 
Sbjct: 1021 AHVRKSRGLLELLSEPGEELQSLHPDERATDVSRSSVDQLCKITEKAVLKFLEIALSKYR 1080

Query: 1075 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1134
            +A+VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTP
Sbjct: 1081 KARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTP 1140

Query: 1135 IINAVLVNEGDERAARVVKGRIEKTLLSDLAFYIQDVYRGNMSYLEIRVDLATIEKLQLE 1194
            IINAVLVN  DERAARVVKGR+EKT+LSD+A+YIQDVY+ N+S+L+IR+DL TIEKLQLE
Sbjct: 1141 IINAVLVNNNDERAARVVKGRVEKTMLSDVAYYIQDVYKDNLSFLQIRIDLNTIEKLQLE 1200

Query: 1195 LTMEDIAVALSRAPKLKIQTTDIHILGKDKIHVNVYPEGMKAKSISTSAKEPSENEVFYK 1254
            LT+EDIAVAL++APKLKIQ +D+ I G DK+ VNV+PEG K+KSISTSAK+PSEN+VFY+
Sbjct: 1201 LTIEDIAVALTKAPKLKIQASDVSIAGDDKVIVNVFPEGSKSKSISTSAKDPSENDVFYR 1260

Query: 1255 MQTLRRSLPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTITNHV 1314
            MQ LRR+LP +VVKGLP+I+RAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKT+TNHV
Sbjct: 1261 MQQLRRALPHIVVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVTNHV 1320

Query: 1315 LEVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1374
            LEV+SVLGIEAAR+SI+GEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM
Sbjct: 1321 LEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1380

Query: 1375 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVVKYNDVSER 1434
            RDSVLQLASFEKTTDHLFDAAFYMKKD VEGVSECIILGQTMS+GTGSFKVVK  D+   
Sbjct: 1381 RDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVVKGTDIKPE 1440

Query: 1435 DLKVRPTLFESLASETA-IKAN 1455
            DLK +PTLFESL+S ++ IK N
Sbjct: 1441 DLKPKPTLFESLSSASSNIKLN 1462

>TDEL0E01990 Chr5 (373218..377600) [4383 bp, 1460 aa] {ON} Anc_5.426
            YOR116C
          Length = 1460

 Score = 2542 bits (6588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1214/1460 (83%), Positives = 1322/1460 (90%), Gaps = 5/1460 (0%)

Query: 1    MKEVVVGETQKKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGV 60
            MKEVVV  T K+ISG+EFSAL+AADIVAQSEVEI+TRDLFDLE GR  + GGALD +MGV
Sbjct: 1    MKEVVVSATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGV 60

Query: 61   SSSSQECMTCHGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDR 120
            SSSS EC TCHGNLASCHGHFGHIKLALPVFHVGYFK+TIQILQ ICK+CSAVLL D DR
Sbjct: 61   SSSSLECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDR 120

Query: 121  RDFLKELRRPGIDNLRKMSILKKVIDQCKKQRRCLKCXXXXXXXXXXXXXXXXXSLKIIH 180
            R FL ELRRPG+DNLR+M IL KV+DQCKKQRRCL+C                 SLKIIH
Sbjct: 121  RHFLSELRRPGVDNLRRMGILSKVLDQCKKQRRCLQCGALNGVVKKAAAGSGSASLKIIH 180

Query: 181  DTFRWVGKKMVPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCE 240
            DTFRW GKK VPEKD+W+G+W+E+L+H+PELER+VKRC DDLNPLKTL LFKQLK EDCE
Sbjct: 181  DTFRWAGKKSVPEKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCE 240

Query: 241  LLGINSTVRSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGI+S+ +SGRPETYIWRYLPAPPVCIRPSV MQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLAKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360
            +GL KGISINNMMEHWDYLQL+VAMYINSDSVNPAM+PGASSGGGKVKPIRGFCQRLKGK
Sbjct: 301  SGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAKVLT+PEKVTRYN++KLQQL+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLL 420

Query: 421  INGPTVHPGANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSL 480
            INGP VHPGANYLLKK+E+ARRNLRYGD++KLAKNL+ GDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  INGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFD GSLTQLLSMMSD  LQFDIP PAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMKP 600

Query: 601  YYLWTGKQVFSLLIRPNKKSPVVINLDAKNKVYIPPKDKSFPNEMSINDGFVIIRGSEIL 660
             YLWTGKQVFSLLI+PNKKSPVVINLDAKNKV+IPPK KS P+EMS NDG+VIIRGSEIL
Sbjct: 601  CYLWTGKQVFSLLIKPNKKSPVVINLDAKNKVFIPPKSKSLPSEMSQNDGYVIIRGSEIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPS 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAAN MNRMAKLCARYLGNRGFSIGISDVTP+
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPA 720

Query: 721  SDLRDKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
             DL+ KKE+MV FAYAKCDELID +  GKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV
Sbjct: 721  DDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840
            CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DDTVRTSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIV 960
            D+TVRTS+NGIVQFTYGGDGLDP++MEGNA+PVNF+RSW+HA N+TFN  E GL PY+I 
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIE 960

Query: 961  RETDNVLKPLEEKLIRYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAARLA 1020
             ETD +L PL  +LIRYDN+G +VPKE      Y D++DAER FY SL+ +M+ KA  LA
Sbjct: 961  EETDKILAPLMNRLIRYDNVGKLVPKEKDALIEYIDQNDAERNFYLSLKSFMRGKAELLA 1020

Query: 1021 QIRNTRGLLEMTQNGGDTSMEV-----VSSELQASVDQVYKITKKNVNAFLTIALHKYHR 1075
             +R  RG+ E+    G     +     V   ++ SVDQ+ +IT  +V  FL IA+ KY R
Sbjct: 1021 SVRKQRGMKELLDEPGPEFKNIDFDEDVPENIRHSVDQLCRITGDSVREFLKIAISKYRR 1080

Query: 1076 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1135
            A+VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1136 INAVLVNEGDERAARVVKGRIEKTLLSDLAFYIQDVYRGNMSYLEIRVDLATIEKLQLEL 1195
            INAVLVN+ DERAARVVKGRIEKTLLSD+AFYIQDVY+ N+S++++R+DL TI+KLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRIEKTLLSDVAFYIQDVYQDNLSFMQVRIDLNTIDKLQLEL 1200

Query: 1196 TMEDIAVALSRAPKLKIQTTDIHILGKDKIHVNVYPEGMKAKSISTSAKEPSENEVFYKM 1255
            T+EDIAVA++RAPKLKIQ +D+ IL KDKI +NV+PEG KAKSISTSAKEP EN+VF++M
Sbjct: 1201 TIEDIAVAITRAPKLKIQASDVTILDKDKIAINVFPEGYKAKSISTSAKEPHENDVFFRM 1260

Query: 1256 QTLRRSLPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTITNHVL 1315
            Q LRRSLP +VVKGLPDISRAVIN+RDD KRELLVEGYGLR+VM TDGV+G KT TNH+L
Sbjct: 1261 QQLRRSLPGIVVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVGHKTATNHIL 1320

Query: 1316 EVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1375
            EV SVLGIEAARASI+GEIDYTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1380

Query: 1376 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVVKYNDVSERD 1435
            DSVLQLASFEKTTDHLFDAAFYMK+DAVEGVSECIILGQTMS+GTG+FKV+K  D+ E+D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVIKGTDLHEQD 1440

Query: 1436 LKVRPTLFESLASETAIKAN 1455
            L+ +PTLFESL+ ETAIKAN
Sbjct: 1441 LRPKPTLFESLSKETAIKAN 1460

>Smik_15.294 Chr15 complement(500962..505344) [4383 bp, 1460 aa] {ON}
            YOR116C (REAL)
          Length = 1460

 Score = 2536 bits (6573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1203/1460 (82%), Positives = 1329/1460 (91%), Gaps = 5/1460 (0%)

Query: 1    MKEVVVGETQKKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGV 60
            MKEVVV ET K+I G+EFSAL+AADIVAQSEVE++TRDLFDLEK R  K  GALD +MGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60

Query: 61   SSSSQECMTCHGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDR 120
            SSSS EC TCHGNLASCHGHFGH+KLALPVFH+GYFK+TIQILQ ICK+CSA+LLS+ D+
Sbjct: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120

Query: 121  RDFLKELRRPGIDNLRKMSILKKVIDQCKKQRRCLKCXXXXXXXXXXXXXXXXXSLKIIH 180
            R FL+ELRRPG+DNLR+M ILKK++DQCKKQRRCL C                 +LKIIH
Sbjct: 121  RHFLQELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWVGKKMVPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCE 240
            DTFRWVGKK  PEKD W+GEW E+LTH+PELER+VKRC DDLNPLKTL LFKQ+KS DCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGINSTVRSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGI++TV SGRPETYIWRYLPAPPVCIRPSV MQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLAKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360
            AGL KGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPG+S+GGGKVKPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAKVLT+PEKVTRYN+ KLQ+LI
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420

Query: 421  INGPTVHPGANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSL 480
            +NGP VHPGANYLLK+NE+ARRNLRYGD+LKLAKNLQ GDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRLKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+D  +LTQLLSMMSD   QFDIPPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDIPPPAIMKP 600

Query: 601  YYLWTGKQVFSLLIRPNKKSPVVINLDAKNKVYIPPKDKSFPNEMSINDGFVIIRGSEIL 660
            YYLWTGKQVFSLLI+PN  SPVVINLDAKNKV++PPK KS PNEMS NDGFVIIRGS+IL
Sbjct: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSKIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPS 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAAN MNRMAKLCAR+LGNRGFSIGI+DVTP+
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 721  SDLRDKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
             DL+ KKEE+V  AY+KCDELI +F  G+LETQPGCNEEQTLEAKIGGLLSKVREEVGDV
Sbjct: 721  DDLKQKKEELVEIAYSKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840
            CINELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DDTVRTSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIV 960
            D+TVRTSANGIVQFTYGGDGLDPL+MEGNA+PVNF RSWDHA NITFN  + GLLPY I+
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDEGLLPYAIM 960

Query: 961  RETDNVLKPLEEKLIRYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAARLA 1020
            + T+ +L+PLEE+L+RYDN G +V +E ++   Y D++DAER FY+SL+ Y+  KA  LA
Sbjct: 961  QTTNEILRPLEERLVRYDNSGCLVKEENLNKAEYVDQYDAERDFYRSLKEYINLKATALA 1020

Query: 1021 QIRNTRGLLEMTQNGGDTSMEV-----VSSELQASVDQVYKITKKNVNAFLTIALHKYHR 1075
             +R +RG+LE+ +     S +V     V   ++ SV Q+Y+I++K+V  FL IAL+KY +
Sbjct: 1021 NLRKSRGMLELLEPPTKESEKVDPDKLVPDNVKTSVSQLYRISEKSVRKFLEIALYKYRK 1080

Query: 1076 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1135
            A++EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1136 INAVLVNEGDERAARVVKGRIEKTLLSDLAFYIQDVYRGNMSYLEIRVDLATIEKLQLEL 1195
            INAVLVN+ DERAARVVKGR+EKTLLSD+A+Y+QDVY+ N+S++++R+DL TI+KLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200

Query: 1196 TMEDIAVALSRAPKLKIQTTDIHILGKDKIHVNVYPEGMKAKSISTSAKEPSENEVFYKM 1255
            T+EDIAVA++RA KLKIQ +D++I+GKD+I +NV+PEG KA+SISTSAKEPSEN+VFY+M
Sbjct: 1201 TIEDIAVAITRAAKLKIQASDVNIIGKDRIAINVFPEGYKARSISTSAKEPSENDVFYRM 1260

Query: 1256 QTLRRSLPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTITNHVL 1315
            Q LRR+LPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLR+VMCTDGVIGS+T TNHVL
Sbjct: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHVL 1320

Query: 1316 EVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1375
            EV SVLGIEAAR SI+ EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1376 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVVKYNDVSERD 1435
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMS+GTGSFKVVK  ++SERD
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISERD 1440

Query: 1436 LKVRPTLFESLASETAIKAN 1455
            L  +P LFESL++E A+KAN
Sbjct: 1441 LVPKPCLFESLSNEAALKAN 1460

>Skud_15.279 Chr15 complement(496216..500598) [4383 bp, 1460 aa] {ON}
            YOR116C (REAL)
          Length = 1460

 Score = 2520 bits (6531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1197/1461 (81%), Positives = 1321/1461 (90%), Gaps = 7/1461 (0%)

Query: 1    MKEVVVGETQKKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGV 60
            MKEVVV ET K+I G+EFSAL+AADIVAQSEVE++TRDLFDLEK R  K  GALD +MGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60

Query: 61   SSSSQECMTCHGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDR 120
            SSS+ EC TCHGNLASCHGHFGH+KLALPVFH+GYFK+TIQILQ ICK+CSAVLLS+ D+
Sbjct: 61   SSSTLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDK 120

Query: 121  RDFLKELRRPGIDNLRKMSILKKVIDQCKKQRRCLKCXXXXXXXXXXXXXXXXXSLKIIH 180
            R FL ELRRPG+DNLR+M ILKK++DQCKKQRRCL C                 +LKIIH
Sbjct: 121  RHFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWVGKKMVPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCE 240
            DTFRWVGKK  PEKD W+GEW E+LTH+PELER+VKRC DDLNPLKTL LFKQ+KS DCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGINSTVRSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGI++T+ SGRPETYIWRYLPAPPVCIRPSV MQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLAKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360
            AGL KGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPG+S+GGGKVKPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAKVLT+PEKVTRYN+ KLQ+LI
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELI 420

Query: 421  INGPTVHPGANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSL 480
            +NGP VHPGANYLLK+NE+ARRNLRYGD++KLAKNLQ GDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+D  +LTQLLSMMSD   QFD+PPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDVPPPAIMKP 600

Query: 601  YYLWTGKQVFSLLIRPNKKSPVVINLDAKNKVYIPPKDKSFPNEMSINDGFVIIRGSEIL 660
            YYLWTGKQVFSLLI+PN  SPVVINLDAKNKV++PPK KS P+EMS NDGFVIIRGS+IL
Sbjct: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVIIRGSQIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPS 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAAN MNRMAKLCAR+LGNRGFSIGI+DVTP+
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 721  SDLRDKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
             DL+ KKEE+V  AY KCDELI +F  G+LETQPGCNEEQTLEAKIGG LSKVREEVGDV
Sbjct: 721  DDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840
            CINELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DDTVRTSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIV 960
            D+TVRTSANGIVQFTYGGDGLDPL+MEGNA+PVNF RSWDHA NITFN  + GLLPY I+
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIM 960

Query: 961  RETDNVLKPLEEKLIRYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAARLA 1020
            +  + +L+PLEE+L+RYDN G++V +E  D   Y D++DAER FY+SLR Y+  KA  LA
Sbjct: 961  KTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATALA 1020

Query: 1021 QIRNTRGLLEMTQ------NGGDTSMEVVSSELQASVDQVYKITKKNVNAFLTIALHKYH 1074
             +R +RG+ E  +       G D   E V   ++ SV Q+Y+I++K+V  FL IAL KY 
Sbjct: 1021 NLRKSRGMFEQLEPPEKELEGIDLD-EAVPDNVRTSVSQLYRISEKSVRKFLEIALFKYR 1079

Query: 1075 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1134
            +A++EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTP
Sbjct: 1080 KARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKSISTP 1139

Query: 1135 IINAVLVNEGDERAARVVKGRIEKTLLSDLAFYIQDVYRGNMSYLEIRVDLATIEKLQLE 1194
            IINAVLVN+ DERAARVVKGR+EKTLLSD+A+Y+QDVY+ N+S++++R+DL+TI+KLQLE
Sbjct: 1140 IINAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLSTIDKLQLE 1199

Query: 1195 LTMEDIAVALSRAPKLKIQTTDIHILGKDKIHVNVYPEGMKAKSISTSAKEPSENEVFYK 1254
            LT+EDIA+A++RA KLKIQ +D++I+GKD+I +NV+PEG KAKSISTSAKEPSEN+VFY+
Sbjct: 1200 LTIEDIAIAITRASKLKIQASDVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDVFYR 1259

Query: 1255 MQTLRRSLPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTITNHV 1314
            MQ LRR+LPDVVVKGLPDISRAVINIRDD KRELLVEGYGLR+VMCTDGVIGSKT TNHV
Sbjct: 1260 MQQLRRALPDVVVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIGSKTTTNHV 1319

Query: 1315 LEVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1374
            LEV SVLGIEAAR SI+ EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM
Sbjct: 1320 LEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1379

Query: 1375 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVVKYNDVSER 1434
            RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMS+GTGSFKVVK  ++SE+
Sbjct: 1380 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEK 1439

Query: 1435 DLKVRPTLFESLASETAIKAN 1455
            DL  +P LFESL++E A+KAN
Sbjct: 1440 DLVPKPCLFESLSNEAALKAN 1460

>YOR116C Chr15 complement(539763..544145) [4383 bp, 1460 aa] {ON}
            RPO31RNA polymerase III largest subunit C160, part of
            core enzyme; similar to bacterial beta-prime subunit and
            to RPA190 and RPO21
          Length = 1460

 Score = 2518 bits (6527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1200/1461 (82%), Positives = 1318/1461 (90%), Gaps = 7/1461 (0%)

Query: 1    MKEVVVGETQKKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGV 60
            MKEVVV ET K+I G+EFSAL+AADIVAQSEVE++TRDLFDLEK R  K  GALD +MGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60

Query: 61   SSSSQECMTCHGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDR 120
            SSSS EC TCHGNLASCHGHFGH+KLALPVFH+GYFK+TIQILQ ICK+CSA+LLS+ D+
Sbjct: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120

Query: 121  RDFLKELRRPGIDNLRKMSILKKVIDQCKKQRRCLKCXXXXXXXXXXXXXXXXXSLKIIH 180
            R FL ELRRPG+DNLR+M ILKK++DQCKKQRRCL C                 +LKIIH
Sbjct: 121  RQFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWVGKKMVPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCE 240
            DTFRWVGKK  PEKD W+GEW E+L H+PELER+VKRC DDLNPLKTL LFKQ+KS DCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGINSTVRSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGI++TV SGRPETYIWRYLPAPPVCIRPSV MQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLAKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360
            AGL KGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPG+S+GGGKVKPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAKVLT+PEKVTRYN+ KLQ+LI
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420

Query: 421  INGPTVHPGANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSL 480
            +NGP VHPGANYLLK+NE+ARRNLRYGD++KLAKNLQ GDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+D  +LTQLLSMMSD    FDIPPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEHFDIPPPAIMKP 600

Query: 601  YYLWTGKQVFSLLIRPNKKSPVVINLDAKNKVYIPPKDKSFPNEMSINDGFVIIRGSEIL 660
            YYLWTGKQVFSLLI+PN  SPVVINLDAKNKV++PPK KS PNEMS NDGFVIIRGS+IL
Sbjct: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSQIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPS 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAAN MNRMAKLCAR+LGNRGFSIGI+DVTP+
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 721  SDLRDKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
             DL+ KKEE+V  AY KCDELI +F  G+LETQPGCNEEQTLEAKIGGLLSKVREEVGDV
Sbjct: 721  DDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840
            CINELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DDTVRTSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIV 960
            D+TVRTSANGIVQFTYGGDGLDPL+MEGNA+PVNF RSWDHA NITFN  + GLLPY I+
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIM 960

Query: 961  RETDNVLKPLEEKLIRYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAARLA 1020
               + +L PLEE+L+RYDN G +V +E ++   Y D++DAER FY SLR Y+  KA  LA
Sbjct: 961  ETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATALA 1020

Query: 1021 QIRNTRGLLEMTQ------NGGDTSMEVVSSELQASVDQVYKITKKNVNAFLTIALHKYH 1074
             +R +RG+L + +       G D   E V   ++ SV Q+Y+I++K+V  FL IAL KY 
Sbjct: 1021 NLRKSRGMLGLLEPPAKELQGIDPD-ETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYR 1079

Query: 1075 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1134
            +A++EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP
Sbjct: 1080 KARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1139

Query: 1135 IINAVLVNEGDERAARVVKGRIEKTLLSDLAFYIQDVYRGNMSYLEIRVDLATIEKLQLE 1194
            IINAVLVN+ DERAARVVKGR+EKTLLSD+AFY+QDVY+ N+S++++R+DL TI+KLQLE
Sbjct: 1140 IINAVLVNDNDERAARVVKGRVEKTLLSDVAFYVQDVYKDNLSFIQVRIDLGTIDKLQLE 1199

Query: 1195 LTMEDIAVALSRAPKLKIQTTDIHILGKDKIHVNVYPEGMKAKSISTSAKEPSENEVFYK 1254
            LT+EDIAVA++RA KLKIQ +D++I+GKD+I +NV+PEG KAKSISTSAKEPSEN+VFY+
Sbjct: 1200 LTIEDIAVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYR 1259

Query: 1255 MQTLRRSLPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTITNHV 1314
            MQ LRR+LPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLR+VMCTDGVIGS+T TNHV
Sbjct: 1260 MQQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHV 1319

Query: 1315 LEVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1374
            LEV SVLGIEAAR SI+ EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM
Sbjct: 1320 LEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1379

Query: 1375 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVVKYNDVSER 1434
            RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMS+GTGSFKVVK  ++SE+
Sbjct: 1380 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEK 1439

Query: 1435 DLKVRPTLFESLASETAIKAN 1455
            DL  +  LFESL++E A+KAN
Sbjct: 1440 DLVPKRCLFESLSNEAALKAN 1460

>Kpol_1016.9 s1016 (19972..24354) [4383 bp, 1460 aa] {ON}
            (19972..24354) [4383 nt, 1461 aa]
          Length = 1460

 Score = 2518 bits (6526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1192/1460 (81%), Positives = 1318/1460 (90%), Gaps = 5/1460 (0%)

Query: 1    MKEVVVGETQKKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGV 60
            MKEVVV ET KKISG+EFSAL+A+DIVAQSEVE++TRDLFDLE GR  K GGALD +MGV
Sbjct: 1    MKEVVVSETPKKISGLEFSALSASDIVAQSEVEVSTRDLFDLENGRAPKIGGALDPKMGV 60

Query: 61   SSSSQECMTCHGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDR 120
            SSSS EC TCHGNLASCHGHFGHIKLALPVFHVGYFK+TIQILQ ICK+CS++LL+D DR
Sbjct: 61   SSSSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSSILLNDTDR 120

Query: 121  RDFLKELRRPGIDNLRKMSILKKVIDQCKKQRRCLKCXXXXXXXXXXXXXXXXXSLKIIH 180
            RDFL ELRRPGIDNL++M+I+KK++DQCKKQRRCL C                 SLKIIH
Sbjct: 121  RDFLHELRRPGIDNLKRMAIIKKILDQCKKQRRCLTCGALNGVVKRAAAGSGSASLKIIH 180

Query: 181  DTFRWVGKKMVPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCE 240
            DTFRWVGKK  PEKD W+G+W ++L ++PELERF KR  DDLNPLKTL LFKQ++ EDCE
Sbjct: 181  DTFRWVGKKSSPEKDEWVGDWEKVLANNPELERFAKRSMDDLNPLKTLNLFKQIRPEDCE 240

Query: 241  LLGINSTVRSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGI+STV++GRPETYIWRYLPAPPVCIRPSV MQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLAKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360
            AGL KGISINNMMEHWDYLQL+VAMYINSDSVNP+M+PGASSGG K KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPSMMPGASSGGAKAKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAKVLT+PEKVTRYN+ KLQ L+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNREKLQALV 420

Query: 421  INGPTVHPGANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSL 480
            INGP VHPGANY+LK NEEARRNLRYGD+LK+AK L+ GD+VERHLEDGD+VLFNRQPSL
Sbjct: 421  INGPNVHPGANYILKANEEARRNLRYGDRLKIAKQLRVGDIVERHLEDGDIVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEA+NLMGVKNN
Sbjct: 481  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAMNLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKD+F D  + TQLLSMMSD+ LQFDIPPP I+KP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDTFLDRATFTQLLSMMSDSNLQFDIPPPTIIKP 600

Query: 601  YYLWTGKQVFSLLIRPNKKSPVVINLDAKNKVYIPPKDKSFPNEMSINDGFVIIRGSEIL 660
            Y LWTGKQ+FSLLI+PNK SPVVINLDAKNKV+IPPK KS PNEMS NDGFV+IRGS+IL
Sbjct: 601  YCLWTGKQLFSLLIKPNKDSPVVINLDAKNKVFIPPKSKSLPNEMSQNDGFVVIRGSQIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPS 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAAN MNRMAKLCARYLGNRGFSIGISDVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPD 720

Query: 721  SDLRDKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
            + L+ KKEE+V  AYAKCDELID+F  GKLETQPGCNEEQTLEAKIGGLLSKVREEVGD+
Sbjct: 721  NALKQKKEELVEIAYAKCDELIDLFTKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDI 780

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840
            CINELDNLNAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF+KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFRKNSK 840

Query: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DDTVRTSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIV 960
            D+TVRTS+NGIVQFTYGGDGLDPL+MEGNA+PVNF RSWDHA NITF+ +  GLLPY I+
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFKRSWDHAINITFDNSAQGLLPYAII 960

Query: 961  RETDNVLKPLEEKLIRYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAARLA 1020
             +T+++L P EE+LIRYDN+G +V       + + D+ D+ER FY SLR YMQEKA+ LA
Sbjct: 961  NKTNDILAPFEERLIRYDNIGTLVKANDQAKDEFVDQLDSERNFYCSLRKYMQEKASILA 1020

Query: 1021 QIRNTRGLLEMTQNGGDTSMEV-----VSSELQASVDQVYKITKKNVNAFLTIALHKYHR 1075
             IR  +GL E++   G+   E+      SSE + +V+++ KIT+K V  FL IA+ KY R
Sbjct: 1021 SIRKDKGLKELSSEPGNEFKEMDLDEGESSEARFAVEKLCKITEKTVEKFLEIAMSKYRR 1080

Query: 1076 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1135
            A+VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1136 INAVLVNEGDERAARVVKGRIEKTLLSDLAFYIQDVYRGNMSYLEIRVDLATIEKLQLEL 1195
            INAVLVN+ D+RAARVVKGRIEKTLLSD+A+Y+QDVY+ N+S+LE+++DL+TI+KLQLEL
Sbjct: 1141 INAVLVNDNDKRAARVVKGRIEKTLLSDVAYYVQDVYKDNLSFLEVKIDLSTIDKLQLEL 1200

Query: 1196 TMEDIAVALSRAPKLKIQTTDIHILGKDKIHVNVYPEGMKAKSISTSAKEPSENEVFYKM 1255
            T+EDIAVAL+RAPKLKIQTTD+ I+ KDKI ++VYPEG KAKSISTS KEPSEN+VFY+M
Sbjct: 1201 TIEDIAVALTRAPKLKIQTTDVQIVSKDKITISVYPEGSKAKSISTSMKEPSENDVFYRM 1260

Query: 1256 QTLRRSLPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTITNHVL 1315
            QTLRR+LP +VV GLPDI+RAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKT TNHVL
Sbjct: 1261 QTLRRALPQIVVNGLPDIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTTTNHVL 1320

Query: 1316 EVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1375
            EV SVLGIEAAR+SI+GEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1376 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVVKYNDVSERD 1435
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMS+GTG+FK++K  ++   D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKILKSTEIKPDD 1440

Query: 1436 LKVRPTLFESLASETAIKAN 1455
            LK + TLFE+L +E A+K N
Sbjct: 1441 LKPKRTLFENLVAEPALKVN 1460

>CAGL0L11660g Chr12 (1245685..1250064) [4380 bp, 1459 aa] {ON} highly
            similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116c RPO31 DNA-directed RNA polymerase III
          Length = 1459

 Score = 2517 bits (6523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1203/1457 (82%), Positives = 1321/1457 (90%), Gaps = 4/1457 (0%)

Query: 1    MKEVVVGETQKKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGV 60
            MKEVV+GET K+ISG+EFSAL+ ADIVAQSE+EI++RDLFDLE  R  K GGALD RMGV
Sbjct: 1    MKEVVIGETPKRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGV 60

Query: 61   SSSSQECMTCHGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDR 120
            S+SS EC TCHGNLASCHGHFGHIKLALPVFHVGYFK+TIQILQ ICK CSA+LLS++D+
Sbjct: 61   SASSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDK 120

Query: 121  RDFLKELRRPGIDNLRKMSILKKVIDQCKKQRRCLKCXXXXXXXXXXXXXXXXXSLKIIH 180
            R FL ELRRPG+DNLR+M++LKKV+DQCKKQRRCL C                 SLKIIH
Sbjct: 121  RHFLSELRRPGVDNLRRMALLKKVLDQCKKQRRCLHCGALNGVVKKAAAGAGTASLKIIH 180

Query: 181  DTFRWVGKKMVPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCE 240
            DTFRWVGKK  PEKD+WIG+W E+L+H+PELER+VKR +DDLNPLKTL LFKQ+ SEDCE
Sbjct: 181  DTFRWVGKKSTPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCE 240

Query: 241  LLGINSTVRSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGI++T ++GRPETYIWRY+PAPPVCIRPSV MQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLAKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360
            AG+ KGISINNMMEHWDYLQ+TVAMYINSDS+NPAMLPG+S+GGGKVKPIRGFCQRLKGK
Sbjct: 301  AGIEKGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYN +KL+QL+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLV 420

Query: 421  INGPTVHPGANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSL 480
             NGP VHPGANYLLKKNEEARRNLRYGD+ KLA NLQYGDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  QNGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFD  SLTQLLSMMSD  LQFDIPPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMSDGSLQFDIPPPAIMKP 600

Query: 601  YYLWTGKQVFSLLIRPNKKSPVVINLDAKNKVYIPPKDKSFPNEMSINDGFVIIRGSEIL 660
             YLWTGKQVFSLLI+PNK SPV INLDAKNKVYIPPK K +PNEMS NDGFVI+RGS+IL
Sbjct: 601  CYLWTGKQVFSLLIKPNKNSPVKINLDAKNKVYIPPKQKHYPNEMSQNDGFVIVRGSQIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPS 720
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEAA+ MNRMAKLCARYLGNRGFSIGISDVTP+
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPA 720

Query: 721  SDLRDKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
             DL+ KKE++V  AYAKCDELID++  GKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV
Sbjct: 721  DDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840
            CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DDTVRTSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIV 960
            D+TVRTS+NGIVQFTYGGDGLDPL+MEGNA+PVNF RSWDHA NITFN  + GLLPYEI 
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIK 960

Query: 961  RETDNVLKPLEEKLIRYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAARLA 1020
            +  DN+LKPLE++LIRYD LG  V  E    + Y D+HD+ER FY SLR +M +KA +LA
Sbjct: 961  KTVDNILKPLEKRLIRYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTDKAKKLA 1020

Query: 1021 QIRNTRGLLEMTQ----NGGDTSMEVVSSELQASVDQVYKITKKNVNAFLTIALHKYHRA 1076
            ++R +RGL ++ +     G D   E + + +Q S+ Q+Y+IT+  V  FL IA+ KYHRA
Sbjct: 1021 KLRKSRGLPKLIKKSELEGYDPENEHIDAIVQHSITQLYRITEDAVQKFLEIAISKYHRA 1080

Query: 1077 KVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1136
            KVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII
Sbjct: 1081 KVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140

Query: 1137 NAVLVNEGDERAARVVKGRIEKTLLSDLAFYIQDVYRGNMSYLEIRVDLATIEKLQLELT 1196
            NAVLVN  DERAARVVKGRIEKTLLSD+ +YIQDVY+ NM+YL+++VDL TI+KLQLELT
Sbjct: 1141 NAVLVNNNDERAARVVKGRIEKTLLSDVCYYIQDVYKENMAYLQVKVDLNTIDKLQLELT 1200

Query: 1197 MEDIAVALSRAPKLKIQTTDIHILGKDKIHVNVYPEGMKAKSISTSAKEPSENEVFYKMQ 1256
            +EDIA+A++RAPKLKIQT+D+ +LGKDKI +NV PEG  +K+ STS KEP+EN+VFY+MQ
Sbjct: 1201 IEDIAIAITRAPKLKIQTSDVTVLGKDKIAINVLPEGFGSKTSSTSLKEPTENDVFYRMQ 1260

Query: 1257 TLRRSLPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTITNHVLE 1316
            TLRR+LP ++VKGL DI+RAVINIRDDGKRELLVEGYGLR+VMCTDGVIG+KT TNHVLE
Sbjct: 1261 TLRRALPSIMVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTATNHVLE 1320

Query: 1317 VNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRD 1376
            + +VLGIEAARASI+GEIDYTMSNHGMSVDPRHIQLLGDVMT+KGEVLGITRFGLSKMRD
Sbjct: 1321 IFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKMRD 1380

Query: 1377 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVVKYNDVSERDL 1436
            SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMS+GTGSFKVVK  D++E +L
Sbjct: 1381 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKNTDIAEDEL 1440

Query: 1437 KVRPTLFESLASETAIK 1453
            K + TLFESL S  A K
Sbjct: 1441 KPKRTLFESLTSNVANK 1457

>Suva_8.169 Chr8 complement(297556..301938) [4383 bp, 1460 aa] {ON}
            YOR116C (REAL)
          Length = 1460

 Score = 2509 bits (6504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1194/1461 (81%), Positives = 1316/1461 (90%), Gaps = 7/1461 (0%)

Query: 1    MKEVVVGETQKKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGV 60
            MKEVVV ET K+I G+EFSAL+AADIVAQSEVE++TRDLFDLEK R  +  GALD +MGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGV 60

Query: 61   SSSSQECMTCHGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDR 120
            SSSS EC TCHGNLASCHGHFGH+KLALPVFH+GYFK+TIQILQ ICK+CSA+LLS+ D+
Sbjct: 61   SSSSLECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120

Query: 121  RDFLKELRRPGIDNLRKMSILKKVIDQCKKQRRCLKCXXXXXXXXXXXXXXXXXSLKIIH 180
            R FL ELRRPG+DNLR+M ILKK++DQCKKQRRCL C                 +LKIIH
Sbjct: 121  RKFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWVGKKMVPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCE 240
            DTFRWVGKK  PEKD W+GEW E+LTH+PELER+VKRC DDLNPLKTL LFKQ+KS DCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGINSTVRSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGI++TV SGRPETYIWRYLPAPPVCIRPSV MQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLAKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360
            AGL KGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPG+S+GGGKVKPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAKVLT+PEKVTRYN+ KLQ+L+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELV 420

Query: 421  INGPTVHPGANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSL 480
            +NGP VHPGANYLLKKNE+ARRNLRYGD++KLAK+LQ GDV+ERHLEDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+D  +LTQLL MMSD   QFD+PPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMSDGVEQFDVPPPAIMKP 600

Query: 601  YYLWTGKQVFSLLIRPNKKSPVVINLDAKNKVYIPPKDKSFPNEMSINDGFVIIRGSEIL 660
            YYLWTGKQVFSLLI+P+ KSPVVINLDAKNKV++PPK KS P+EMS NDGFV+IRGS+IL
Sbjct: 601  YYLWTGKQVFSLLIKPSHKSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVVIRGSQIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPS 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAAN MNRMAKLCAR+LGNRGFSIGI+DVTP+
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 721  SDLRDKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
             DL+ KKEE+V  AY KCDELI  F  G+LETQPGCNEEQTLEAKIGG LSKVREEVGDV
Sbjct: 721  DDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840
            CINELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DDTVRTSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIV 960
            D+TVRTSANGIVQFTYGGDGLDPL+MEGNA+PVNF RSWDHA NITF+  + GLLPY I+
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIM 960

Query: 961  RETDNVLKPLEEKLIRYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAARLA 1020
               + +L PLE++L+RYDN G +V  E  D   + D++DAER FY+SLR Y+  KA  LA
Sbjct: 961  ETANKILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQYDAERDFYRSLREYINLKATTLA 1020

Query: 1021 QIRNTRGLLEMTQ------NGGDTSMEVVSSELQASVDQVYKITKKNVNAFLTIALHKYH 1074
             +R +RG+LE+         G D   E V + ++ SV Q+Y+I++++V  FL IAL KY 
Sbjct: 1021 NLRKSRGMLELVNAPPKELQGMDPD-EAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYR 1079

Query: 1075 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1134
            +A++EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP
Sbjct: 1080 KARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1139

Query: 1135 IINAVLVNEGDERAARVVKGRIEKTLLSDLAFYIQDVYRGNMSYLEIRVDLATIEKLQLE 1194
            IINAVLVN+ DERAARVVKGR+EKTLLSD+A+Y+QDVY+ N+S++++R+DL TI+KLQLE
Sbjct: 1140 IINAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLE 1199

Query: 1195 LTMEDIAVALSRAPKLKIQTTDIHILGKDKIHVNVYPEGMKAKSISTSAKEPSENEVFYK 1254
            LT+EDIAVA++RA KLKIQ  D+ I+GKDKI +NV+PEG KAKSISTSAKEPSEN+VFY+
Sbjct: 1200 LTIEDIAVAITRASKLKIQAPDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFYR 1259

Query: 1255 MQTLRRSLPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTITNHV 1314
            MQ LRR+LPDVVVKGL DISRAVINIRDDGKRELLVEGYGLR+VMCTDGVIGSKT TNHV
Sbjct: 1260 MQQLRRALPDVVVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSKTTTNHV 1319

Query: 1315 LEVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1374
            LEV SVLGIEAAR SIV EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM
Sbjct: 1320 LEVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1379

Query: 1375 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVVKYNDVSER 1434
            RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMS+GTGSFKV+K  +VSE+
Sbjct: 1380 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVIKGTNVSEK 1439

Query: 1435 DLKVRPTLFESLASETAIKAN 1455
            DL  +P LFESL++E A+KAN
Sbjct: 1440 DLIPKPCLFESLSNEAALKAN 1460

>SAKL0G02354g Chr7 complement(193623..197999) [4377 bp, 1458 aa] {ON}
            highly similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1458

 Score = 2504 bits (6491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1194/1461 (81%), Positives = 1312/1461 (89%), Gaps = 9/1461 (0%)

Query: 1    MKEVVVGETQKKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGV 60
            MKEVVV    KKI G+EFSAL+A+DIVAQSEVEI+TRDLFDLE GR  K GGALD +MGV
Sbjct: 1    MKEVVVDIAPKKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGV 60

Query: 61   SSSSQECMTCHGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDR 120
            SSS  EC TCHGNLASCHGHFGHIKLALPVFHVGYFK+TIQILQ +CK+C+++LLSD D+
Sbjct: 61   SSSHAECSTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDK 120

Query: 121  RDFLKELRRPGIDNLRKMSILKKVIDQCKKQRRCLKCXXXXXXXXXXXXXXXXXSLKIIH 180
            R FL ELRRPG+DNLR+M  LKK++DQCKKQRRCL C                 SLKIIH
Sbjct: 121  RQFLAELRRPGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNGVVKKAAAGSGSASLKIIH 180

Query: 181  DTFRWVGKKMVPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCE 240
            DTFRWVGKK  PEK++W+G+W ++L H+PELER++KRC DDLNPLKTL LFKQ+K EDCE
Sbjct: 181  DTFRWVGKKSAPEKEKWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDCE 240

Query: 241  LLGINSTVRSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGI+S V+SGRPETYIWRYLPAPPVCIRPSV MQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLAKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360
            AGL KGISINNMME WDYLQL VAMYINSDSVNPAM+PGAS  GGK KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGAS--GGKTKPIRGFCQRLKGK 358

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAKVLT+PEKVTRYNK KLQQL+
Sbjct: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLV 418

Query: 421  INGPTVHPGANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSL 480
            INGP +HPGANYLLKKN++ARRNLRYGD++KLAKNLQYGDVVERH+EDGDVVLFNRQPSL
Sbjct: 419  INGPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSL 478

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 538

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFD  +LTQLLSMMSD  +QFD+PPPA+MKP
Sbjct: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKP 598

Query: 601  YYLWTGKQVFSLLIRPNKKSPVVINLDAKNKVYIPPKDKSFPNEMSINDGFVIIRGSEIL 660
            +YLWTGKQVFSLLIRPNKKSPV+IN+DAKNKV++PPK K  PNEMS+NDGFV+IRGSEIL
Sbjct: 599  HYLWTGKQVFSLLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSVNDGFVVIRGSEIL 658

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPS 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAA+ MNRMAKLCARYLGNRGFSIGISDVTP 
Sbjct: 659  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPG 718

Query: 721  SDLRDKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
            +DL+ KKE+ V  AYAKCDELID F  GKLETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 719  ADLKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840
            CI ELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 779  CIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 838

Query: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 839  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 898

Query: 901  DDTVRTSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIV 960
            D+TVRTS+NGIVQFTYGGDGLDPLDMEGNA+PVNF RSWDHA NITF   + GLLPY+I+
Sbjct: 899  DNTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQII 958

Query: 961  RETDNVLKPLEEKLIRYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAARLA 1020
              T+++LKPLE+KL+R+DNLG  + KE  +   Y D+HDAER FY+SLR YM EKA  LA
Sbjct: 959  ENTNSILKPLEQKLVRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLA 1018

Query: 1021 QIRNTRGLLEMTQNGGDTSMEVVSSELQ------ASVDQVYKITKKNVNAFLTIALHKYH 1074
            +IR  +GL  +        +++++ + Q       +V+Q+ KI+K  V  FL IA+ KYH
Sbjct: 1019 KIRKAKGLKTLLDEPA-PELKILNLDEQYPEYILTAVNQLCKISKNLVETFLGIAISKYH 1077

Query: 1075 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1134
            RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP
Sbjct: 1078 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1137

Query: 1135 IINAVLVNEGDERAARVVKGRIEKTLLSDLAFYIQDVYRGNMSYLEIRVDLATIEKLQLE 1194
            IINAVLVN+GDERAARVVKGRIEKT+LSD+ +YIQDVY+ N+S+++ +VDL TIEKLQLE
Sbjct: 1138 IINAVLVNDGDERAARVVKGRIEKTILSDVVYYIQDVYKDNLSFIQAKVDLGTIEKLQLE 1197

Query: 1195 LTMEDIAVALSRAPKLKIQTTDIHILGKDKIHVNVYPEGMKAKSISTSAKEPSENEVFYK 1254
            LT+EDIAVA++RA KLKI T D+ I+G++KI++NV+PEG KAKSISTSAKEPSEN VFY+
Sbjct: 1198 LTIEDIAVAITRASKLKISTADVSIVGRNKININVFPEGYKAKSISTSAKEPSENAVFYR 1257

Query: 1255 MQTLRRSLPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTITNHV 1314
            MQ LRR+LP +VVKGLPDISRAVINIRDDGKRELLVEGYGLR+VM TDGVIGSKT TNH+
Sbjct: 1258 MQHLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHI 1317

Query: 1315 LEVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1374
            LE+ +VLGIEAAR SIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM
Sbjct: 1318 LEIFNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1377

Query: 1375 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVVKYNDVSER 1434
            RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMS+GTGSFKVVK   +SE 
Sbjct: 1378 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTSISEE 1437

Query: 1435 DLKVRPTLFESLASETAIKAN 1455
            DLK + TLFESL ++ A+K +
Sbjct: 1438 DLKPKHTLFESLCNDVALKTH 1458

>ZYRO0F09856g Chr6 complement(798821..803197) [4377 bp, 1458 aa] {ON}
            highly similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1458

 Score = 2488 bits (6449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1193/1460 (81%), Positives = 1313/1460 (89%), Gaps = 7/1460 (0%)

Query: 1    MKEVVVGETQKKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGV 60
            MKEVV  E  KKISG+EFSAL+AADIVAQSEVEI+TRDLFDLE GR  KTGGALD +MGV
Sbjct: 1    MKEVVSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGV 60

Query: 61   SSSSQECMTCHGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDR 120
            SSSS EC TCHGNLASCHGHFGHIKLALPVFH+GYFK+TIQILQ ICK+CS++LL D D+
Sbjct: 61   SSSSMECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDK 120

Query: 121  RDFLKELRRPGIDNLRKMSILKKVIDQCKKQRRCLKCXXXXXXXXXXXXXXXXXSLKIIH 180
            + FL ELRRPG+DNLR+M ILKKV+DQCKKQRRCL+C                 SLKIIH
Sbjct: 121  KHFLSELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCGALNGVVKKAAAGGGSASLKIIH 180

Query: 181  DTFRWVGKKMVPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCE 240
            DTFRW GKK VPEK++WIG+W+ +L H PELER+VKRC DDLNPLKTL LFKQ+K EDCE
Sbjct: 181  DTFRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCE 240

Query: 241  LLGINSTVRSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGI+ST++SGRPETYIWRYLPAPPVCIRPSV MQDSPASNEDDLTVKLTE+VWTSSLIK
Sbjct: 241  LLGIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300

Query: 301  AGLAKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360
            AGL KGISINNMMEHWDYLQL VAMYINSDSVNPA+L G +  GGKVKPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGT--GGKVKPIRGFCQRLKGK 358

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLS+DEVAVP  VAKVLT+PE+VTRYNK KLQQL+
Sbjct: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLV 418

Query: 421  INGPTVHPGANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSL 480
            +NGP  +PGANYLLKK+E+ARRNLR+GD++KLAKNL+ GD+VERHLEDGDVVLFNRQPSL
Sbjct: 419  VNGPNEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSL 478

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQ+EEARAEAINLMGVK+N
Sbjct: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSN 538

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFD   +TQLLSMMSD  LQFDIPPP I KP
Sbjct: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMSDGALQFDIPPPTIWKP 598

Query: 601  YYLWTGKQVFSLLIRPNKKSPVVINLDAKNKVYIPPKDKSFPNEMSINDGFVIIRGSEIL 660
             YLWTGKQ+FSLLIRPNKKSPVV+NLDAKNKVYIPPK KS PNEMS NDGFV+IRGS+IL
Sbjct: 599  CYLWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQIL 658

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPS 720
            SGVMDKSVLGDGKKHSVFYTILRDYG QEAA  MNRMAKLCARY+GNRGFSIGISDVTP+
Sbjct: 659  SGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTPA 718

Query: 721  SDLRDKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
             +L++KKEEMV  AYAKCDELID+F  GKLETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 719  EELKEKKEEMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840
            CINELDN+NAPLIMATCGSKGSTLNVSQMVAVVGQQIISG+RVPDGFQDRSLPHF KNSK
Sbjct: 779  CINELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSK 838

Query: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLTPPEFL+HAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC Y
Sbjct: 839  TPQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLY 898

Query: 901  DDTVRTSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIV 960
            D+TVRTS+NGIVQFTYGGDGLDPL+MEGNA+PVNF R+WDHA N+TFN  + GLLPY+I+
Sbjct: 899  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIM 958

Query: 961  RETDNVLKPLEEKLIRYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAARLA 1020
            + T+ +L+PLE +L+RYDNLG  + KE  D   Y D++DAER FY SLR ++  KA  LA
Sbjct: 959  QVTEEILQPLENRLVRYDNLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLA 1018

Query: 1021 QIRNTRGLLEMTQNGGDTSMEV-----VSSELQASVDQVYKITKKNVNAFLTIALHKYHR 1075
            + R ++ + E+          V     V  +++ SVDQVY+IT K V  FL +A+ KY R
Sbjct: 1019 KFRGSKDMKELMDEPALELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRR 1078

Query: 1076 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1135
            AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1079 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138

Query: 1136 INAVLVNEGDERAARVVKGRIEKTLLSDLAFYIQDVYRGNMSYLEIRVDLATIEKLQLEL 1195
            INAVLVNE DERAARVVKGRIEKTLLSD+AFYIQDVYR N+SYL++RVDL+TI+KLQLEL
Sbjct: 1139 INAVLVNESDERAARVVKGRIEKTLLSDVAFYIQDVYRDNLSYLQVRVDLSTIDKLQLEL 1198

Query: 1196 TMEDIAVALSRAPKLKIQTTDIHILGKDKIHVNVYPEGMKAKSISTSAKEPSENEVFYKM 1255
            T+EDIAVA++RAPKLKIQ +D+HI+GKDKI +NV+P+G KAKSIST AKEPSENEVFY+M
Sbjct: 1199 TIEDIAVAMTRAPKLKIQASDVHIVGKDKIAINVFPDGAKAKSISTLAKEPSENEVFYRM 1258

Query: 1256 QTLRRSLPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTITNHVL 1315
            Q LRR+LP +VVKGL DISRAVINIRDDGKRELLVEGYGLR+VM TDGV+G KT+TNH+L
Sbjct: 1259 QQLRRALPGIVVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVTNHIL 1318

Query: 1316 EVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1375
            EV SVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKMR
Sbjct: 1319 EVYSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1378

Query: 1376 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVVKYNDVSERD 1435
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM++GTG+FKVVK  +VSE  
Sbjct: 1379 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVVKGTNVSEEQ 1438

Query: 1436 LKVRPTLFESLASETAIKAN 1455
            LK +PTLFESL +ET++K N
Sbjct: 1439 LKPKPTLFESLVNETSVKVN 1458

>KLTH0F16236g Chr6 (1316542..1320924) [4383 bp, 1460 aa] {ON} highly
            similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1460

 Score = 2484 bits (6438), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1191/1464 (81%), Positives = 1304/1464 (89%), Gaps = 13/1464 (0%)

Query: 1    MKEVVVGETQKKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGV 60
            MKEVVV    K+I G+EFSAL+A+DIVAQS+VEI+TRDLFDLE GR+ K+GGALD RMGV
Sbjct: 1    MKEVVVDIAPKRIKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60

Query: 61   SSSSQECMTCHGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDR 120
            SSS  EC TCHGNLASCHGHFGHIKL+LPVFHVGYFK+TIQ+LQ ICK C+A+LLS++D+
Sbjct: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDK 120

Query: 121  RDFLKELRRPGIDNLRKMSILKKVIDQCKKQRRCLKCXXXXXXXXXXXXXXXXXSLKIIH 180
              FL ELRRPGIDNLR+M ILKKV+DQCKKQRRCL+C                 SLKI+H
Sbjct: 121  HQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNGVVKKAAAGSGSASLKILH 180

Query: 181  DTFRWVGKKMVPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCE 240
            DTFRWVGKK  PEKD+W+G+W  +L H+PELER+VK+C DDLNPLKTL LFKQ+  EDCE
Sbjct: 181  DTFRWVGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAPEDCE 240

Query: 241  LLGINSTVRSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGI+STV+SGRPETYIWRYLPAPPVCIRPSV MQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLAKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360
            AGL KGISINNMME WDYLQL VAMYINSDSVNPAM+PG S+GG K KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGG-KTKPIRGFCQRLKGK 359

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLI 420
            QGRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVP  VAKVLT+PE VTRYNK+KLQQL+
Sbjct: 360  QGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLV 419

Query: 421  INGPTVHPGANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSL 480
            INGP  HPGANYLLKK+EEARRNLRYGD++KLA+NLQYGDVVERHLEDGDVVLFNRQPSL
Sbjct: 420  INGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQPSL 479

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFF      QLLSMMSD  LQFDIPPP+IMKP
Sbjct: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPSIMKP 599

Query: 601  YYLWTGKQVFSLLIRPNKKSPVVINLDAKNKVYIPPKDKSFPNEMSINDGFVIIRGSEIL 660
            YY+WTGKQVFSLLIRPNK+SPVVINLDAKNKVYIPPKDKS PNEMSINDG+V+IRGS+IL
Sbjct: 600  YYMWTGKQVFSLLIRPNKESPVVINLDAKNKVYIPPKDKSLPNEMSINDGYVVIRGSKIL 659

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPS 720
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEAA  MNRMAKLCAR+LGNRGFSIGI+DVTP 
Sbjct: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGINDVTPG 719

Query: 721  SDLRDKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
             +L++KKE MV  AYAKCD LID+F  GKLETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 720  FELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840
            CI ELDNLN+ LIMA CGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 780  CIKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSK 839

Query: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899

Query: 901  DDTVRTSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIV 960
            D+T+RTS+NGIVQFTYGGDGLDP+DMEGNA+PVNF RSW+HA N+TFN  +  LLPY+I+
Sbjct: 900  DNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIM 959

Query: 961  RETDNVLKPLEEKLIRYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAARLA 1020
            ++T+ VLKPLEEKL+RYDNLG  +   L D   Y D+ DAER FYKSLR YM EKA+ LA
Sbjct: 960  QQTNGVLKPLEEKLVRYDNLGNELDPSLQDRVEYIDQDDAERNFYKSLRDYMYEKASHLA 1019

Query: 1021 QIRNTRGLLEMTQNGGDTSMEVVSSELQ--------ASVDQVYKITKKNVNAFLTIALHK 1072
             IR  +GL E      + + E+ + +L         ASVDQ+ KI+ K V  FL IA+ K
Sbjct: 1020 NIRAHKGLKEFLD---EPAAELQAMDLDEGAPASALASVDQLCKISSKLVLKFLEIAIFK 1076

Query: 1073 YHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVIS 1132
            YH+AKVEPGTAVGA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVIS
Sbjct: 1077 YHKAKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVIS 1136

Query: 1133 TPIINAVLVNEGDERAARVVKGRIEKTLLSDLAFYIQDVYRGNMSYLEIRVDLATIEKLQ 1192
            TPIINAVLVN  DERAARVVKGRIEKTLLSD+AFYIQDVY+ NMS+L+++VDL TIEKLQ
Sbjct: 1137 TPIINAVLVNNNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNMSFLQVKVDLGTIEKLQ 1196

Query: 1193 LELTMEDIAVALSRAPKLKIQTTDIHILGKDKIHVNVYPEGMKAKSISTSAKEPSENEVF 1252
            LELT+EDIAVA++RA KLKI  +D+ I+GKDK+++NVYPE  K KSISTSAKEP ENE+F
Sbjct: 1197 LELTVEDIAVAITRAAKLKIAASDVSIMGKDKVNINVYPEMAKLKSISTSAKEPVENELF 1256

Query: 1253 YKMQTLRRSLPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTITN 1312
            Y+MQ LRR+LP +VVKGLPDI+RAVINI+DDG RELLVEGYGLREVM TDGVIG KT TN
Sbjct: 1257 YRMQHLRRALPGIVVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKTN 1316

Query: 1313 HVLEVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLS 1372
            H+LEV SVLGIEAAR SIVGEIDYTMSNHGMSVDPRH+QLLGDVMTYKGE+LGITRFGLS
Sbjct: 1317 HILEVFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLS 1376

Query: 1373 KMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVVKYNDVS 1432
            KMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMS+GTG+FKVVK  D+S
Sbjct: 1377 KMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTDIS 1436

Query: 1433 ERDLKVRPTLFESLA-SETAIKAN 1455
            E DL  +PTLFESL  S TA+K N
Sbjct: 1437 ESDLAPKPTLFESLCDSVTALKVN 1460

>TBLA0A03720 Chr1 complement(929751..934127) [4377 bp, 1458 aa] {ON}
            Anc_5.426 YOR116C
          Length = 1458

 Score = 2455 bits (6363), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1183/1460 (81%), Positives = 1284/1460 (87%), Gaps = 7/1460 (0%)

Query: 1    MKEVVVGETQKKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGV 60
            MKEVV  E  KKISG+EFSAL+AADIVAQSEV ITTRDL+DLE GR  K  GALD+RMGV
Sbjct: 1    MKEVVTSEIPKKISGLEFSALSAADIVAQSEVAITTRDLYDLEHGRAPKKSGALDQRMGV 60

Query: 61   SSSSQECMTCHGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDR 120
            SSS+ EC TCHGNLASCHGHFGHIKLALPVFHVGYFK+TIQILQ ICK C+AVLLSD+D+
Sbjct: 61   SSSNLECETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKSCAAVLLSDEDK 120

Query: 121  RDFLKELRRPGIDNLRKMSILKKVIDQCKKQRRCLKCXXXXXXXXXXXXXXXXXSLKIIH 180
            R+FL ELRRPGIDNL++M ILKK++DQCKKQRRCL C                 SLKIIH
Sbjct: 121  RNFLSELRRPGIDNLKRMGILKKILDQCKKQRRCLHCGGLNGVVKKAAAGGGSASLKIIH 180

Query: 181  DTFRWVGKKMVPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCE 240
            DTFRWVGKK  PEKD W+G+W E+L+H+PELERFVKR  DDLNPLKTL LFKQ+K EDCE
Sbjct: 181  DTFRWVGKKQTPEKDSWVGDWQEVLSHNPELERFVKRAMDDLNPLKTLNLFKQIKPEDCE 240

Query: 241  LLGINSTVRSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGI+ST +SGRPETYIWRYLPAPPVCIRPSV MQDSPASNEDDLTVKLTE+VWTSSLIK
Sbjct: 241  LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300

Query: 301  AGLAKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360
            AGL KGISINNMMEHWDYLQL+VAMYINSDSVNP ++PGAS+G  KVKPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPLLMPGASTGN-KVKPIRGFCQRLKGK 359

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAKVLTFPE+VTRYNKRKLQ L+
Sbjct: 360  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPERVTRYNKRKLQALV 419

Query: 421  INGPTVHPGANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSL 480
            +NGP VHPGANYLLKK+EEARRNLRYGDK+KLAKNLQ GDVVERHLEDGDVVLFNRQPSL
Sbjct: 420  LNGPNVHPGANYLLKKDEEARRNLRYGDKVKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 479

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFD  + TQLLSMM D  LQFDIPPPAIMKP
Sbjct: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMCDGNLQFDIPPPAIMKP 599

Query: 601  YYLWTGKQVFSLLIRPNKKSPVVINLDAKNKVYIPPKDKSFPNEMSINDGFVIIRGSEIL 660
             YLWTGKQ+FSLLI+PN  SPVVIN+DAKNKV+ PPKDKS P+EMS NDGFV+IRGS+IL
Sbjct: 600  CYLWTGKQLFSLLIKPNSNSPVVINVDAKNKVFKPPKDKSLPSEMSPNDGFVVIRGSQIL 659

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPS 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAA  MNRMAKLCAR+LGNRGFSIGI+DVTP 
Sbjct: 660  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAATAMNRMAKLCARFLGNRGFSIGINDVTPD 719

Query: 721  SDLRDKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
              L++ KE +V  AYAKCDELI ++  GKLETQPGCNEEQTLEAKI G+LSKVREEVGD+
Sbjct: 720  DKLKNLKENLVEIAYAKCDELIGLYNQGKLETQPGCNEEQTLEAKISGILSKVREEVGDI 779

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840
            CINELDN NAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK
Sbjct: 780  CINELDNWNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 839

Query: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSF+SGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 840  TPQSKGFVRNSFYSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899

Query: 901  DDTVRTSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIV 960
            D+TVRTS+NGIVQFTYGGDGLDP DMEGNA+PVNF RSWDHA NI F+ N+  + PY+I+
Sbjct: 900  DNTVRTSSNGIVQFTYGGDGLDPFDMEGNAQPVNFNRSWDHAYNIKFDNNDKTIYPYQIL 959

Query: 961  RETDNVLKPLEEKLIRYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAARLA 1020
              T+++L PLEEKLIRYDN+G VV  E    + + D+ DAER FY SLR YM +KA  LA
Sbjct: 960  EITNDILHPLEEKLIRYDNIGKVVTPENSGKDEFVDQLDAERNFYNSLRDYMTKKANELA 1019

Query: 1021 QIRNTRGLLEMTQNGGDTSM-----EVVSSELQASVDQVYKITKKNVNAFLTIALHKYHR 1075
             +R +RG+ E+    GD        E     ++ SV+Q+ +IT+  V  FL IA+ KY R
Sbjct: 1020 DVRKSRGMKELLSAPGDEFKLMDLDEQTPDSIRHSVEQICRITENTVREFLKIAITKYRR 1079

Query: 1076 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1135
            A+VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1080 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1139

Query: 1136 INAVLVNEGDERAARVVKGRIEKTLLSDLAFYIQDVYRGNMSYLEIRVDLATIEKLQLEL 1195
            INAVLVNE DERAARVVKGRIEKTLLSD+A+YIQD Y+ N SYLE+++DL TIEKLQLEL
Sbjct: 1140 INAVLVNENDERAARVVKGRIEKTLLSDVAYYIQDCYKDNNSYLEVKIDLGTIEKLQLEL 1199

Query: 1196 TMEDIAVALSRAPKLKIQTTDIHILGKDKIHVNVYPEGMKAKSISTSAKEPSENEVFYKM 1255
            TM DIA A++RAPKLKIQ  D+      KI ++V PE   +K IS SAKEP EN VFY+M
Sbjct: 1200 TMSDIADAIARAPKLKIQFGDVVPESNSKIRISVRPEASVSK-ISASAKEPLENNVFYRM 1258

Query: 1256 QTLRRSLPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTITNHVL 1315
            Q LRR+LP +VVKGLPDI+RAVINIRD+GKRELLVEGYGLR+VMCTDGVIGSKT TNHVL
Sbjct: 1259 QHLRRALPSIVVKGLPDIARAVINIRDNGKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1318

Query: 1316 EVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1375
            EVNSVLGIEAARASI+GEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1319 EVNSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1378

Query: 1376 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVVKYNDVSERD 1435
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMS+GTGSFKVVK   +    
Sbjct: 1379 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKDTHIRNGT 1438

Query: 1436 LKVRPTLFESLASETAIKAN 1455
            LK + TLFESL  ET IK N
Sbjct: 1439 LKPKRTLFESLCKETNIKIN 1458

>AER252C Chr5 complement(1101343..1105722) [4380 bp, 1459 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOR116C
            (RPO31)
          Length = 1459

 Score = 2453 bits (6358), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1178/1463 (80%), Positives = 1295/1463 (88%), Gaps = 12/1463 (0%)

Query: 1    MKEVVVGETQKKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGV 60
            MKEVVV    K+ISG+EFSAL+A+DIVAQSEVEI TRDLFDLE GR  K GGALD RMGV
Sbjct: 1    MKEVVVDILPKRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGV 60

Query: 61   SSSSQECMTCHGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDR 120
            SSS  EC TCHG LASCHGHFGHIKLALPVFHVGYFK+TIQILQ ICK+C+ +LL+++D+
Sbjct: 61   SSSQAECSTCHGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDK 120

Query: 121  RDFLKELRRPGIDNLRKMSILKKVIDQCKKQRRCLKCXXXXXXXXXXXXXXXXXSLKIIH 180
            R FL ELRRPGIDNLR+M+ LKKV+DQCKKQRRCL C                 +LKIIH
Sbjct: 121  RQFLSELRRPGIDNLRRMATLKKVLDQCKKQRRCLHCGMLNGVVKKAAAGSGSAALKIIH 180

Query: 181  DTFRWVGKKMVPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCE 240
            DTFRWVGKK  PEKD+WIG+WN++L H PELER++KR  ++LNPLKTL LFKQ+  +DCE
Sbjct: 181  DTFRWVGKKSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCE 240

Query: 241  LLGINSTVRSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGI+STV++GRPETYIWRYLPAPPVCIRPSV MQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLAKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360
            AGL KGISINNMME WDYLQ+ VAMYINSDSVNPA++PG + GGGK KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGN-GGGKTKPIRGFCQRLKGK 359

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAKVLTFPEKVTRYNK KLQQLI
Sbjct: 360  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLI 419

Query: 421  INGPTVHPGANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSL 480
            +NG  VHPGANYLLKKNEEARRNLRYGD++KLAKNLQ GDVVERHLEDGDVVLFNRQPSL
Sbjct: 420  VNGANVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 479

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFD  +  Q+LSMMSD  LQFDIPPPAIM+P
Sbjct: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRP 599

Query: 601  YYLWTGKQVFSLLIRPNKKSPVVINLDAKNKVYIPPKDKSFPNEMSINDGFVIIRGSEIL 660
            +YLWTGKQ+FSLLI+PNKKSPV+INLDAKNKVYI PK+K++PNEMS NDG+V+IRGS IL
Sbjct: 600  HYLWTGKQLFSLLIKPNKKSPVIINLDAKNKVYIAPKNKAYPNEMSANDGYVVIRGSNIL 659

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPS 720
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEA   MNRMAKLCARYLGNRGFSIGISDVTP 
Sbjct: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISDVTPG 719

Query: 721  SDLRDKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
             +L+  KEEMV  AYAKCDELID++K GKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV
Sbjct: 720  VELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 779

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840
            CI ELDNLNAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 780  CIRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 839

Query: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899

Query: 901  DDTVRTSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIV 960
            D+TVRTS+NGIVQFTYGGDGLDPL+MEGNAKPVNF RSWDHA NIT+N ++ G+LPY+I+
Sbjct: 900  DNTVRTSSNGIVQFTYGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQIL 959

Query: 961  RETDNVLKPLEEKLIRYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAARLA 1020
             ET+ +L PLE++L RYDN+G  +   L ++E Y D+HDAER FY+SLR YM EKA +LA
Sbjct: 960  EETNAILHPLEQQLSRYDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLA 1019

Query: 1021 QIRNTRGLLEMTQNGGDTSMEVVSSELQA--------SVDQVYKITKKNVNAFLTIALHK 1072
             I  +RGL E+       ++E+   +L A        SV+Q+ KI+ K V  FL IA+ K
Sbjct: 1020 DITKSRGLKELYHA---PALELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISK 1076

Query: 1073 YHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVIS 1132
            Y +AKVEPGTAVGAIGA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVIS
Sbjct: 1077 YRKAKVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVIS 1136

Query: 1133 TPIINAVLVNEGDERAARVVKGRIEKTLLSDLAFYIQDVYRGNMSYLEIRVDLATIEKLQ 1192
            TPIINA LVN+ DERAARVVKGR+EKTLLSD+ FYIQDVYR NMS+L+++VDLATIEKLQ
Sbjct: 1137 TPIINATLVNDDDERAARVVKGRVEKTLLSDVIFYIQDVYRDNMSFLQVKVDLATIEKLQ 1196

Query: 1193 LELTMEDIAVALSRAPKLKIQTTDIHILGKDKIHVNVYPEGMKAKSISTSAKEPSENEVF 1252
            LELT+EDIA+A++ APKLKI T D+ I+G++KI++NV  +  KAKSIST A EP EN+VF
Sbjct: 1197 LELTVEDIAIAITSAPKLKISTGDVSIVGRNKININVCNDLDKAKSISTLASEPHENDVF 1256

Query: 1253 YKMQTLRRSLPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTITN 1312
            +KMQ LRR+LP +VVKGLPDISRAVINIRDDGKRELLVEGYGLR+VM TDGV+G KT TN
Sbjct: 1257 FKMQHLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKTN 1316

Query: 1313 HVLEVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLS 1372
            H LEV  VLGIEAAR SI+ EIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLS
Sbjct: 1317 HFLEVYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLS 1376

Query: 1373 KMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVVKYNDVS 1432
            KMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM++GTGSFKVVK  ++S
Sbjct: 1377 KMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVVKGTNIS 1436

Query: 1433 ERDLKVRPTLFESLASETAIKAN 1455
              DLK +PTLFE+L S   +K N
Sbjct: 1437 PDDLKPKPTLFENLCSLNTLKVN 1459

>KLLA0E21253g Chr5 (1896457..1900830) [4374 bp, 1457 aa] {ON} highly
            similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1457

 Score = 2448 bits (6344), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1173/1460 (80%), Positives = 1288/1460 (88%), Gaps = 8/1460 (0%)

Query: 1    MKEVVVGETQKKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGV 60
            MKE V+    KKI GI FSAL+AADIV+QSEVEI+TRDLFDL+ GR  K GGALD RMGV
Sbjct: 1    MKETVIDIAPKKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGV 60

Query: 61   SSSSQECMTCHGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDR 120
            SSS  EC TCHGNLASCHGHFGHIKLALPVFHVGYFK+TIQILQ +CK C A+LLS++D+
Sbjct: 61   SSSQAECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDK 120

Query: 121  RDFLKELRRPGIDNLRKMSILKKVIDQCKKQRRCLKCXXXXXXXXXXXXXXXXXSLKIIH 180
            R FL ELRRPG+DNLR+M+ILKK++DQCKKQRRC +C                 +LKIIH
Sbjct: 121  RKFLTELRRPGMDNLRRMNILKKILDQCKKQRRCFECGELNGVVKKAAAGSGSAALKIIH 180

Query: 181  DTFRWVGKKMVPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCE 240
            DTFRWVGKK  PEK++WIG+W ++L ++PELER+VKRC DDLNPLK L LFKQ+K  DCE
Sbjct: 181  DTFRWVGKKSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCE 240

Query: 241  LLGINSTVRSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGI+ST +SGRPETYIWRYLPAPPVCIRPSV MQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLAKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360
            AGL KGISINNMME WDYLQL VAMYINSDSVNP+MLPG+S  G K KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSS--GTKSKPIRGFCQRLKGK 358

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAK+LT+PEKVTRYNK KLQQL+
Sbjct: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLV 418

Query: 421  INGPTVHPGANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSL 480
            INGP VHPGANYLLKKNE+ARRNLRYGD++KLAK LQYGDVVERH+EDGDVVLFNRQPSL
Sbjct: 419  INGPKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSL 478

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 538

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFD   LTQLLSMMSD+ LQFDIPPP+IMKP
Sbjct: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMKP 598

Query: 601  YYLWTGKQVFSLLIRPNKKSPVVINLDAKNKVYIPPKDKSFPNEMSINDGFVIIRGSEIL 660
            +YLWTGKQVFSLLI+P++KSPVVINLDAKNKVY+PP  K +PNEMS NDGFV+IRGS IL
Sbjct: 599  HYLWTGKQVFSLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNIL 658

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPS 720
            SGVMDKSVLGDGKKHSVFYTILRDYGP EAA  MNRMAKLCARYLGNRGFSIGI+DVTP 
Sbjct: 659  SGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGINDVTPG 718

Query: 721  SDLRDKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
            SDL+ KKE+MV  AYAKCDELID+F  GKLETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 719  SDLKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840
            CI ELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 779  CIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 838

Query: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 839  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 898

Query: 901  DDTVRTSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIV 960
            D+TVRTS+NGIVQFTYGGDGLDPLDMEGNA+PVNF RSW HA N+T N N  GLLPY+I+
Sbjct: 899  DNTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLLPYQII 958

Query: 961  RETDNVLKPLEEKLIRYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAARLA 1020
             ET+ +L+PLE KL RYDN+G  + KE    + Y D+ DAER+FY+SLR +M EKA  LA
Sbjct: 959  AETNVILQPLENKLKRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLA 1018

Query: 1021 QIRNTRGLLEMTQNGGDTSMEV-----VSSELQASVDQVYKITKKNVNAFLTIALHKYHR 1075
             +R  RGL E+     +   E      V + +  +++Q+ KI+K  V  FL+IA+ KYHR
Sbjct: 1019 SLRGERGLKELVDEPAEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHR 1078

Query: 1076 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1135
            A+VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1079 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138

Query: 1136 INAVLVNEGDERAARVVKGRIEKTLLSDLAFYIQDVYRGNMSYLEIRVDLATIEKLQLEL 1195
            INAVLVN+ DERAARVVKGR+EKTLLSD++FY+QD+YR NM++L+I++D  TIEKLQLEL
Sbjct: 1139 INAVLVNDNDERAARVVKGRVEKTLLSDVSFYVQDIYRDNMAFLQIKIDSETIEKLQLEL 1198

Query: 1196 TMEDIAVALSRAPKLKIQTTDIHILGKDKIHVNVYPEGMKAKSISTSAKEPSENEVFYKM 1255
            T+EDI VA+++APKLKI T DI I+GKDKI++ V  +G   KSIST+ KEP  NEVFY+M
Sbjct: 1199 TLEDIVVAIAKAPKLKIGTNDISIIGKDKINIAVSSDGKSMKSISTAMKEPEPNEVFYRM 1258

Query: 1256 QTLRRSLPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTITNHVL 1315
            Q LRR+LP +VVKG  DISRAVINIRDDGKRELLVEGYGLR+VM TDGVIGSKT TNH+L
Sbjct: 1259 QQLRRALPHIVVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHIL 1318

Query: 1316 EVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1375
            EV  VLGIEAAR+ I+ EIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGL+KMR
Sbjct: 1319 EVYDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMR 1378

Query: 1376 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVVKYNDVSERD 1435
            DSVLQLASFEKTTDHLFDAAFYMK DAVEGVSECIILGQTMS+GTGSFKVVK   V E D
Sbjct: 1379 DSVLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVVKNTVVGEND 1438

Query: 1436 LKVRPTLFESLASETAIKAN 1455
            L  +PTLFE+L  +T +KAN
Sbjct: 1439 LTPKPTLFETLC-DTVVKAN 1457

>Ecym_5525 Chr5 complement(1063773..1068152) [4380 bp, 1459 aa] {ON}
            similar to Ashbya gossypii AER252C
          Length = 1459

 Score = 2429 bits (6295), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1160/1461 (79%), Positives = 1297/1461 (88%), Gaps = 8/1461 (0%)

Query: 1    MKEVVVGETQKKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGV 60
            MKEVVV    KKI G+ FSAL+A+DIVAQSEVEI TRDLFDLE GR  K GGALD +MGV
Sbjct: 1    MKEVVVDVAPKKIKGLHFSALSASDIVAQSEVEIFTRDLFDLENGRAPKQGGALDSKMGV 60

Query: 61   SSSSQECMTCHGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDR 120
            SSS  EC TCHGNLASCHGHFGHIKLALPVFH+GYFK+TIQILQ ICK+C+A+LLS++++
Sbjct: 61   SSSQAECSTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQSICKNCAAILLSEEEK 120

Query: 121  RDFLKELRRPGIDNLRKMSILKKVIDQCKKQRRCLKCXXXXXXXXXXXXXXXXXSLKIIH 180
            R FL ELRRPGIDNLR+M+ L+KV+DQCKKQRRCL C                 +LKIIH
Sbjct: 121  RQFLAELRRPGIDNLRRMATLRKVLDQCKKQRRCLHCGALNGVVKKAATGSGSAALKIIH 180

Query: 181  DTFRWVGKKMVPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCE 240
            DTFRWVGKK  PEK++WIG+WN++L H+PELER++KR  D+LNPLKTL LFKQ++++DCE
Sbjct: 181  DTFRWVGKKSAPEKEKWIGDWNQVLQHNPELERYMKRSMDNLNPLKTLNLFKQVRAQDCE 240

Query: 241  LLGINSTVRSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGI+STV++GRPETYIWRYLPAPPVCIRPSV MQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLAKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360
            AGL KGISINNMME WDYLQ+ VAMYINSDSVNPA++PG + GG     IRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGTGGGKTKP-IRGFCQRLKGK 359

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAKVLT+PE+VTRYNK KLQQLI
Sbjct: 360  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPERVTRYNKHKLQQLI 419

Query: 421  INGPTVHPGANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSL 480
            INGP VHPGANY+LKKNE+ARRNLRYGD++KLAKN+Q GDVVERH+EDGDVVLFNRQPSL
Sbjct: 420  INGPNVHPGANYMLKKNEDARRNLRYGDRIKLAKNIQIGDVVERHIEDGDVVLFNRQPSL 479

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFDIPPPAIMKP 600
            LLTPKSGEPII+ATQDFITGSYLISHKDSFFD  + TQLLSMM+DA +QFD+PPPAI+KP
Sbjct: 540  LLTPKSGEPIISATQDFITGSYLISHKDSFFDRATFTQLLSMMADANMQFDLPPPAIIKP 599

Query: 601  YYLWTGKQVFSLLIRPNKKSPVVINLDAKNKVYIPPKDKSFPNEMSINDGFVIIRGSEIL 660
             YLWTGKQVFSLLIRPNKKSPV+INLDAKNKVY+PPK+KSFPNEMS NDG+VIIRGSEIL
Sbjct: 600  CYLWTGKQVFSLLIRPNKKSPVIINLDAKNKVYLPPKNKSFPNEMSSNDGYVIIRGSEIL 659

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPS 720
             GVMDKSVLGDGKKHSVFYTILRD+GP EAA  MNRMAKLCARYLGNRGFSIGI+DVTP 
Sbjct: 660  CGVMDKSVLGDGKKHSVFYTILRDFGPYEAAKAMNRMAKLCARYLGNRGFSIGINDVTPG 719

Query: 721  SDLRDKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
             +L+ KKEEMV  AYAKCDELID+FK G+LETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 720  KELKAKKEEMVEIAYAKCDELIDLFKRGELETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840
            CI ELDNLNAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 780  CIRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFAKNSK 839

Query: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVR+SFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 840  TPQSKGFVRSSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899

Query: 901  DDTVRTSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIV 960
            D+TVRTS+NG+VQFTYGGDGLDPL+MEGNA+PVNF RSWDHA NITFN  E GLLPY+I+
Sbjct: 900  DNTVRTSSNGVVQFTYGGDGLDPLNMEGNAQPVNFNRSWDHANNITFNNEEPGLLPYQIM 959

Query: 961  RETDNVLKPLEEKLIRYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAARLA 1020
              ++++L PLE +L+R DN+G  +  +L  ++ Y D++DAER FY+SLR YM  KA RLA
Sbjct: 960  ETSNSILVPLERQLLRLDNVGNAISADLGSNDEYIDQNDAERDFYQSLRTYMTAKAHRLA 1019

Query: 1021 QIRNTRGLLEMTQNGG------DTSMEVVSSELQASVDQVYKITKKNVNAFLTIALHKYH 1074
            QIR ++GL  + +         D      +++L  S++Q+ KI+   V  FL IA+ KYH
Sbjct: 1020 QIRKSKGLKSLLEEPAQELKYMDLDASASTADLN-SINQLCKISYNLVTTFLNIAISKYH 1078

Query: 1075 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1134
            +AKVEPGTAVGAIGA SIGEPGTQMTLKTFHFAGVASMN+TLGVPRIKEIINASKVISTP
Sbjct: 1079 KAKVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASKVISTP 1138

Query: 1135 IINAVLVNEGDERAARVVKGRIEKTLLSDLAFYIQDVYRGNMSYLEIRVDLATIEKLQLE 1194
            IINA+LVN+ DERAARVVKGRIEKTLLSD+ FYIQDVYR NMS+++++VDL+TIEKLQLE
Sbjct: 1139 IINALLVNDNDERAARVVKGRIEKTLLSDVVFYIQDVYRDNMSFIQVKVDLSTIEKLQLE 1198

Query: 1195 LTMEDIAVALSRAPKLKIQTTDIHILGKDKIHVNVYPEGMKAKSISTSAKEPSENEVFYK 1254
            LT+EDIA+A+SRAPKLKI T D+ I+GK+KI+++V  +  K KSIST   EP+EN+VFY+
Sbjct: 1199 LTIEDIAIAISRAPKLKISTGDVSIIGKNKINISVGNDLEKGKSISTLVSEPNENDVFYR 1258

Query: 1255 MQTLRRSLPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTITNHV 1314
            MQ LRR+LP++VVKGLPDISRAVINI +DGKRELLVEGYGLR+VM TDGVIG KT TNH 
Sbjct: 1259 MQHLRRALPNIVVKGLPDISRAVINILEDGKRELLVEGYGLRDVMTTDGVIGYKTKTNHF 1318

Query: 1315 LEVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1374
            LEV  VLGIEAAR SI+ EIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM
Sbjct: 1319 LEVFEVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1378

Query: 1375 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVVKYNDVSER 1434
            RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMS+GTGSFKVV+  ++S  
Sbjct: 1379 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVRGTNISMD 1438

Query: 1435 DLKVRPTLFESLASETAIKAN 1455
            +LK  PTLFE+L + TA+K +
Sbjct: 1439 ELKPNPTLFENLCNNTALKVS 1459

>TPHA0H01760 Chr8 complement(402254..406633) [4380 bp, 1459 aa] {ON}
            Anc_5.426 YOR116C
          Length = 1459

 Score = 2427 bits (6291), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1160/1454 (79%), Positives = 1297/1454 (89%), Gaps = 9/1454 (0%)

Query: 1    MKEVVVGETQKKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGV 60
            MKEVV+ ET K+ISG+EFSAL+ +DI+AQSEVEI+TRDLFDLE GR    GGALD +MGV
Sbjct: 1    MKEVVISETPKRISGLEFSALSTSDIIAQSEVEISTRDLFDLENGRAPIEGGALDPKMGV 60

Query: 61   SSSSQECMTCHGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDR 120
            SSS+ EC TCHGNLASCHGHFGHIKL+LPVFHVGYFK+TIQILQ +CK CSA+LL+D D+
Sbjct: 61   SSSTLECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQILQGVCKSCSAILLNDTDK 120

Query: 121  RDFLKELRRPGIDNLRKMSILKKVIDQCKKQRRCLKCXXXXXXXXXXXXXXXXXSLKIIH 180
            R FL ELR+P IDNL++MSILKK++DQCKKQRRCL+C                 SLKIIH
Sbjct: 121  RHFLHELRKPDIDNLKRMSILKKILDQCKKQRRCLECGDLNGVVKRAATGSGSASLKIIH 180

Query: 181  DTFRWVGKKMVPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCE 240
            DTFRWVGKK VPEKD+WIG+WN++LT++PELE+F+KRC+DDLNPLKTL LFKQ+K+EDCE
Sbjct: 181  DTFRWVGKKNVPEKDKWIGDWNQVLTNNPELEKFIKRCTDDLNPLKTLNLFKQIKNEDCE 240

Query: 241  LLGINSTVRSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGI+STV SGRPETYIWRYLPAPPVCIRPSV MQDS ASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVASGRPETYIWRYLPAPPVCIRPSVMMQDSSASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLAKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360
            AGL KGISINNMMEHWDYLQL+VAMYINSDSVN  ++PG S+GG K KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLSVAMYINSDSVNLLVMPG-SNGGTKAKPIRGFCQRLKGK 359

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP+LVAKVLT+PEKVTRYNK KLQ+L+
Sbjct: 360  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPELVAKVLTYPEKVTRYNKTKLQKLV 419

Query: 421  INGPTVHPGANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSL 480
            +NGP VHPGANYLLK NEEARRNLRYG++ KLAK L+ GD+VERHLEDGD+VLFNRQPSL
Sbjct: 420  MNGPNVHPGANYLLKSNEEARRNLRYGNRDKLAKQLRIGDIVERHLEDGDIVLFNRQPSL 479

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHV-PQTEEARAEAINLMGVKN 539
            HRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNL    QTEEARAEAINLMGVKN
Sbjct: 480  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLLCYQQTEEARAEAINLMGVKN 539

Query: 540  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFDIPPPAIMK 599
            NLLTPKSGEPIIAATQDFITGSYLISHKDSFFD  +LTQLLSMMSDA L+FDIPPPAI K
Sbjct: 540  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDANLKFDIPPPAIFK 599

Query: 600  PYYLWTGKQVFSLLIRPNKKSPVVINLDAKNKVYIPPKDKSFPNEMSINDGFVIIRGSEI 659
            P  LWTGKQ+FSLLI+PNK+SPVVINLDAKNKVYIPP++KS+P+EMS NDG+VIIRGSEI
Sbjct: 600  PQCLWTGKQIFSLLIKPNKESPVVINLDAKNKVYIPPQNKSWPSEMSPNDGYVIIRGSEI 659

Query: 660  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTP 719
            LSGVMDKSVLGDGKKHSVFYTILRDYGPQE+AN MNRMAKLCARYLGNRGFSIGISDVTP
Sbjct: 660  LSGVMDKSVLGDGKKHSVFYTILRDYGPQESANAMNRMAKLCARYLGNRGFSIGISDVTP 719

Query: 720  SSDLRDKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGD 779
              +L+ KKE++V  AY KCDELI  +  G+LETQPGCNEEQTLEAKIGGLLSKVREEVGD
Sbjct: 720  GEELKLKKEDLVEIAYKKCDELIIQYNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGD 779

Query: 780  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNS 839
            VCINELDNLNAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF+KNS
Sbjct: 780  VCINELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFEKNS 839

Query: 840  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 899
            KTPQSKGFVRNSFF+GLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ
Sbjct: 840  KTPQSKGFVRNSFFTGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 899

Query: 900  YDDTVRTSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEI 959
            YD+T+RTS+NGIVQFTYGGDGLDPLDMEGNAKPVNF R+WDHA NITF+ N  GLLPY+I
Sbjct: 900  YDNTIRTSSNGIVQFTYGGDGLDPLDMEGNAKPVNFKRTWDHASNITFDFNAKGLLPYQI 959

Query: 960  VRETDNVLKPLEEKLIRYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAARL 1019
            +++T+ +L+PLE  L+RY+N+G  + K+    + Y D+ DA+R FY S+R YM EKA +L
Sbjct: 960  IKQTNLILQPLENALVRYNNVGKPLSKKDYHKDEYVDQLDAKRDFYASIREYMVEKAEQL 1019

Query: 1020 AQIRNTRGLLEMTQNGGDTSMEV-----VSSELQASVDQVYKITKKNVNAFLTIALHKYH 1074
            A+IR  R L E+     +    +     + S ++  VD++ KI++ NV  FL IA+ KYH
Sbjct: 1020 AKIRKARSLKELISEPAEELQHIDFDENIPSNVREVVDKLCKISEANVKKFLEIAISKYH 1079

Query: 1075 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1134
            RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTP
Sbjct: 1080 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTP 1139

Query: 1135 IINAVLVNEGDERAARVVKGRIEKTLLSDLAFYIQDVYRGNMSYLEIRVDLATIEKLQLE 1194
            II AVLVN+ D RAARVVKGRIEKTLLSD+A+YI+DVYR N +++ I++DL+TIEKLQLE
Sbjct: 1140 IIKAVLVNDSDRRAARVVKGRIEKTLLSDVAYYIEDVYRDNRTFIRIKIDLSTIEKLQLE 1199

Query: 1195 LTMEDIAVALSRAPKLKIQTTDIHILGKDKIHVNVYPEGMKAKSISTSAKEPSENEVFYK 1254
            LT+EDIA+A+S+APKLKI +++IHI+G DKI ++V+ E   +KSISTS KE SEN VFYK
Sbjct: 1200 LTIEDIAIAISKAPKLKIDSSNIHIVGNDKIAIDVFEEA--SKSISTSLKESSENTVFYK 1257

Query: 1255 MQTLRRSLPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTITNHV 1314
            MQTLRR+LPDVVVKGL DISRAVINI+DD K ELLVEGYGLR+VMCTDGVIG+KT TNH+
Sbjct: 1258 MQTLRRALPDVVVKGLADISRAVINIKDDSKTELLVEGYGLRDVMCTDGVIGTKTSTNHI 1317

Query: 1315 LEVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1374
            LE+ +VLGIEAAR+SIVGEIDYTMSNHGMSVDPRHIQLLGDVMT+KGEVLGITRFGLSKM
Sbjct: 1318 LEIFNVLGIEAARSSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKM 1377

Query: 1375 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVVKYNDVSER 1434
            RDSVLQLASFEKTTDHLFDAAFYMKKD V+GVSECIILGQTMS+GTGSF VVK+  VS  
Sbjct: 1378 RDSVLQLASFEKTTDHLFDAAFYMKKDEVKGVSECIILGQTMSIGTGSFNVVKHTVVSPE 1437

Query: 1435 DLKVRPTLFESLAS 1448
             +K + TLFESL S
Sbjct: 1438 QVKPKRTLFESLVS 1451

>Kwal_55.21459 s55 (846902..850348) [3447 bp, 1148 aa] {ON} YOR116C
            (RPO31) - RNA polymerase III large subunit [contig 130]
            FULL
          Length = 1148

 Score = 1950 bits (5052), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 926/1145 (80%), Positives = 1015/1145 (88%), Gaps = 6/1145 (0%)

Query: 1    MKEVVVGETQKKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGV 60
            MKEVVV    K+I G+EFSAL+A+DIV QS+VEI+TRDLFDLE GR+ K+GGALD RMGV
Sbjct: 1    MKEVVVDIAPKRIKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60

Query: 61   SSSSQECMTCHGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDR 120
            SSS  EC TCHGNLASCHGHFGHIKL+LPVFHVGYFK+TIQ+LQ ICK C+A+LLS++D+
Sbjct: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDK 120

Query: 121  RDFLKELRRPGIDNLRKMSILKKVIDQCKKQRRCLKCXXXXXXXXXXXXXXXXXSLKIIH 180
            R FL ELRRPGIDNLR+M ILKKV+DQCKKQRRCL+C                 SLKI+H
Sbjct: 121  RQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNGVVKKAAAGSGSASLKILH 180

Query: 181  DTFRWVGKKMVPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCE 240
            DTFRWVGKK  PEKD+W+G+W  +L+H+PELER+VK+C DDLNPLKTL LFKQ+  EDCE
Sbjct: 181  DTFRWVGKKSAPEKDKWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLNLFKQVSPEDCE 240

Query: 241  LLGINSTVRSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            L+GI+STV+SGRPETYIWRYLPAPPVCIRPSV MQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLAKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360
            AGL KGISINNMME WDYLQL VAMYINSDSVNPAM+PG S+GG K KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGG-KTKPIRGFCQRLKGK 359

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLI 420
            QGRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVP  VAKVLT+PE VTRYNK KLQQL+
Sbjct: 360  QGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQLV 419

Query: 421  INGPTVHPGANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSL 480
            INGP  HPGANYLLKK+EEARRNLRYGD++KLAKNLQYGD+VERHLEDGDVVLFNRQPSL
Sbjct: 420  INGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQPSL 479

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 480  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+      QLLSMMSD  +QFDIPPPAIMKP
Sbjct: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPPAIMKP 599

Query: 601  YYLWTGKQVFSLLIRPNKKSPVVINLDAKNKVYIPPKDKSFPNEMSINDGFVIIRGSEIL 660
            YY+WTGKQVFSLLIRPNKKS VVINLDAKNKVYIPPK K  PNEMSINDGFV+IRGS+IL
Sbjct: 600  YYMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIRGSQIL 659

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPS 720
            SGVMDKSVLGDGKKHSVFYTILRD+GP+EAA  MNRMAKLCARYLGNRGFSIGI+DVTP 
Sbjct: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGINDVTPG 719

Query: 721  SDLRDKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
             +L++KKE MV  AYAKCD+LID F  GKLETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 720  FELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840
            CI ELDNLN+ LIMA CGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 780  CIKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSK 839

Query: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899

Query: 901  DDTVRTSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIV 960
            D+T+RTS+NGIVQFTYGGDGLDP+DMEGNA+PVNF RSWDHA NITFN ++  LLPY+I+
Sbjct: 900  DNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIM 959

Query: 961  RETDNVLKPLEEKLIRYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAARLA 1020
            ++T+++L+PLEEKL+RYDNLG  +   L D   + D+ DAER FYKSLR Y+  KA+ LA
Sbjct: 960  QQTNSILQPLEEKLVRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLREYLHTKASHLA 1019

Query: 1021 QIRNTRGLLEMTQNGGD--TSMEV---VSSELQASVDQVYKITKKNVNAFLTIALHKYHR 1075
            +IR+ +GL +          SM++     S L ASVDQ+ KI+ K V  FL IA+ KYH+
Sbjct: 1020 KIRSHKGLKQFLDEPAPELQSMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYHK 1079

Query: 1076 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1135
            AKVEPGTAVGA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1080 AKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1139

Query: 1136 INAVL 1140
            INAVL
Sbjct: 1140 INAVL 1144

>Ecym_8065 Chr8 (139544..144775) [5232 bp, 1743 aa] {ON} similar to
            Ashbya gossypii ADR086C
          Length = 1743

 Score =  724 bits (1870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/1491 (34%), Positives = 759/1491 (50%), Gaps = 132/1491 (8%)

Query: 11   KKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGVSSSSQECMTC 70
            + I  ++F   +  ++ A S  +I   +  D E     K GG  D R+G    + +C TC
Sbjct: 12   RTIKEVQFGLFSPEEVRAISVAKIEFPETMD-ETQMRAKVGGLNDPRLGSIDRNYKCQTC 70

Query: 71   HGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDRRDFLKELRRP 130
               +  C GHFGHI+LA PVFH+G+     ++ +C+C  C  +LL      D   EL R 
Sbjct: 71   GEGMNDCPGHFGHIELAKPVFHIGFISKIKKVCECVCMHCGKLLL------DEYNELMRQ 124

Query: 131  GIDNLRKMSILKKVIDQCKKQRRCLKCXXXXXXXXXXXXXXXXXSLKIIHDTFRWVGKKM 190
             I           V   CK +   + C                        + R  G  +
Sbjct: 125  AIKIKDPKRRFNAVWSLCKSK---MVCDTEVPSEDDPSKYISRGGCGNAQPSIRKDGLSL 181

Query: 191  VPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCELLGINSTVRS 250
            V     W  + N   +  PE     KR    L+  + L +FK +  ED   LG N     
Sbjct: 182  V---GTWKKDKNSEDSDQPE-----KRI---LSAEEILNVFKHITPEDSLRLGFNEDF-- 228

Query: 251  GRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIKAGLAKGISIN 310
             RPE  I   LP PP  +RPS++  +S    EDDLT KL +I+  +  ++     G   +
Sbjct: 229  ARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTYKLGDILKANINVQRLEINGSPQH 287

Query: 311  NMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGKQGRFRGNLSG 370
             + E    LQ  VA Y+++D    A  P A    G+  PI+    RLKGK+GR RGNL G
Sbjct: 288  VIQESESLLQFHVATYMDNDI---AGQPQAVQKSGR--PIKSIRARLKGKEGRIRGNLMG 342

Query: 371  KRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLIINGPTVHPGA 430
            KRVDFS RTVIS DPNL +D+V VP+ +AK LT+PE VT YN  +L QL+ NGP  HPGA
Sbjct: 343  KRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHPGA 402

Query: 431  NYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSLHRLSILSHYA 490
             Y+++ N + R +LRY  +    + LQYG  VERH+ D D VLFNRQPSLH++S+++H  
Sbjct: 403  KYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIIDNDPVLFNRQPSLHKMSMMAHRV 460

Query: 491  KIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGEPI 550
            K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P+S +P 
Sbjct: 461  KVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPQQIVSPQSNKPC 520

Query: 551  IAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFD--IPPPAIMKPYYLWTGKQ 608
            +   QD + G   ++ +D+F +L  +  +L  + D    +D  IP P I+KP  LW+GKQ
Sbjct: 521  MGIVQDTLCGIRKMTLRDTFIELDQVLNMLYWIPD----WDGVIPKPTILKPKPLWSGKQ 576

Query: 609  VFSLLIRPNKKSPVVINLDAKNKVYIPPKDKSFPNEMSINDGFVIIRGSEILSGVMDKSV 668
            + S+ I PN    + +    +   Y+ PKD          +G +II G +I+ GV+DK  
Sbjct: 577  LLSMAI-PNG---IHLQRFDEGTTYLSPKD----------NGMLIIDG-QIIFGVVDKKT 621

Query: 669  LGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPSSDLRDKKE 728
            +G      + + + R+ GPQ  A     + K+   +L + GFSIGI D         +  
Sbjct: 622  VG-SSSGGLIHVVTREKGPQVCAKLFGNIQKVVNYWLLHNGFSIGIGDTIADEKTMREIT 680

Query: 729  EMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELDNL 788
            E +  A  +  E+    +   L  + G    ++ E  +   L++ R++ G      L +L
Sbjct: 681  EAIALAKKRVQEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRSAELNLRDL 740

Query: 789  NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKTPQSKGFV 848
            N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P+SKGFV
Sbjct: 741  NNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLPHFSKDDYSPESKGFV 800

Query: 849  RNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDDTVRTSA 908
             NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD T R S 
Sbjct: 801  ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDGTTRNSL 860

Query: 909  NGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACN----ITFNKNETGLLPYEIVRETD 964
              I+QF YG DG+D   +E   + ++ I   D A      I     E GL P  +   T+
Sbjct: 861  GNIIQFVYGEDGMDASHIE--KQSIDTIPGSDLAFEKRYRIDLLNPEYGLDPSLLESATE 918

Query: 965  --------NVLKPLEEKLIRYDNLGAVV-------------PKELIDDERYADRHDAERA 1003
                    N+L    ++L++   L   V              + +I + +   R D  + 
Sbjct: 919  IMGDLKLQNMLDEEYKQLVQDRQLLRSVFLDGEHNWPLPVNIRRIIQNAQQTFRIDTTKP 978

Query: 1004 ---FYKSLRMYMQEKAARLAQIRNTRGLLEMTQNGGDTSM-EVVSSELQA-SVDQVYKIT 1058
                 K + + +++    L  +R +  +L+  Q    T    +V S L    V   Y++T
Sbjct: 979  TDLTIKDVVLGVRKLQDNLLVLRGSSNILKEAQENAVTLFCSLVRSRLATRRVLTEYRLT 1038

Query: 1059 KKNVNAFLTIALHKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGV 1118
            K+     L     ++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVAS  VT GV
Sbjct: 1039 KQTFQWVLNNIEAQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGV 1098

Query: 1119 PRIKEIINASKVISTPIINAVLVNE---GDERAARVVKGRIEKTLLSDLAFYIQDVYRGN 1175
            PR+KEI+N +K + TP +  V +NE    D+  A++++  IE T L  +    +  Y  +
Sbjct: 1099 PRLKEILNVAKNMKTPSL-TVYLNEDYAADQEKAKLIRSAIEHTTLKSVTVSSEIYYDPD 1157

Query: 1176 MSYLEIRVDLATIE--------------------KLQLEL---TMEDIAVALSRAPKLKI 1212
             S   I  D   I+                     L+LEL    M D  + + +  + KI
Sbjct: 1158 PSSTVIEEDEEIIQLHFSLMDEETENSLKHQSPWLLRLELDRAAMNDKDLTMGQVGE-KI 1216

Query: 1213 QTT---DIHILGKDKIHVNVYPEGMKAKSIST--SAKEPSENEVFYKMQTLRRSLPDVVV 1267
            + T   D+ ++  +    N+       +   T  +  E  E+ +  K++     L  + +
Sbjct: 1217 KETFKNDLFVIWSEDNAENLIIRCRVVRDPKTLDAEAEAEEDHMLKKIENTM--LESITL 1274

Query: 1268 KGLPDISRAVINIRD------DGKRE------LLVEGYGLREVMCTDGVIGSKTITNHVL 1315
            +G+ DI+R V+   D       G+        L  +G  L EVM   GV  ++  TN  +
Sbjct: 1275 RGVQDITRVVMMKYDRKVPNETGEYHKVPEWVLETDGVNLSEVMTVPGVDPTRIYTNSFI 1334

Query: 1316 EVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1375
            ++ +VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +G ++ +TR G ++  
Sbjct: 1335 DIMNVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTSQGFLMSVTRHGFNRAD 1394

Query: 1376 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVV 1426
               L   SFE+T + LF+A    + D   GVSE +ILGQ   +GTG+F V+
Sbjct: 1395 TGALMRCSFEETVEILFEAGASAELDDCNGVSENVILGQMAPIGTGAFDVM 1445

>ZYRO0F05918g Chr6 (487056..492290) [5235 bp, 1744 aa] {ON} highly
            similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140C
          Length = 1744

 Score =  723 bits (1866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/1498 (33%), Positives = 767/1498 (51%), Gaps = 147/1498 (9%)

Query: 11   KKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGVSSSSQECMTC 70
            + +  ++F   +  +I A S  +I   +  D  + R  K GG  D R+G    S +C TC
Sbjct: 12   RTVKEVQFGLFSPEEICAISVAKIKFPETMDETQTR-AKIGGLNDPRLGSIDRSLKCQTC 70

Query: 71   HGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDRRDFLKELRRP 130
               +  C GHFGHI+LA PVFH+G+     ++ +C+C  C  +LL + +      E  R 
Sbjct: 71   QEGMNECPGHFGHIELAKPVFHIGFISKIKKVCECVCMHCGKLLLDEHN------EQMRQ 124

Query: 131  GIDNLRKMSILKKVIDQCKKQRRCLKCXXXXXXXXXXXXXXXXXSLKIIHDTFRWVGKKM 190
             I           V   CK +   + C                        T R  G K+
Sbjct: 125  AIKIKDSKKRFNAVWSLCKAK---MICDTDVPSDEDPTQLISRGGCGNAQPTIRRDGLKL 181

Query: 191  VPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCELLGINSTVRS 250
            V     W  + N      PE     +R    LN  + L +FK +  ED   LG N     
Sbjct: 182  V---GSWKKDKNSGDNEEPE-----QRV---LNMEEILNIFKHISPEDSWKLGFNEEF-- 228

Query: 251  GRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIKAGLAKGISIN 310
             RPE  I   LP PP  +RPS++  +S    EDDLT KL +I+  +  ++     G   +
Sbjct: 229  ARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHNGAPHH 287

Query: 311  NMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGKQGRFRGNLSG 370
             + E    LQ  VA Y+++D    A  P A    G+  P++    RLKGK+GR RGNL G
Sbjct: 288  TIEEAESLLQFHVATYMDNDI---AGQPQALQKSGR--PVKSIRARLKGKEGRIRGNLMG 342

Query: 371  KRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLIINGPTVHPGA 430
            KRVDFS RTVIS DPNL +D+V VP+ +AK LT+PE VT YN  +L  L+ NGP  HPGA
Sbjct: 343  KRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTMLVRNGPNEHPGA 402

Query: 431  NYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSLHRLSILSHYA 490
             Y+++ N + R +LRY  +    + LQYG  VERH+ D D VLFNRQPSLH++S+++H  
Sbjct: 403  KYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHVIDNDPVLFNRQPSLHKMSMMAHKV 460

Query: 491  KIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGEPI 550
            K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P+S +P 
Sbjct: 461  KVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPQQIVSPQSNKPC 520

Query: 551  IAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFD--IPPPAIMKPYYLWTGKQ 608
            +   QD + G   ++ +D+F +LG +  +L  + D    +D  IP PAI+KP  LWTGKQ
Sbjct: 521  MGVVQDTLCGIRKLTLRDNFIELGQVLNMLYWVPD----WDGVIPTPAILKPKPLWTGKQ 576

Query: 609  VFSLLIRPNKKSPVVINLDA--KNKVYIPPKDKSFPNEMSINDGFVIIRGSEILSGVMDK 666
            + S+ I      P  I+L    +    + PKD          +G ++I G +I+ GV+DK
Sbjct: 577  LLSVAI------PKGIHLQRFDEGTTLLSPKD----------NGMLVIDG-QIIFGVVDK 619

Query: 667  SVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPSSDLRDK 726
              +G      + + + R+ GPQ  A   + + K+   +  + GFS GI D         +
Sbjct: 620  KTVGSSSG-GLIHVVTREKGPQVCATLFSNIQKVVNYWFLHCGFSTGIGDTIADGQTMRQ 678

Query: 727  KEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELD 786
              E +  A  K +++    +   L  + G    ++ E  +   L++ R++ G +    L+
Sbjct: 679  ITEAIAEAKVKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEARDKAGRLAEVNLN 738

Query: 787  NLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKTPQSKG 846
            + N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P+SKG
Sbjct: 739  DTNFVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKG 798

Query: 847  FVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDDTVRT 906
            FV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD T R 
Sbjct: 799  FVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDGTTRN 858

Query: 907  SANGIVQFTYGGDGLDPLDMEGNAKPVNFI----RSWDHACNITFNKNETGLLPYEIVRE 962
            S   I+QF YG DG+D   +E  A  V  I    R+++    I     +  L P  ++  
Sbjct: 859  SLGNIIQFIYGEDGMDAAHIEKQA--VETIGGSDRNFERRYRIDLLNPDYSLDP-SLLES 915

Query: 963  TDNVLKPLEEKLIRYDNLGAVVPKELIDDERYADR-------------------HDAERA 1003
               ++  L+ + +  +       K+L++D ++  R                    +A++ 
Sbjct: 916  GSEIIGDLKLQSLLDEEY-----KQLVEDRKFLRRIFVDGEVNWPLPVNIRRIIQNAQQT 970

Query: 1004 F-----------YKSLRMYMQEKAARLAQIRNTRGLLEMTQNGGDTSMEVVSSELQAS-- 1050
            F            + +   ++E   RL  +R    +++  Q    T    +     AS  
Sbjct: 971  FRIDRSKPSDVTIRDVVWGVKELQERLLVVRGNSRIIKEAQEDAITLFCCLMRSRLASRR 1030

Query: 1051 VDQVYKITKKNVNAFLTIALHKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVA 1110
            V Q Y++TK+     L     ++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVA
Sbjct: 1031 VIQEYRLTKQAFEWVLNNIEVQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVA 1090

Query: 1111 SMNVTLGVPRIKEIINASKVISTPIINAVLVNE--GDERAARVVKGRIEKTLLSDLA--- 1165
            S  VT GVPR+KEI+N +K + TP + A L  +   D+  A++++  IE T L  +    
Sbjct: 1091 SKKVTSGVPRLKEILNVAKNMKTPSLTAYLEPDYAADQEKAKLIRSVIEHTTLKSVTVAS 1150

Query: 1166 --FYIQD-----------VYRGNMSYLEIRVDLATIEK----LQLEL---TMEDIAVALS 1205
              +Y  D           + + + S L+   + +  ++    L+LEL    M D  + + 
Sbjct: 1151 EIYYDPDPRSTAIPEDEEIIQLHFSLLDDETEKSLAQQSPWLLRLELDRAAMNDKDLTMG 1210

Query: 1206 RAPKLKIQTT---DIHILGKD--KIHVNVYPEGMKAKSISTSAKEPSENEVFYKMQTLRR 1260
            +  + KI+ T   D+ ++  +     + +    ++ KS+     E  E+ +  K++    
Sbjct: 1211 QVGE-KIKETFKNDLFVIWSEDNAEQLIIRCRVVRPKSMDLET-EAEEDHMLKKIENTM- 1267

Query: 1261 SLPDVVVKGLPDISRAVINIRD------DGKRE------LLVEGYGLREVMCTDGVIGSK 1308
             L ++ ++G+ +I R V+   D       G+ +      L  +G  L EVM   GV  S+
Sbjct: 1268 -LENITLRGVENIERVVMMKYDRKVPSETGEYQKIPEWVLETDGVNLSEVMTVPGVDASR 1326

Query: 1309 TITNHVLEVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITR 1368
              TN  +++  VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +G +  +TR
Sbjct: 1327 IYTNSFIDIMEVLGIEAGRAALYKEVFNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTR 1386

Query: 1369 FGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVV 1426
             G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   +GTG+F V+
Sbjct: 1387 HGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDVM 1444

>TPHA0A03070 Chr1 complement(671766..676925) [5160 bp, 1719 aa] {ON}
            Anc_7.314 YDL140C
          Length = 1719

 Score =  722 bits (1864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/1510 (34%), Positives = 772/1510 (51%), Gaps = 171/1510 (11%)

Query: 11   KKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGVSSSSQECMTC 70
            + +  ++F   +  ++ + S  +I   +  D  + R  K GG  D R+G    + +C TC
Sbjct: 12   RTVKEVQFGLFSPEEVRSISVAKIKFPETMDETQTR-AKIGGLNDPRLGSIDRNLKCQTC 70

Query: 71   HGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDRRDFLKELRRP 130
               +  C GHFGHI LA PVFH+G+     ++ +CIC  C  +LL + +     +++R+ 
Sbjct: 71   QEGMNECPGHFGHIDLAKPVFHIGFISKIKKVCECICMHCGKLLLDENN-----EQMRQV 125

Query: 131  -GIDNLRKMSILKKVIDQCKKQRRCLKCXXXXXXXXXXXXXXXXXSLKIIHDTFRWVGKK 189
              I + +K      +   CK +     C                        T R  G K
Sbjct: 126  MSIKDSKKR--FNAIWTLCKTK---TVCETDVPSEDDPTQLISRGGCGNAQPTIRKDGLK 180

Query: 190  MVPEKDRWIGEW--NEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCELLGINST 247
            +V       G W  ++      E E+ V      LN  + L +FK +   D   LG N  
Sbjct: 181  LV-------GSWKKDKATNDGDEPEQRV------LNTEEILNIFKHISVHDSNTLGFNEQ 227

Query: 248  VRSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIKAGLAKGI 307
                RP+  I   LP PP  +RPS++  +S    EDDLT KL +I+  +  ++     G 
Sbjct: 228  F--ARPDWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHNGA 284

Query: 308  SINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGKQGRFRGN 367
              + + E    LQ  +A Y+++D    A  P A    G+  P++    RLKGK+GR RGN
Sbjct: 285  PHHAIEEAESLLQFHIATYMDNDI---AGQPQALQKSGR--PVKSIRARLKGKEGRIRGN 339

Query: 368  LSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLIINGPTVH 427
            L GKRVDFS RTVIS DPNL +D+V VP+ +AK LT+PE VT YN  +L QL+ NGP  H
Sbjct: 340  LMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEH 399

Query: 428  PGANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSLHRLSILS 487
            PGA Y+++ N + R +LRY  +    + LQYG  VERH+ D D VLFNRQPSLH++S+++
Sbjct: 400  PGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLHKMSMMA 457

Query: 488  HYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSG 547
            H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P+S 
Sbjct: 458  HRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCSVPLQIVSPQSN 517

Query: 548  EPIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFD--IPPPAIMKPYYLWT 605
            +P +   QD + G   ++ +D F +L  L  +L  + D    +D  IP PAI+KP  LW+
Sbjct: 518  KPCMGIVQDTLCGIRKLTLRDCFIELDQLLNMLYWVPD----WDGIIPTPAIIKPVPLWS 573

Query: 606  GKQVFSLLIRPNKKSPVVINLDA--KNKVYIPPKDKSFPNEMSINDGFVIIRGSEILSGV 663
            GKQ+ S+ I      P  I+L    +    + PKD          +G +II G +I+ GV
Sbjct: 574  GKQILSIAI------PKGIHLQRFDEGTTMLSPKD----------NGMLIIDG-QIIFGV 616

Query: 664  MDKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPSSDL 723
            +DK  +G      + + + R+ GPQ  A     + K+   +  + GFS GI D       
Sbjct: 617  VDKKTVGSSNG-GLIHVVTREKGPQICAKMFGNIQKVVNFWFLHNGFSTGIGDTIADGGT 675

Query: 724  RDKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCIN 783
              +  E +  A  K +E+    +   L  + G    ++ E  +   L++ R++ G +   
Sbjct: 676  MKEITETIADAKRKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAEV 735

Query: 784  ELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKTPQ 843
             L++LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P+
Sbjct: 736  NLNDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPE 795

Query: 844  SKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDDT 903
            SKGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD T
Sbjct: 796  SKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDST 855

Query: 904  VRTSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEI-VRE 962
             R S   ++QF YG DG+D   +E   + ++ I   D A    F K       Y I +  
Sbjct: 856  TRNSLGNVIQFVYGEDGIDAGHIE--KQSIDTIGGSDAA----FEKR------YRIDLMS 903

Query: 963  TDNVLKP--LEEKL-----IRYDNLGAVVPKELIDDERYADR------------------ 997
             ++ L P  LE  L     ++  ++     K+L+DD R+                     
Sbjct: 904  PNHALDPSLLESGLEITGDVKLQSILDTEYKQLVDDRRFLRNVFIDGEPNWHLPVNIRRI 963

Query: 998  -HDAERAF----YKSLRMYMQE---KAARLAQ----IRNTRGLLEMTQNGGDTSM-EVVS 1044
              +A++ F     K   + + E     ARL +    +R    ++E  QN   T    +V 
Sbjct: 964  IQNAQQTFRIDHTKPSDLTINEVIRDVARLQENLLVLRGKGKIIEEAQNDAITLFCCLVR 1023

Query: 1045 SELQA-SVDQVYKITKKNVNAFLTIALHKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKT 1103
            S L    V Q Y++TK+     L     ++ R+ V PG  VG + AQSIGEP TQMTL T
Sbjct: 1024 SRLAVRRVLQEYRLTKQAFQWVLNNIESQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNT 1083

Query: 1104 FHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVNE--GDERAARVVKGRIEKTLL 1161
            FHFAGVAS  VT GVPR+KEI+N +K + TP     L  E   D+  A++++  IE T L
Sbjct: 1084 FHFAGVASKKVTSGVPRLKEILNVAKNMKTPSSTVYLDPEYATDQEKAKIIRSAIEHTTL 1143

Query: 1162 SDLA-----FY---------------IQDVYRGNMSYLEIRVDLATIEKLQLEL---TME 1198
              +      +Y               IQ  Y    S  E  +D  +   L+LEL    M 
Sbjct: 1144 KSVTVASEIYYDPDPTTTVIAEDEEIIQLHYSLMDSETEKNIDNQSPWLLRLELDRAAMN 1203

Query: 1199 DIAVALSRAPKLKIQTT---DIHIL----GKDKIHVN---VYPEGMKAKSISTSAKEPSE 1248
            D  + + +  + KI+ T   D+ ++      DK+ +    V P+ + A++      E  E
Sbjct: 1204 DKDLTMVQVGE-KIKETFRNDLSVIWSEDNADKLIIRCRVVRPKSLDAET------EAEE 1256

Query: 1249 NEVFYKMQTLRRSLPDVVVKGLPDISRAVINIRD------DGKRE------LLVEGYGLR 1296
            + +  K++     L  + ++G+ DI R V+   D       G+ +      L  +G  L 
Sbjct: 1257 DHMLKKIENTM--LESITLRGVEDIERVVMMKYDRKMPSETGEYQKVPEWVLETDGVNLM 1314

Query: 1297 EVMCTDGVIGSKTITNHVLEVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDV 1356
            EVM   GV GS+  TN  +++  VLGIEA RA++  E+   +++ G  V+ RH+ LL DV
Sbjct: 1315 EVMTVPGVDGSRIYTNSFIDITEVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDV 1374

Query: 1357 MTYKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM 1416
            MT +G +  +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ  
Sbjct: 1375 MTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMA 1434

Query: 1417 SVGTGSFKVV 1426
             +GTG+F V+
Sbjct: 1435 PIGTGAFDVM 1444

>Suva_4.104 Chr4
            complement(193257..193711,193754..193782,194161..198878)
            [5202 bp, 1733 aa] {ON} YDL140C (REAL)
          Length = 1733

 Score =  717 bits (1851), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/1503 (33%), Positives = 769/1503 (51%), Gaps = 157/1503 (10%)

Query: 11   KKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGVSSSSQECMTC 70
            + +  ++F   +  ++ A S  +I   +  D  + R  K GG  D R+G    + +C TC
Sbjct: 12   RTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTR-AKIGGLNDPRLGSIDRNLKCQTC 70

Query: 71   HGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDRRDFLKELRRP 130
               +  C GHFGHI LA PVFHVG+     ++ +C+C  C  +LL + +      EL R 
Sbjct: 71   QEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHN------ELMRQ 124

Query: 131  GIDNLRKMSILKKVIDQCKKQRRCLKCXXXXXXXXXXXXXXXXXSLKIIHDTFRWVGKKM 190
             +           +   CK +   + C                        T R  G K+
Sbjct: 125  ALAIKDTKKRFGAIWTLCKTK---MVCETDVPSENDPTQLVSRGGCGNTQPTVRKDGLKL 181

Query: 191  VP--EKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCELLGINSTV 248
            V   +KDR  G+ +E     PEL          L+  + L +FK + ++D   LG N   
Sbjct: 182  VGSWKKDRATGDADE-----PELRV--------LSTEEILNIFKHISAKDSSSLGFNEVF 228

Query: 249  RSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIKAGLAKGIS 308
               RPE  I   LP PP  +RPS++  +S    EDDLT KL +I+  +  ++     G  
Sbjct: 229  --SRPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHNGAP 285

Query: 309  INNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGKQGRFRGNL 368
             + + E    LQ  VA Y+++D    A  P A    G+  P++    RLKGK+GR RGNL
Sbjct: 286  HHAIEEAESLLQFHVATYMDNDI---AGQPQALQKSGR--PVKSIRARLKGKEGRIRGNL 340

Query: 369  SGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLIINGPTVHP 428
             GKRVDFS RTVIS DPNL +D+V VP+ +AK LT+PE VT YN  +L QL+ NGP  HP
Sbjct: 341  MGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP 400

Query: 429  GANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSLHRLSILSH 488
            GA Y+++ + + R +LRY  +    + LQYG  VERH+ D D VLFNRQPSLH++S+++H
Sbjct: 401  GAKYVIRDSGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAH 458

Query: 489  YAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGE 548
              K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P+S +
Sbjct: 459  RVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNK 518

Query: 549  PIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFD--IPPPAIMKPYYLWTG 606
            P +   QD + G   ++ +D+F +L  +  +L  + D    +D  IP PAI+KP  LW+G
Sbjct: 519  PCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPD----WDGVIPTPAIIKPKPLWSG 574

Query: 607  KQVFSLLIRPNKKSPVVINLDAKNKVYIPPKDKSFPNEMSINDGFVIIRGSEILSGVMDK 666
            KQV S+ I PN    + +    +    + PKD          +G +II G +I+ GV++K
Sbjct: 575  KQVLSVAI-PNG---IHLQRFDEGTTLLSPKD----------NGMLIIDG-QIVFGVVEK 619

Query: 667  SVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPSSDLRDK 726
              +G      + + + R+ GPQ  A     + K+   +L + GFS GI D         +
Sbjct: 620  KTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMRE 678

Query: 727  KEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELD 786
              E +  A  K  ++    +   L  + G    ++ E  +   L++ R++ G +    L 
Sbjct: 679  ITETIADAKKKVFDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAEVNLK 738

Query: 787  NLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKTPQSKG 846
            +LN    M   GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P+SKG
Sbjct: 739  DLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAYGFVDRTLPHFSKDDYSPESKG 798

Query: 847  FVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDDTVRT 906
            FV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD+T R 
Sbjct: 799  FVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRN 858

Query: 907  SANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFN---KNETGLLPYEIVRET 963
            S   ++QF YG DG+D   +E  +  ++ I   D A    +     N   +L   ++   
Sbjct: 859  SLGNVIQFIYGEDGMDASHIEKQS--LDTIGGSDAAFEKRYRIDLLNPDHILDPSLLESG 916

Query: 964  DNVLKPLEEKLIRYDNLGAVVPKELIDDERYADRH-----DAERAFYKSLRMYMQEKAAR 1018
              +L  L+ +++  +       K+L+ D  +  RH     +A      ++R  +Q  A +
Sbjct: 917  SEILGDLKLQVLLDEEY-----KQLVKDRSFL-RHIFVDGEANWPLPVNIRRIIQ-NAQQ 969

Query: 1019 LAQIRNT------------------------RGLLEMTQNGGDTSMEVVSSELQA----- 1049
               I +T                        RG  E+ QN    ++ +    L++     
Sbjct: 970  TFHIDHTKPSDLTIKDIVIGVKDLQENLLVLRGKNEIIQNAQQDAVTLFCCLLRSRLASR 1029

Query: 1050 SVDQVYKITKKNVNAFLTIALHKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGV 1109
             V Q YK+TK+     L+    ++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGV
Sbjct: 1030 RVIQEYKLTKQAFEWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGV 1089

Query: 1110 ASMNVTLGVPRIKEIINASKVISTPIINAVLV--NEGDERAARVVKGRIEKTLLSDLA-- 1165
            AS  VT GVPR+KEI+N +K + TP +   L   +  D+  A+ ++  IE T L  +   
Sbjct: 1090 ASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEKAKFIRSAIEHTTLKSVTIA 1149

Query: 1166 ---FYIQD-----------VYRGNMSYL----EIRVDLATIEKLQLEL---TMEDIAVAL 1204
               +Y  D           + + + S L    E   D  +   L+LEL    M D  + +
Sbjct: 1150 SEIYYDPDPRSTVIPEDEEIIQLHFSLLDDEAEQSFDQQSPWLLRLELDRAAMNDKDLTM 1209

Query: 1205 SRAPKLKIQT--TDIHIL----GKDKIHVN---VYPEGMKAKSISTSAKEPSENEVFYKM 1255
             +  +   QT   D+ ++      +K+ +    V P+ + A++      E  E+ +  K+
Sbjct: 1210 GQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAET------EAEEDHMLKKI 1263

Query: 1256 QTLRRSLPDVVVKGLPDISRAVINIRD------------DGKRELLVEGYGLREVMCTDG 1303
            +     L ++ ++G+ +I R V+   D            + +  L  +G  L EVM   G
Sbjct: 1264 ENTM--LENITLRGVENIERVVMMKYDRKVPSPTGEYIKEPEWVLETDGVNLSEVMTVPG 1321

Query: 1304 VIGSKTITNHVLEVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEV 1363
            +  ++  TN  +++  VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +G +
Sbjct: 1322 IDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGL 1381

Query: 1364 LGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSF 1423
              +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   +GTG+F
Sbjct: 1382 TSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAF 1441

Query: 1424 KVV 1426
             V+
Sbjct: 1442 DVM 1444

>Smik_4.95 Chr4 complement(182198..187357) [5160 bp, 1719 aa] {ON}
            YDL140C (REAL)
          Length = 1719

 Score =  715 bits (1845), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/1496 (33%), Positives = 769/1496 (51%), Gaps = 143/1496 (9%)

Query: 11   KKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGVSSSSQECMTC 70
            + +  ++F   +  ++ A S  +I   +  D  + R  K GG  D R+G    + +C TC
Sbjct: 12   RTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTR-AKIGGLNDPRLGSIDRNLKCQTC 70

Query: 71   HGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDRRDFLKELRRP 130
               +  C GHFGHI LA PVFHVG+     ++ +C+C  C  +LL + +      EL R 
Sbjct: 71   QEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHN------ELMRQ 124

Query: 131  GIDNLRKMSILKKVIDQCKKQRRCLKCXXXXXXXXXXXXXXXXXSLKIIHDTFRWVGKKM 190
             +           +   CK +   + C                        T R  G K+
Sbjct: 125  ALAIKDSKKRFAAIWTLCKTK---MVCETDVPSEDDPTQLVSRGGCGNTQPTVRKDGLKL 181

Query: 191  VP--EKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCELLGINSTV 248
            V   +KDR  G+  E     PEL          L+  + L +FK +  +D   LG N   
Sbjct: 182  VGSWKKDRASGDAEE-----PELRV--------LSTEEILNIFKHISVKDFTSLGFNEVF 228

Query: 249  RSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIKAGLAKGIS 308
               RPE  I   LP PP  +RPS++  +S    EDDLT KL +I+  +  ++     G  
Sbjct: 229  --SRPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHNGAP 285

Query: 309  INNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGKQGRFRGNL 368
             + + E    LQ  VA Y+++D    A  P A    G+  P++    RLKGK+GR RGNL
Sbjct: 286  HHAIEEAESLLQFHVATYMDNDI---AGQPQALQKSGR--PVKSIRARLKGKEGRIRGNL 340

Query: 369  SGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLIINGPTVHP 428
             GKRVDFS RTVIS DPNL +D+V VP+ +AK LT+PE VT YN  +L QL+ NGP  HP
Sbjct: 341  MGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP 400

Query: 429  GANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSLHRLSILSH 488
            GA Y+++ + + R +LRY  +    + LQYG  VERH+ D D VLFNRQPSLH++S+++H
Sbjct: 401  GAKYVIRDSGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAH 458

Query: 489  YAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGE 548
              K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P+S +
Sbjct: 459  RVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNK 518

Query: 549  PIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFD--IPPPAIMKPYYLWTG 606
            P +   QD + G   ++ +D+F +L  +  +L  + D    +D  IP PAI+KP  LW+G
Sbjct: 519  PCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPD----WDGVIPTPAIIKPKPLWSG 574

Query: 607  KQVFSLLIRPNKKSPVVINLDAKNKVYIPPKDKSFPNEMSINDGFVIIRGSEILSGVMDK 666
            KQ+ S+ I PN    + +    +    + PKD          +G +II G +I+ GV++K
Sbjct: 575  KQILSVAI-PNG---IHLQRFDEGTTLLSPKD----------NGMLIIDG-QIIFGVVEK 619

Query: 667  SVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPSSDLRDK 726
              +G      + + + R+ GPQ  A     + K+   +L + GFS GI D         +
Sbjct: 620  KTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMRE 678

Query: 727  KEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELD 786
              E +  A  K  ++    +   L  + G    ++ E  +   L++ R++ G +    L 
Sbjct: 679  ITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAEVNLK 738

Query: 787  NLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKTPQSKG 846
            +LN    M   GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P+SKG
Sbjct: 739  DLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKG 798

Query: 847  FVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDDTVRT 906
            FV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD+T R 
Sbjct: 799  FVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRN 858

Query: 907  SANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFN---KNETGLLPYEIVRET 963
            S   ++QF YG DG+D   +E  +  ++ I   D A    +     N   +L   ++   
Sbjct: 859  SLGNVIQFIYGEDGMDAAHIEKQS--LDTIGGSDAAFEKRYRIDLLNTEHILDPSLLESG 916

Query: 964  DNVLKPLEEKLIRYDNLGAVVPKELIDDERYADR--------------HDAERAFY---- 1005
              +L  L+ +++  +    +V       E + D                +A++ F+    
Sbjct: 917  SEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNIRRIIQNAQQTFHIDHT 976

Query: 1006 KSLRMYMQEKAARLAQIRNT----RGLLEMTQNGGDTSMEVVSSELQA-----SVDQVYK 1056
            K   + +++    +  ++ +    RG  E+ QN    ++ +    L++      V Q Y+
Sbjct: 977  KPSDLTIKDIVLGVKDLQGSLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYR 1036

Query: 1057 ITKKNVNAFLTIALHKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTL 1116
            +TK+  +  L+    ++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVAS  VT 
Sbjct: 1037 LTKQAFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTS 1096

Query: 1117 GVPRIKEIINASKVISTPIINAVLV--NEGDERAARVVKGRIEKTLLSDLA-----FYIQ 1169
            GVPR+KEI+N +K + TP +   L   +  D+  A++++  IE T L  +      +Y  
Sbjct: 1097 GVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDP 1156

Query: 1170 D-----------VYRGNMSYL----EIRVDLATIEKLQLEL---TMEDIAVALSRAPKLK 1211
            D           + + + S L    E   D  +   L+LEL    M D  + + +  +  
Sbjct: 1157 DPRSTVIPEDEEIIQLHFSLLDDEAEQSFDQQSPWLLRLELDRAAMNDKDLTMGQVGERI 1216

Query: 1212 IQT--TDIHIL----GKDKIHVN---VYPEGMKAKSISTSAKEPSENEVFYKMQTLRRSL 1262
             QT   D+ ++      +K+ +    V P+ + A++      E  E+ +  K++     L
Sbjct: 1217 KQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAET------EAEEDHMLKKIENTM--L 1268

Query: 1263 PDVVVKGLPDISRAVINIRD------------DGKRELLVEGYGLREVMCTDGVIGSKTI 1310
             ++ ++G+ +I R V+   D            + +  L  +G  L EVM   G+  ++  
Sbjct: 1269 ENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDATRIY 1328

Query: 1311 TNHVLEVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFG 1370
            TN  +++  VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +G +  +TR G
Sbjct: 1329 TNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHG 1388

Query: 1371 LSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVV 1426
             ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   +GTG+F V+
Sbjct: 1389 FNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDVM 1444

>ADR086C Chr4 complement(860406..865643) [5238 bp, 1745 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDL140C
            (RPO21)
          Length = 1745

 Score =  715 bits (1846), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/1496 (34%), Positives = 760/1496 (50%), Gaps = 142/1496 (9%)

Query: 11   KKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGVSSSSQECMTC 70
            + I  ++F   +  ++ A S  +I   +  D E     K GG  D R+G    + +C TC
Sbjct: 12   RTIKEVQFGLFSPEEVRAISVAKIEFPETMD-ETQMRAKVGGLNDPRLGSIDRNFKCQTC 70

Query: 71   HGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDRRDFLKELRRP 130
               +  C GHFGHI+LA PVFH+G+     ++ +C+C  C  +LL      D   EL R 
Sbjct: 71   GEGMNDCPGHFGHIELAKPVFHIGFISKIKKVCECVCMHCGKLLL------DEYNELMRQ 124

Query: 131  GIDNLRKMSILKKVIDQCKKQRRCLKCXXXXXXXXXXXXXXXXXSLKIIHDTFRWVGKKM 190
             I           V   CK +   + C                        + R  G  +
Sbjct: 125  AIKIKDPKRRFNAVWSLCKAK---MVCDTEVPSEDDPSKYISRGGCGNAQPSIRKDGLSL 181

Query: 191  VPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCELLGINSTVRS 250
            V     W  + N      PE     KR    ++  + L +FK +  ED   LG N     
Sbjct: 182  V---GTWKKDKNAEDADQPE-----KRI---ISAEEILNVFKHISPEDSWRLGFNEDF-- 228

Query: 251  GRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIKAGLAKGISIN 310
             RPE  +   LP PP  +RPS++  +S    EDDLT KL +I+  +  ++     G   +
Sbjct: 229  SRPEWMLLTVLPVPPPPVRPSISFNES-QRGEDDLTYKLGDILKANINVQRLEINGSPQH 287

Query: 311  NMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGKQGRFRGNLSG 370
             + E    LQ  VA Y+++D    A  P A    G+  PI+    RLKGK+GR RGNL G
Sbjct: 288  VIQESESLLQFHVATYMDNDI---AGQPQAVQKSGR--PIKSIRARLKGKEGRIRGNLMG 342

Query: 371  KRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLIINGPTVHPGA 430
            KRVDFS RTVIS DPNL +D+V VP+ +AK LT+PE VT YN  +L QL+ NGP  HPGA
Sbjct: 343  KRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHPGA 402

Query: 431  NYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSLHRLSILSHYA 490
             Y+++ N + R +LRY  +    + LQYG  VERH+ D D VLFNRQPSLH++S+++H  
Sbjct: 403  KYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDDDPVLFNRQPSLHKMSMMAHRV 460

Query: 491  KIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGEPI 550
            K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P+S +P 
Sbjct: 461  KVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPC 520

Query: 551  IAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFD--IPPPAIMKPYYLWTGKQ 608
            +   QD + G   ++ +D+F +L  +  +L  + D    +D  IP P I+KP  LW+GKQ
Sbjct: 521  MGIVQDTLCGIRKMTLRDTFIELDQVLNMLYWIPD----WDGVIPTPTILKPKPLWSGKQ 576

Query: 609  VFSLLIRPNKKSPVVINLDA--KNKVYIPPKDKSFPNEMSINDGFVIIRGSEILSGVMDK 666
            + S+ I      P  I+L    +   Y+ PKD          +G +II G +I+ GV+DK
Sbjct: 577  LLSMAI------PSGIHLQRFDEGTTYLSPKD----------NGMLIIDG-QIIFGVVDK 619

Query: 667  SVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPSSDLRDK 726
              +G      + + + R+ GP+  A     + K+   +L + GFSIGI D         +
Sbjct: 620  KTVGSSSG-GLIHVVTREKGPEVCAKLFGNIQKVVNYWLLHNGFSIGIGDTIADEKTMRE 678

Query: 727  KEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELD 786
              + +  A  K +E+    +   L  + G    ++ E  +   L++ R++ G      L 
Sbjct: 679  ITDAIALAKKKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEARDKAGRSAEVNLK 738

Query: 787  NLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKTPQSKG 846
            +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P+SKG
Sbjct: 739  DLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLPHFSKDDYSPESKG 798

Query: 847  FVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDDTVRT 906
            FV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD T R 
Sbjct: 799  FVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDGTTRN 858

Query: 907  SANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHAC-----------NITFNKN--ETG 953
            S   I+QF YG DG+D   +E  +  ++ I   D A            N   + N  E+G
Sbjct: 859  SLGNIIQFVYGEDGMDAAHIEKQS--IDTIPGSDLAFEKRYRIDLLNPNYALDPNLLESG 916

Query: 954  LLPYEIVRE--TDNVLKPLEEKLIR-------------YDNLGAVVPKELIDDERYADRH 998
                EIV +    N+L    ++L++             ++    V  + +I + +   R 
Sbjct: 917  T---EIVGDLKLQNLLDEEYKQLVQDRHFLRKIFMDGEHNWPLPVNIRRIIQNAQQTFRI 973

Query: 999  DAERAFYKSLRMYMQEKAARLAQIRNTRGLLEMTQNGGDTSMEVVSSELQA-----SVDQ 1053
            D+ +    S++  +Q       ++   RG  ++ Q   + ++ +    L++      V  
Sbjct: 974  DSTKPTDLSIQDVVQGVRGLQERLLVLRGKSQILQEAQENAITLFCCLLRSRLATRRVIT 1033

Query: 1054 VYKITKKNVNAFLTIALHKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMN 1113
             Y++TK+     L     ++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVAS  
Sbjct: 1034 EYRLTKQTFEWVLNNIEAQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKK 1093

Query: 1114 VTLGVPRIKEIINASKVISTPIINAVLVNE--GDERAARVVKGRIEKTLLSDLAFYIQDV 1171
            VT GVPR+KEI+N +K + TP +   L      D+  A++++  IE T L  +    +  
Sbjct: 1094 VTSGVPRLKEILNVAKNMKTPSLTVYLEESYATDQEKAKLIRSAIEHTTLKSVPVASEIY 1153

Query: 1172 YRGNMSYLEIRVDLATIEKLQLELTMEDIAVALS-RAPKL------KIQTTD-------- 1216
            Y  + S   I  D   I+ L   L  E+   +L  ++P L      ++  TD        
Sbjct: 1154 YDPDPSSTVIEEDEEIIQ-LHFSLMDEETEASLKHQSPWLLRLELDRVAMTDKDLTMGQV 1212

Query: 1217 ---IHILGKDKIHVNVYPEGMKAKSIS-----------TSAKEPSENEVFYKMQTLRRSL 1262
               I    K+ + V ++ E    K I             +  E  E+ +  K++     L
Sbjct: 1213 GEKIKETFKNDLFV-IWSEDNAEKLIIRCRVVRDPKTLDAEAEAEEDHMLKKIENTM--L 1269

Query: 1263 PDVVVKGLPDISRAVINIRD------DGKRE------LLVEGYGLREVMCTDGVIGSKTI 1310
              + ++G+ DI+R V+   D       G+        L  +G  L EVM   GV  ++  
Sbjct: 1270 ESITLRGVQDITRVVMMKYDRKVPSETGEYHKIPEWVLETDGVNLSEVMSVPGVDPTRIY 1329

Query: 1311 TNHVLEVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFG 1370
            TN  +++ +VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +G ++ +TR G
Sbjct: 1330 TNSFIDIMNVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTSQGFLMSVTRHG 1389

Query: 1371 LSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVV 1426
             ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   +GTGSF V+
Sbjct: 1390 FNRADTGALMRCSFEETVEILFEAGAAAELDDCSGVSENVILGQMAPIGTGSFDVM 1445

>TBLA0F02170 Chr6 (535350..540530) [5181 bp, 1726 aa] {ON} Anc_7.314
            YDL140C
          Length = 1726

 Score =  713 bits (1841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/1509 (34%), Positives = 766/1509 (50%), Gaps = 169/1509 (11%)

Query: 11   KKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGVSSSSQECMTC 70
            + I  ++F   +  +I A S  +I   +  D  + R  K GG  D R+G    + +C TC
Sbjct: 12   RTIKEVQFGLFSPEEIRAISVAKIRFPETMDETQTR-AKIGGLNDPRLGSIDRNLKCQTC 70

Query: 71   HGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDR--RDFLKELR 128
               +  C GHFGHI LA PVFH+G+     ++ +CIC  C  +LL + +   R  LK   
Sbjct: 71   QEGMNECPGHFGHIDLAKPVFHIGFISKIKKVCECICMHCGKLLLDEHNEQMRQILK--- 127

Query: 129  RPGIDNLRKMSILKKVIDQCKKQRRCLKCXXXXXXXXXXXXXXXXXSLKIIHDTFRWVGK 188
               I + +K      +   CK +   + C                        T R  G 
Sbjct: 128  ---IKDSKKR--FNAIWSLCKTK---MICDTDVPSEHDPTQLVSRGGCGNAQPTVRKDGL 179

Query: 189  KMVPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCELLGINSTV 248
            K+V     W  E N      PE +R        L+  + L +FK +  ED   +G N   
Sbjct: 180  KLV---GSWKKEKNTSDGDEPE-QRI-------LSTEEILNIFKHISPEDSIAMGFNEEF 228

Query: 249  RSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIKAGLAKGIS 308
               RPE      LP PP  +RPS++  +S    EDDLT KL +I+  +  ++     G  
Sbjct: 229  --SRPEWMFLTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHNGAP 285

Query: 309  INNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGKQGRFRGNL 368
             + + E    LQ  VA Y+++D    A  P A    G+  P++    RLKGK+GR RGNL
Sbjct: 286  HHAIEEAESLLQFHVATYMDNDI---AGQPQALQKSGR--PVKSIRARLKGKEGRIRGNL 340

Query: 369  SGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLIINGPTVHP 428
             GKRVDFS RTVIS DPNL +D+V VP+ +AK LT+PE VT YN  +L  L+ NGP  HP
Sbjct: 341  MGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTHLVRNGPNEHP 400

Query: 429  GANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSLHRLSILSH 488
            GA Y+++ N + R +LRY  +    + LQYG  VERH+ D D VLFNRQPSLH++S+++H
Sbjct: 401  GAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAH 458

Query: 489  YAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGE 548
              ++ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++ +S +
Sbjct: 459  RVRVMPFSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSAQSNK 518

Query: 549  PIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFD--IPPPAIMKPYYLWTG 606
            P +   QD + G   ++ +D+F +   +  LL  + D    +D  IP PAI+KP  LW+G
Sbjct: 519  PCMGIVQDTLCGIRKLTLRDNFIEFDQVLNLLYWVPD----WDGVIPTPAILKPKPLWSG 574

Query: 607  KQVFSLLIRPNKKSPVVINLDA--KNKVYIPPKDKSFPNEMSINDGFVIIRGSEILSGVM 664
            KQ+ S+ I      P  I+L    +   ++ PKD          +G +II G +I+ GV+
Sbjct: 575  KQILSIAI------PKGIHLQRFDEGTTFLSPKD----------NGMLIIDG-QIIFGVV 617

Query: 665  DKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPSSDLR 724
            DK  +G      + + + R+ GPQ  A   + + K+   +  + GFS GI D     +  
Sbjct: 618  DKKTVGSSSG-GLIHVVTREKGPQICAKLFSNIQKVTNYWFLHNGFSTGIGDTIADGETM 676

Query: 725  DKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINE 784
             +    +  A  K +E+    +   L  + G    ++ E  +   L++ R++ G +    
Sbjct: 677  REITGTIAEAKRKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAEVN 736

Query: 785  LDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKTPQS 844
            L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P+S
Sbjct: 737  LNDTNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPES 796

Query: 845  KGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDDTV 904
            KGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD T 
Sbjct: 797  KGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDSTT 856

Query: 905  RTSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEI-VRET 963
            R S   ++QF YG DG+D   +E   + ++ I   D A    F K       Y I +  T
Sbjct: 857  RNSLGNVIQFVYGEDGIDAGHIE--KQSIDTIGGSDAA----FEKR------YRIDLLNT 904

Query: 964  DNVLKP--LEEKL-----IRYDNLGAVVPKELIDDERYADR------------------- 997
            +N L P  LE        ++  NL  V  K+L+ D  +                      
Sbjct: 905  ENSLNPSLLESGAEISGNLKLQNLLDVEYKQLVKDRTFLRTVFVDGEPNWPLPVNIKRIV 964

Query: 998  HDAERAF-----------YKSLRMYMQEKAARLAQIRNTRGLLEMTQNGGDTSM-EVVSS 1045
             +A++ F              +   +Q+   +L  +R+   +++  Q+   T    ++ S
Sbjct: 965  QNAQQTFKVDHSKPSDLTIPDIVHGVQDLQEKLLVLRDKSEIMQKAQSDATTLFCCLIRS 1024

Query: 1046 ELQA-SVDQVYKITKKNVNAFLTIALHKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTF 1104
             L    V Q +K+ K++    L     ++ R+ V PG  VG + AQSIGEP TQMTL TF
Sbjct: 1025 RLATRRVLQEFKLNKQSFQWVLNNVEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTF 1084

Query: 1105 HFAGVASMNVTLGVPRIKEIINASKVISTPIINAVL--VNEGDERAARVVKGRIEKTLLS 1162
            HFAGVAS  VT GVPR+KEI+N +K + TP + A L      D+  A++++  IE T L 
Sbjct: 1085 HFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTAYLEPAYAADQEKAKLIRSAIEHTTLK 1144

Query: 1163 DLA-----FYIQD----VYRGNMSYLEIRVDLATIEK-----------LQLEL---TMED 1199
             +      +Y  D    V   +   +++   L   E            L+LEL    M D
Sbjct: 1145 SVTVASEIYYDPDPRTTVIAEDEEIMQLHFSLMDEETEKSLDQQSPWLLRLELDRAAMND 1204

Query: 1200 IAVALSRAPKLKIQTT---DIHIL----GKDKIHVN---VYPEGMKAKSISTSAKEPSEN 1249
              + + +  + KI+ T   D+ ++      +K+ +    V P+ + A++      E  E+
Sbjct: 1205 KDLTMGQVGE-KIRETFRNDLFVIWSEDNAEKLIIRCRVVRPKALDAET------EAEED 1257

Query: 1250 EVFYKMQTLRRSLPDVVVKGLPDISRAVINIRD------DGKRE------LLVEGYGLRE 1297
             +  K++     L ++ ++G+ +I R V+   D       G  E      L  +G  L E
Sbjct: 1258 HMLKKIENTM--LENITLRGVENIERVVMMKYDRKIPGTSGAYEKVPEWVLETDGVNLLE 1315

Query: 1298 VMCTDGVIGSKTITNHVLEVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVM 1357
            VM   GV  S+  TN  +++  VLGIEA RA++  E+   +++ G  V+ RH+ LL DVM
Sbjct: 1316 VMTVPGVDASRIYTNSFIDITEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVM 1375

Query: 1358 TYKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMS 1417
            T  G +  +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   
Sbjct: 1376 TTNGSLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAP 1435

Query: 1418 VGTGSFKVV 1426
            +GTGSF V+
Sbjct: 1436 IGTGSFDVM 1444

>KLLA0F05071g Chr6 complement(496371..501533) [5163 bp, 1720 aa] {ON}
            highly similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140C
          Length = 1720

 Score =  713 bits (1841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/1494 (34%), Positives = 762/1494 (51%), Gaps = 138/1494 (9%)

Query: 11   KKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGVSSSSQECMTC 70
            + I  ++F   +  ++   S  +I   +  D E   + K GG  D R+G    + +C TC
Sbjct: 12   RTIKEVQFGLFSPEEVRGISVAKIEFPETMD-ESQMKAKIGGLNDPRLGSIDRNYKCQTC 70

Query: 71   HGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDRRDFLKELRRP 130
               +A C GHFGHI+LA PVFH+G+     ++ + +C  C  +LL      D   E  R 
Sbjct: 71   GEGMAECPGHFGHIELAKPVFHIGFLSKIKKVCESVCMHCGKLLL------DEYNEQMRQ 124

Query: 131  GIDNLRKMSILKKVIDQCKKQRRCLKCXXXXXXXXXXXXXXXXXSLKIIHDTFRWVGKKM 190
             I           V   CK +   + C                     I  + R  G  +
Sbjct: 125  AIKIKDPKRRFNAVWTLCKAK---MVCETEVPSPDDPTVFLSRGGCGHIQPSIRKDGLSL 181

Query: 191  VPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCELLGINSTVRS 250
            V     W  + N   +  PE     KR    ++  + L +FK +  ED   LG N     
Sbjct: 182  V---GTWKKDKNADDSDQPE-----KRI---ISAEEILNVFKHISPEDGWRLGFNEDF-- 228

Query: 251  GRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIKAGLAKGISIN 310
             RPE  I   LP PP  +RPS++  +S    EDDLT KL +I+  +  ++     G   +
Sbjct: 229  SRPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTYKLGDILKANINVQKLEINGSPQH 287

Query: 311  NMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGKQGRFRGNLSG 370
             + E    LQ  VA Y+++D    A  P A    G+  PI+    RLKGK+GR RGNL G
Sbjct: 288  VIQESESLLQFHVATYMDNDI---AGQPQAVQKSGR--PIKSIRARLKGKEGRIRGNLMG 342

Query: 371  KRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLIINGPTVHPGA 430
            KRVDFS RTVIS DPNL +D+V VP+ +AK LT+PE VT YN  +L QL+ NGP  HPGA
Sbjct: 343  KRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHPGA 402

Query: 431  NYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSLHRLSILSHYA 490
             Y+++++ + R +LRY  +    + LQYG  VERH+ D D VLFNRQPSLH++S+++H  
Sbjct: 403  KYVIRESGD-RIDLRYSKRAGDIQ-LQYGWKVERHITDNDPVLFNRQPSLHKMSMMAHRV 460

Query: 491  KIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGEPI 550
            K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P+S +P 
Sbjct: 461  KVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPC 520

Query: 551  IAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFD--IPPPAIMKPYYLWTGKQ 608
            +   QD + G   ++ +D+F +L  +  +L  + D    +D  IP PAI+KP  LW+GKQ
Sbjct: 521  MGIVQDTLCGIRKMTLRDTFIELDQVLNMLYWIPD----WDGIIPTPAILKPVPLWSGKQ 576

Query: 609  VFSLLIRPNKKSPVVINLDAKNKVYIPPKDKSFPNEMSINDGFVIIRGSEILSGVMDKSV 668
            V S+ I PN    + +        ++ PKD          +G +II G +I+ GV+DK  
Sbjct: 577  VLSMAI-PNG---IHLQRFDDGTTFLSPKD----------NGMLIIDG-KIIFGVVDKKT 621

Query: 669  LGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPSSDLRDKKE 728
            +G      + + + R+ GP+  A   + + K+   +L + GFSIGI D         +  
Sbjct: 622  VG-SSSGGLIHVVTREKGPEICARLFSNIQKVVNYWLLHNGFSIGIGDTIADEKTMREIT 680

Query: 729  EMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELDNL 788
            E +  A  K +++    +   L  + G    ++ E  +   L++ R++ G      L +L
Sbjct: 681  EAIAVAKKKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEARDKAGRSAEVNLKDL 740

Query: 789  NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKTPQSKGFV 848
            N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P+SKGFV
Sbjct: 741  NNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLPHFSKDDYSPESKGFV 800

Query: 849  RNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDDTVRTSA 908
             NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD T R S 
Sbjct: 801  ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDGTTRNSL 860

Query: 909  NGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFN---KNETGLLPYEIVRETDN 965
              ++QF YG DG+D   +E  +  ++ I   D A    +     NE   L   ++     
Sbjct: 861  GNVIQFIYGEDGMDAAHIEKQS--IDTIPGSDSAFERRYRIDLLNEEYALDPSLLESGSE 918

Query: 966  VLKPLEEKLIRYDNLGAVVPKELIDDERYADR--HDAERAF--YKSLRMYMQ--EKAARL 1019
            ++   + +L+  D       K+L+DD +   R   D E  +    +++  +Q  ++  R+
Sbjct: 919  IIGDSKLQLLLNDEY-----KQLVDDRQILRRVFVDGEHNWPLPVNIKRIIQNSQQTFRI 973

Query: 1020 AQIRNT---------------------RG----LLEMTQNGGDTSMEVVSSELQA-SVDQ 1053
             Q + T                     RG    L E  QN       ++ S L    V +
Sbjct: 974  DQTKPTDLTIEDVISGVRKLQEKLLVVRGKSDILKEAQQNAITLFCCLLRSRLATRRVIE 1033

Query: 1054 VYKITKKNVNAFLTIALHKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMN 1113
             Y++ ++  +  L     ++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVAS  
Sbjct: 1034 EYRLNRQTFDWVLNNIEAQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKK 1093

Query: 1114 VTLGVPRIKEIINASKVISTPIINAVLVNE--GDERAARVVKGRIEKTLLSDLAFYIQDV 1171
            VT GVPR+KEI+N +K + TP +   L  E   D+  A+ ++  IE T L  +    +  
Sbjct: 1094 VTSGVPRLKEILNVAKNMKTPSLTVYLDPEYAADQEKAKEIRSAIEHTTLKSVTVASEIY 1153

Query: 1172 YRGNMSYLEIRVDLATIEKLQLELTMEDIAVALS-RAPKL------KIQTTD-------- 1216
            Y  +     I  D   I+ L   L  E+   +L  ++P L      +   TD        
Sbjct: 1154 YDPDPRSTVIEDDEEIIQ-LHFSLMDEETEKSLDYQSPWLLRLELDRAAMTDKDLTMGQV 1212

Query: 1217 ---IHILGKDKIHVNVYPEGMKAKSI--STSAKEPS------ENEVFYKMQTLRRS-LPD 1264
               I    K+ + V ++ E    K I      ++P       E E  + ++ +  S L  
Sbjct: 1213 GEKIKETFKNDLFV-IWSEDNAEKLIIRCRVIRDPKTLDADVEAEEDHMLKKIENSMLEK 1271

Query: 1265 VVVKGLPDISRAVINIRD------DGKRE------LLVEGYGLREVMCTDGVIGSKTITN 1312
            + ++G+ DI+R V+   D       G+        L  +G  L EVM   GV GS+  TN
Sbjct: 1272 ITLRGVEDITRVVMMKYDRKVPSETGEYHKVPEWVLETDGVNLSEVMTVSGVDGSRIYTN 1331

Query: 1313 HVLEVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLS 1372
              +++ +VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +G ++ +TR G +
Sbjct: 1332 SFIDIMNVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTSQGFLMSVTRHGFN 1391

Query: 1373 KMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVV 1426
            +     L   SFE+T + LF+A    + D   GVSE +ILGQ   +GTG+F V+
Sbjct: 1392 RADTGALMRCSFEETVEILFEAGAAAELDDCRGVSENVILGQMAPIGTGAFDVM 1445

>YDL140C Chr4 complement(205360..210561) [5202 bp, 1733 aa] {ON}
            RPO21RNA polymerase II largest subunit B220, part of
            central core; phosphorylation of C-terminal heptapeptide
            repeat domain regulates association with transcription
            and splicing factors; similar to bacterial beta-prime
          Length = 1733

 Score =  713 bits (1841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/1496 (33%), Positives = 768/1496 (51%), Gaps = 143/1496 (9%)

Query: 11   KKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGVSSSSQECMTC 70
            + +  ++F   +  ++ A S  +I   +  D  + R  K GG  D R+G    + +C TC
Sbjct: 12   RTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTR-AKIGGLNDPRLGSIDRNLKCQTC 70

Query: 71   HGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDRRDFLKELRRP 130
               +  C GHFGHI LA PVFHVG+     ++ +C+C  C  +LL + +      EL R 
Sbjct: 71   QEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHN------ELMRQ 124

Query: 131  GIDNLRKMSILKKVIDQCKKQRRCLKCXXXXXXXXXXXXXXXXXSLKIIHDTFRWVGKKM 190
             +           +   CK +   + C                        T R  G K+
Sbjct: 125  ALAIKDSKKRFAAIWTLCKTK---MVCETDVPSEDDPTQLVSRGGCGNTQPTIRKDGLKL 181

Query: 191  VP--EKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCELLGINSTV 248
            V   +KDR  G+ +E     PEL          L+  + L +FK +  +D   LG N   
Sbjct: 182  VGSWKKDRATGDADE-----PELRV--------LSTEEILNIFKHISVKDFTSLGFNEVF 228

Query: 249  RSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIKAGLAKGIS 308
               RPE  I   LP PP  +RPS++  +S    EDDLT KL +I+  +  ++     G  
Sbjct: 229  --SRPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHNGAP 285

Query: 309  INNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGKQGRFRGNL 368
             + + E    LQ  VA Y+++D    A  P A    G+  P++    RLKGK+GR RGNL
Sbjct: 286  HHAIEEAESLLQFHVATYMDNDI---AGQPQALQKSGR--PVKSIRARLKGKEGRIRGNL 340

Query: 369  SGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLIINGPTVHP 428
             GKRVDFS RTVIS DPNL +D+V VP+ +AK LT+PE VT YN  +L QL+ NGP  HP
Sbjct: 341  MGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP 400

Query: 429  GANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSLHRLSILSH 488
            GA Y+++ + + R +LRY  +    + LQYG  VERH+ D D VLFNRQPSLH++S+++H
Sbjct: 401  GAKYVIRDSGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAH 458

Query: 489  YAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGE 548
              K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P+S +
Sbjct: 459  RVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNK 518

Query: 549  PIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFD--IPPPAIMKPYYLWTG 606
            P +   QD + G   ++ +D+F +L  +  +L  + D    +D  IP PAI+KP  LW+G
Sbjct: 519  PCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPD----WDGVIPTPAIIKPKPLWSG 574

Query: 607  KQVFSLLIRPNKKSPVVINLDAKNKVYIPPKDKSFPNEMSINDGFVIIRGSEILSGVMDK 666
            KQ+ S+ I PN    + +    +    + PKD          +G +II G +I+ GV++K
Sbjct: 575  KQILSVAI-PNG---IHLQRFDEGTTLLSPKD----------NGMLIIDG-QIIFGVVEK 619

Query: 667  SVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPSSDLRDK 726
              +G      + + + R+ GPQ  A     + K+   +L + GFS GI D         +
Sbjct: 620  KTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMRE 678

Query: 727  KEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELD 786
              E +  A  K  ++    +   L  + G    ++ E  +   L++ R++ G +    L 
Sbjct: 679  ITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAEVNLK 738

Query: 787  NLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKTPQSKG 846
            +LN    M   GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P+SKG
Sbjct: 739  DLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKG 798

Query: 847  FVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDDTVRT 906
            FV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD+T R 
Sbjct: 799  FVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRN 858

Query: 907  SANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNK---NETGLLPYEIVRET 963
            S   ++QF YG DG+D   +E  +  ++ I   D A    +     N    L   ++   
Sbjct: 859  SLGNVIQFIYGEDGMDAAHIEKQS--LDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESG 916

Query: 964  DNVLKPLEEKLIRYDNLGAVVPKELIDDERYADR--------------HDAERAFY---- 1005
              +L  L+ +++  +    +V       E + D                +A++ F+    
Sbjct: 917  SEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNIRRIIQNAQQTFHIDHT 976

Query: 1006 KSLRMYMQEKAARLAQIRNT----RGLLEMTQNGGDTSMEVVSSELQA-----SVDQVYK 1056
            K   + +++    +  ++      RG  E+ QN    ++ +    L++      V Q Y+
Sbjct: 977  KPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYR 1036

Query: 1057 ITKKNVNAFLTIALHKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTL 1116
            +TK+  +  L+    ++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVAS  VT 
Sbjct: 1037 LTKQAFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTS 1096

Query: 1117 GVPRIKEIINASKVISTPIINAVLV--NEGDERAARVVKGRIEKTLLSDLA-----FYIQ 1169
            GVPR+KEI+N +K + TP +   L   +  D+  A++++  IE T L  +      +Y  
Sbjct: 1097 GVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDP 1156

Query: 1170 D-----------VYRGNMSYL----EIRVDLATIEKLQLEL---TMEDIAVALSRAPKLK 1211
            D           + + + S L    E   D  +   L+LEL    M D  + + +  +  
Sbjct: 1157 DPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRAAMNDKDLTMGQVGERI 1216

Query: 1212 IQT--TDIHIL----GKDKIHVN---VYPEGMKAKSISTSAKEPSENEVFYKMQTLRRSL 1262
             QT   D+ ++      +K+ +    V P+ + A++      E  E+ +  K++     L
Sbjct: 1217 KQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAET------EAEEDHMLKKIENTM--L 1268

Query: 1263 PDVVVKGLPDISRAVINIRD------------DGKRELLVEGYGLREVMCTDGVIGSKTI 1310
             ++ ++G+ +I R V+   D            + +  L  +G  L EVM   G+  ++  
Sbjct: 1269 ENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIY 1328

Query: 1311 TNHVLEVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFG 1370
            TN  +++  VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +G +  +TR G
Sbjct: 1329 TNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHG 1388

Query: 1371 LSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVV 1426
             ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   +GTG+F V+
Sbjct: 1389 FNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDVM 1444

>Skud_4.114 Chr4 complement(201053..206233) [5181 bp, 1726 aa] {ON}
            YDL140C (REAL)
          Length = 1726

 Score =  711 bits (1834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/1498 (33%), Positives = 765/1498 (51%), Gaps = 147/1498 (9%)

Query: 11   KKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGVSSSSQECMTC 70
            + +  ++F   +  ++ A S  +I   +  D  + R  K GG  D R+G    + +C TC
Sbjct: 12   RTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTR-AKIGGLNDPRLGSIDRNLKCQTC 70

Query: 71   HGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDRRDFLKELRRP 130
               +  C GHFGHI LA PVFHVG+     ++ +C+C  C  +LL + +      EL R 
Sbjct: 71   QEGMNECPGHFGHIDLAKPVFHVGFIAKIKKLCECVCMHCGKLLLDEHN------ELMRQ 124

Query: 131  GIDNLRKMSILKKVIDQCKKQRRCLKCXXXXXXXXXXXXXXXXXSLKIIHDTFRWVGKKM 190
             +           +   CK +   + C                        T R  G K+
Sbjct: 125  ALAIKDSKKRFAAIWTLCKTK---MVCETDVPSENDPTQLVSRGGCGNTQPTVRKDGLKL 181

Query: 191  VP--EKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCELLGINSTV 248
            V   +KDR  G+ +E     PEL          L+  + L +FK +  ED   LG N   
Sbjct: 182  VGSWKKDRASGDADE-----PELRV--------LSTEEILNIFKHISVEDFTSLGFNEVF 228

Query: 249  RSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIKAGLAKGIS 308
               RPE  I   LP PP  +RPS++  +S    EDDLT KL +I+  +  ++     G  
Sbjct: 229  --SRPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHNGAP 285

Query: 309  INNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGKQGRFRGNL 368
             + + E    LQ  VA Y+++D    A  P A    G+  P++    RLKGK+GR RGNL
Sbjct: 286  HHAIEEAESLLQFHVATYMDNDI---AGQPQALQKSGR--PVKSIRARLKGKEGRIRGNL 340

Query: 369  SGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLIINGPTVHP 428
             GKRVDFS RTVIS DPNL +D+V VP+ +AK LT+PE VT YN  +L QL+ NGP  HP
Sbjct: 341  MGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP 400

Query: 429  GANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSLHRLSILSH 488
            GA Y+++ + + R +LRY  +    + LQYG  VERH+ D D VLFNRQPSLH++S+++H
Sbjct: 401  GAKYVIRDSGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAH 458

Query: 489  YAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGE 548
               + P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P+S +
Sbjct: 459  RVIVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNK 518

Query: 549  PIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFD--IPPPAIMKPYYLWTG 606
            P +   QD + G   ++ +D+F +L  +  +L  + D    +D  IP PAI+KP  LW+G
Sbjct: 519  PCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPD----WDGVIPTPAIIKPKPLWSG 574

Query: 607  KQVFSLLIRPNKKSPVVINLDA--KNKVYIPPKDKSFPNEMSINDGFVIIRGSEILSGVM 664
            KQV S  I      P  I+L    +    + PKD          +G +II G +I+ GV+
Sbjct: 575  KQVLSAAI------PSGIHLQRFDEGTTLLSPKD----------NGMLIIDG-QIVFGVV 617

Query: 665  DKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPSSDLR 724
            +K  +G      + + + R+ GPQ  A     + K+   +L + GFS GI D        
Sbjct: 618  EKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTM 676

Query: 725  DKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINE 784
             +  E +  A  K  ++    +   L  + G    ++ E  +   L++ R++ G +    
Sbjct: 677  REITETIAEAKKKVFDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAEVN 736

Query: 785  LDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKTPQS 844
            L +LN    M   GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P+S
Sbjct: 737  LKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPES 796

Query: 845  KGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDDTV 904
            KGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD+T 
Sbjct: 797  KGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTT 856

Query: 905  RTSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFN---KNETGLLPYEIVR 961
            R S   ++QF YG DG+D   +E  +  ++ I   D A    +     N   +L   ++ 
Sbjct: 857  RNSLGNVIQFIYGEDGMDAAHIEKQS--LDTIGGSDKAFEKRYRIDLLNPEHILDPSLLE 914

Query: 962  ETDNVLKPLEEKLIRYDNLGAVVPKELIDDERYADR--------------HDAERAFY-- 1005
                +L  L+ +++  +    +V       E + D                +A++ F+  
Sbjct: 915  SGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPMPVNIRRIIQNAQQTFHID 974

Query: 1006 --KSLRMYMQEKAARLAQIRNT----RGLLEMTQNGGDTSMEVVSSELQASVD-----QV 1054
              +   + ++E    +  ++      RG  E+ QN    ++ +     ++ +      Q 
Sbjct: 975  HTRPSDLTIKEIVIGVKDLQENLLVLRGKNEIIQNAQQDAVTLFCCLFRSRLATRRILQE 1034

Query: 1055 YKITKKNVNAFLTIALHKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNV 1114
            Y++TK+     L+    ++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVAS  V
Sbjct: 1035 YRLTKQAFEWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKV 1094

Query: 1115 TLGVPRIKEIINASKVISTPIINAVLV--NEGDERAARVVKGRIEKTLLSDLA-----FY 1167
            T GVPR+KEI+N +K + TP +   L   +  D+  A++++  IE T L  +      +Y
Sbjct: 1095 TSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYY 1154

Query: 1168 IQD-----------VYRGNMSYL----EIRVDLATIEKLQLEL---TMEDIAVALSRAPK 1209
              D           + + + S L    E   D  +   L+LEL    M D  + + +  +
Sbjct: 1155 DPDPRSTVIPEDEEIIQLHFSLLDDEAEQSFDQQSPWLLRLELDRAAMNDKDLTMGQVGE 1214

Query: 1210 LKIQT--TDIHIL----GKDKIHVN---VYPEGMKAKSISTSAKEPSENEVFYKMQTLRR 1260
               QT   D+ ++      +K+ +    V P+ + A++      E  E+ +  K++    
Sbjct: 1215 RIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAET------EAEEDHMLKKIENTM- 1267

Query: 1261 SLPDVVVKGLPDISRAVINIRD------------DGKRELLVEGYGLREVMCTDGVIGSK 1308
             L ++ ++G+ +I R V+   D            + +  L  +G  L EVM   G+  ++
Sbjct: 1268 -LENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTR 1326

Query: 1309 TITNHVLEVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITR 1368
              TN  +++  VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +G +  +TR
Sbjct: 1327 IYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTR 1386

Query: 1369 FGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVV 1426
             G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   +GTG+F V+
Sbjct: 1387 HGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDVM 1444

>KLTH0H02046g Chr8 complement(182788..188010) [5223 bp, 1740 aa] {ON}
            highly similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140C
          Length = 1740

 Score =  709 bits (1831), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/1505 (33%), Positives = 764/1505 (50%), Gaps = 160/1505 (10%)

Query: 11   KKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGVSSSSQECMTC 70
            + +  ++F   +  ++ A S  +I   +  D E     K GG  D R+G    + +C TC
Sbjct: 12   RTVKEVQFGIFSPEEVRAISVAKIEFPETMD-ETQMRAKVGGLNDPRLGSIDRNYKCQTC 70

Query: 71   HGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDRRDFLKELRRP 130
               +  C GHFGHI+LA PVFH+GY     ++ +C+C  C  +LL +        EL R 
Sbjct: 71   GEGMNDCPGHFGHIELAKPVFHIGYISKIKKVCECVCMHCGKLLLDEH------SELMRQ 124

Query: 131  GIDNLRKMSILKKVIDQCKKQRRCLKCXXXXXXXXXXXXXXXXXSLKIIHDTFRWVGKKM 190
             I           V   CK +   + C                        + R  G  +
Sbjct: 125  AIKIKDPKRRFNAVWSLCKAK---MVCETEVPSDNDPAQYVSRGGCGNTQPSVRKDGLSL 181

Query: 191  VPEKDRWIGEW--NEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCELLGINSTV 248
            V       G W  ++      + ER V    + LN      +FK +  ED   LG N   
Sbjct: 182  V-------GTWKKDKGADDADQPERRVISADEVLN------VFKHISPEDSVRLGFNEDF 228

Query: 249  RSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIKAGLAKGIS 308
               RPE  I   LP PP  +RPS++  ++    EDDLT KL +I+  +  ++     G  
Sbjct: 229  --ARPEWMILTVLPVPPPPVRPSISFNET-QRGEDDLTYKLGDILKANINVQRLEINGSP 285

Query: 309  INNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGKQGRFRGNL 368
             + + E    LQ  VA Y+++D    A  P A    G+  PI+    RLKGK+GR RGNL
Sbjct: 286  QHVIQESEALLQFHVATYMDNDI---AGQPQALQKSGR--PIKSIRARLKGKEGRIRGNL 340

Query: 369  SGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLIINGPTVHP 428
             GKRVDFS RTVIS DPNL +D+V VP+ +A+ LT+PE VT YN  +L QL+ NGP  HP
Sbjct: 341  MGKRVDFSARTVISGDPNLDLDQVGVPKSIARTLTYPEVVTPYNIDRLTQLVRNGPNEHP 400

Query: 429  GANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSLHRLSILSH 488
            GA Y+++ N + R +LRY  +    + LQYG  VERH+ D D VLFNRQPSLH++S+++H
Sbjct: 401  GAKYIIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIIDEDPVLFNRQPSLHKMSMMAH 458

Query: 489  YAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGE 548
              K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++ +S +
Sbjct: 459  RVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPQQIVSAQSNK 518

Query: 549  PIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFD--IPPPAIMKPYYLWTG 606
            P +   QD + G   ++ +D+F +L  +  +L  + D    +D  IP P I+KP  LW+G
Sbjct: 519  PCMGIVQDTLCGVRKMTLRDTFIELDQVLNMLYWIPD----WDGVIPTPIILKPKPLWSG 574

Query: 607  KQVFSLLIRPNKKSPVVINLDA--KNKVYIPPKDKSFPNEMSINDGFVIIRGSEILSGVM 664
            KQ+ S+ I      P  I+L    +    + PKD          +G +II G +I+ GV+
Sbjct: 575  KQILSIAI------PSGIHLQRFDEGTTLLSPKD----------NGMLIIDG-QIIFGVV 617

Query: 665  DKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPSSDLR 724
            DK  +G      + + + R+ GP+  A   + + K+   +L + GFSIGI D        
Sbjct: 618  DKKTVGSSSG-GLIHVVTREKGPKICARLFSNLQKVVNFWLLHNGFSIGIGDTIADEKSM 676

Query: 725  DKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINE 784
             +  E +  A  K +E+    +   L  + G    ++ E  +   L++ R++ G      
Sbjct: 677  REITEAIIVAKRKVEEVTKEAQANLLTAKHGMTLRESFEDSVVRYLNEARDKAGRSAEVN 736

Query: 785  LDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKTPQS 844
            L +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P+S
Sbjct: 737  LKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLPHFSKDDYSPES 796

Query: 845  KGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDDTV 904
            KGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD T 
Sbjct: 797  KGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDGTT 856

Query: 905  RTSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFN---KNETGLLPYEIVR 961
            R S   ++QF YG DG+D   +E   + ++ I S D A    F     N    L   ++ 
Sbjct: 857  RNSLGNVIQFIYGEDGMDAAHIE--KQTIDTIASSDAAFERRFRIDLLNPRHALDPSLLE 914

Query: 962  ETDNVLKPLEEKLIRYDNLGAVVPKELIDDERYADR-------------------HDAER 1002
                ++  L+ + +  +       K+L++D  +  +                    +A++
Sbjct: 915  SGSEIIGDLKLQALLDEEF-----KQLVEDREFLRKIFVDGEQNWPLPVNIRRIIQNAQQ 969

Query: 1003 AF-----------YKSLRMYMQEKAARLAQIRNTRGLL-EMTQNGGDTSMEVVSSELQA- 1049
             F            + +   ++E   +L  +R    +L E  QN       ++ S L   
Sbjct: 970  TFRIDQTKPTDLTIRDVVYGVKELQEKLLVLRGKSKILQEAQQNAVTLFCCLLRSRLATR 1029

Query: 1050 SVDQVYKITKKNVNAFLTIALHKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGV 1109
             V Q Y++ K+     L+    ++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGV
Sbjct: 1030 RVIQEYRLNKQTFEWVLSNVESQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGV 1089

Query: 1110 ASMNVTLGVPRIKEIINASKVISTPIINAVLVNE--GDERAARVVKGRIEKTLLSDLA-- 1165
            AS  VT GVPR+KEI+N +K + TP +   L  +   D+  A++++  IE T L  +   
Sbjct: 1090 ASKKVTSGVPRLKEILNVAKNMKTPSLTVYLDKDHAADQEKAKLIRSAIEHTTLKSITVA 1149

Query: 1166 ---FYIQD-----------VYRGNMSYL----EIRVDLATIEKLQLEL---TMEDIAVAL 1204
               +Y  D           + + + S +    E  +D  +   L+LEL    M D  + +
Sbjct: 1150 SEIYYDPDPRSTVIEEDEEIIQLHFSLMDEETEQSLDYQSPWLLRLELDRAAMNDKDLTM 1209

Query: 1205 SRAPKLKIQTT---DIHILGKD--------KIHVNVYPEGMKAKSISTSAKEPSENEVFY 1253
             +  + KI+ T   D+ ++  +        +  V   P+ + A++      E  E+ +  
Sbjct: 1210 GQVGE-KIKETFKNDLFVIWSEDNAEKLIIRCRVVRDPKTLDAEA------EAEEDHMLK 1262

Query: 1254 KMQTLRRSLPDVVVKGLPDISRAVINIRD------DGKRE------LLVEGYGLREVMCT 1301
            +++     L  + ++G+ DI+R V+   D       G+        L  +G  L EVMC 
Sbjct: 1263 RIENTM--LESITLRGVEDITRVVMMKYDRKVPSPTGEYHKVPEWVLETDGVNLAEVMCV 1320

Query: 1302 DGVIGSKTITNHVLEVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKG 1361
             GV  ++  TN  +++ +VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +G
Sbjct: 1321 PGVDPARIYTNSFIDIMNVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTSQG 1380

Query: 1362 EVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTG 1421
             ++ +TR G ++     L   SFE+T + LF+A    + D   GVSE ++LGQ   +GTG
Sbjct: 1381 FLMSVTRHGFNRSDTGALMRCSFEETVEILFEAGAAAELDDCRGVSENVLLGQVAPIGTG 1440

Query: 1422 SFKVV 1426
            +F V+
Sbjct: 1441 AFDVM 1445

>SAKL0F10472g Chr6 (808869..814061) [5193 bp, 1730 aa] {ON} highly
            similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140C
          Length = 1730

 Score =  707 bits (1825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/1508 (33%), Positives = 774/1508 (51%), Gaps = 166/1508 (11%)

Query: 11   KKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGVSSSSQECMTC 70
            + I  ++F   +  ++ A S  +I   +  D  + R  K GG  D R+G    + +C TC
Sbjct: 12   RTIKEVQFGLFSPEEVRAISVAKIEFPETMDETQMR-AKVGGLNDPRLGSIDRNYKCQTC 70

Query: 71   HGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDRRDFLKELRRP 130
               +  C GHFGHI+LA PVFH+G+     ++ +C+C  C   LL D+      + ++  
Sbjct: 71   GEGMNDCPGHFGHIELAKPVFHIGFLSRIKKVCECVCMHCGK-LLLDEHNEQMKQAIKIK 129

Query: 131  GIDNLRKMSILKKVIDQCKKQRRCLKCXXXXXXXXXXXXXXXXXSLKIIHDTFRWVGKKM 190
              D  R+ + +  +       +  + C                        + R  G  +
Sbjct: 130  --DPKRRFNAVWTL------SKVKMICETEVPSEDDPTKYISRGGCGNTQPSIRKDGLSL 181

Query: 191  VPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCELLGINSTVRS 250
            V     W  + N      PE     KR    ++  + L +FK +  ED   LG N     
Sbjct: 182  V---GTWKKDKNADDADQPE-----KRI---ISAEEVLNVFKHICPEDSWRLGFNEDF-- 228

Query: 251  GRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIKAGLAKGISIN 310
             RPE  +   LP PP  +RPS++  ++    EDDLT KL +I+  +  ++     G   +
Sbjct: 229  ARPEWMLLTVLPVPPPPVRPSISFNET-QRGEDDLTYKLGDILKANINVQRLEINGSPQH 287

Query: 311  NMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGKQGRFRGNLSG 370
             + E    LQ  VA Y+++D    A  P A    G+  PI+    RLKGK+GR RGNL G
Sbjct: 288  VIQESEALLQFHVATYMDNDI---AGQPQALQKSGR--PIKSIRARLKGKEGRIRGNLMG 342

Query: 371  KRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLIINGPTVHPGA 430
            KRVDFS RTVIS DPNL +D+V VP+ +AK LT+PE VT YN  +L QL+ NGP  HPGA
Sbjct: 343  KRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHPGA 402

Query: 431  NYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSLHRLSILSHYA 490
             Y+++ N + R +LRY  +    + LQYG  VERH+ D D VLFNRQPSLH++S+++H  
Sbjct: 403  KYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIIDNDPVLFNRQPSLHKMSMMAHRV 460

Query: 491  KIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGEPI 550
            K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P+S +P 
Sbjct: 461  KVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPC 520

Query: 551  IAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFD--IPPPAIMKPYYLWTGKQ 608
            +   QD + G   ++ +D+F +L  +  +L  + D    +D  IP P I+KP  LW+GKQ
Sbjct: 521  MGIVQDTLCGVRKMTLRDTFIELDQVLNMLYWVPD----WDGVIPTPTILKPKPLWSGKQ 576

Query: 609  VFSLLIRPNKKSPVVINLDA--KNKVYIPPKDKSFPNEMSINDGFVIIRGSEILSGVMDK 666
            + S+ I      P  I+L    +    + PKD          +G +I+ G +I+ GV+DK
Sbjct: 577  ILSMAI------PKGIHLQRFDEGTTLLSPKD----------NGMLIVDG-QIIFGVVDK 619

Query: 667  SVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPSSDLRDK 726
              +G      + + + R+ GPQ  A   + + K+   +L + GFSIGI D         +
Sbjct: 620  KTVG-SSNGGLIHIVTREKGPQICARLFSNIQKVVNYWLLHNGFSIGIGDTIADQKTMRE 678

Query: 727  KEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELD 786
              E +  A  K + +    +   L  + G    ++ E  +   L++ R++ G      L 
Sbjct: 679  ITEAIAVAKKKVENVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEARDKAGRSAEVNLK 738

Query: 787  NLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKTPQSKG 846
            +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P+SKG
Sbjct: 739  DLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLPHFSKDDYSPESKG 798

Query: 847  FVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDDTVRT 906
            FV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD T R 
Sbjct: 799  FVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDGTTRN 858

Query: 907  SANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEI-VRETDN 965
            S   I+QF YG DG+D   +E   + ++ I   D A    F +       Y I +   DN
Sbjct: 859  SLGNIIQFIYGEDGMDAAHIE--KQSIDTIAGSDRA----FERR------YRIDLLNPDN 906

Query: 966  VLKP--LE--EKLIRYDNLGAVVPKE---LIDDERYADR--HDAERAF--YKSLRMYMQ- 1013
             L P  LE   +++    L A + +E   L++D R+  +   D E+ +    ++R  +Q 
Sbjct: 907  ALDPSLLESGSEMMGDLKLQASLDEEYRQLVEDRRFLRKIFVDGEQNWPLPVNIRRIIQN 966

Query: 1014 -EKAARLAQIRNT---------------------RGLLEMTQNGGDTSMEVVSSELQA-- 1049
             ++  R+   + T                     RG  EM Q     ++ +    L++  
Sbjct: 967  AQQTFRIDHTKPTDLTIHDVIYGVKDLQEKLLVLRGKSEMLQEAQTNAVTLFCCLLRSRL 1026

Query: 1050 ---SVDQVYKITKKNVNAFLTIALHKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHF 1106
                V + YK+TK+     L     ++ R+ V PG  VG + AQSIGEP TQMTL TFHF
Sbjct: 1027 ASRRVIEEYKLTKQTFQWVLNNVEAQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHF 1086

Query: 1107 AGVASMNVTLGVPRIKEIINASKVISTPIINAVLVNE--GDERAARVVKGRIEKTLLSDL 1164
            AGVAS  VT GVPR+KEI+N +K + TP +   L +E   D+  A++++  IE T L  +
Sbjct: 1087 AGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLESEESADQEKAKLIRSAIEHTTLKSV 1146

Query: 1165 A-----FYIQD----VYRGNMSYLEIRVDLATIEK-----------LQLEL---TMEDIA 1201
                  +Y  D    V   +   +++   L   E            L+LEL    M D  
Sbjct: 1147 TVASEIYYDPDPRSTVIEDDEEIIQLHFSLMDEETEQSLDHQSPWLLRLELDRAAMNDKD 1206

Query: 1202 VALSRAPKLKIQTT---DIHILGKD--------KIHVNVYPEGMKAKSISTSAKEPSENE 1250
            + + +  + KI+ T   D+ ++  +        +  V   P+ + A++      E  E+ 
Sbjct: 1207 LTMGQVGE-KIKETFKNDLFVIWSEDNAEKLIIRCRVVRDPKTLDAEA------EAEEDH 1259

Query: 1251 VFYKMQTLRRSLPDVVVKGLPDISRAVINIRD------DGKRE------LLVEGYGLREV 1298
            +  K++     L  + ++G+ DI+R V+   D       G+ +      L  +G  L EV
Sbjct: 1260 MLKKIENTM--LESITLRGVEDITRVVMMKYDRKTPSATGEYQKVPEWVLETDGVNLAEV 1317

Query: 1299 MCTDGVIGSKTITNHVLEVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMT 1358
            M   GV  ++  TN  +++ +VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT
Sbjct: 1318 MSVPGVDSTRIYTNSFIDIMNVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMT 1377

Query: 1359 YKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSV 1418
             +G ++ +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   +
Sbjct: 1378 SQGFLMSVTRHGFNRSDTGALMRCSFEETVEILFEAGAAAELDNCRGVSENVILGQMAPI 1437

Query: 1419 GTGSFKVV 1426
            GTG+F V+
Sbjct: 1438 GTGAFDVM 1445

>Kwal_56.24489 s56 (1018237..1023423) [5187 bp, 1728 aa] {ON} YDL140C
            (RPO21) - RNA polymerase II large subunit [contig 161]
            FULL
          Length = 1728

 Score =  707 bits (1824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/1500 (33%), Positives = 762/1500 (50%), Gaps = 150/1500 (10%)

Query: 11   KKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGVSSSSQECMTC 70
            + +  ++F   +  ++ A S  +I   +  D E     K GG  D R+G    + +C TC
Sbjct: 12   RTVKEVQFGMFSPEEVRAISVAKIEFPETMD-ETQMRAKVGGLNDPRLGSIDRNFKCQTC 70

Query: 71   HGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDRRDFLKELRRP 130
               +  C GHFGHI+LA PVFH+GY     ++ +C+C  C  +LL +        EL + 
Sbjct: 71   GEGMNDCPGHFGHIELAKPVFHIGYISKIKKVCECVCMHCGKLLLDEH------SELMKQ 124

Query: 131  GIDNLRKMSILKKVIDQCKKQRRCLKCXXXXXXXXXXXXXXXXXSLKIIHDTFRWVGKKM 190
             I           V   CK +   + C                        + R  G  +
Sbjct: 125  AIKIKDPKRRFNAVWSLCKVK---MVCETEVPSDNDPSQYVSRGGCGNTQPSVRKDGLSL 181

Query: 191  VPEKDRWIGEW--NEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCELLGINSTV 248
            V       G W  ++      + ER +    + LN      +FK +  ED   LG N   
Sbjct: 182  V-------GTWKKDKGADDADQPERRIISADEVLN------VFKHISPEDSVRLGFNEDF 228

Query: 249  RSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIKAGLAKGIS 308
               RPE  I   LP PP  +RPS++  ++    EDDLT KL +I+  +  ++     G  
Sbjct: 229  --ARPEWMILTVLPVPPPPVRPSISFNET-QRGEDDLTYKLGDILKANINVQRLEINGSP 285

Query: 309  INNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGKQGRFRGNL 368
             + + E    LQ  VA Y+++D    A  P A    G+  PI+    RLKGK+GR RGNL
Sbjct: 286  QHVIQESEALLQFHVATYMDNDI---AGQPQALQKSGR--PIKSIRARLKGKEGRIRGNL 340

Query: 369  SGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLIINGPTVHP 428
             GKRVDFS RTVIS DPNL +D+V VP+ +A+ LT+PE VT YN  +L QL+ NGP  HP
Sbjct: 341  MGKRVDFSARTVISGDPNLDLDQVGVPKSIARTLTYPEVVTPYNIDRLTQLVRNGPNEHP 400

Query: 429  GANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSLHRLSILSH 488
            GA Y+++ N + R +LRY  +    + LQYG  VERH+ D D VLFNRQPSLH++S+++H
Sbjct: 401  GAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIIDEDPVLFNRQPSLHKMSMMAH 458

Query: 489  YAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGE 548
              K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++ +S +
Sbjct: 459  RVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPQQIVSAQSNK 518

Query: 549  PIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFD--IPPPAIMKPYYLWTG 606
            P +   QD + G   ++ +D+F +L  +  +L  + D    +D  IP P I+KP  LW+G
Sbjct: 519  PCMGIVQDTLCGVRKMTLRDTFIELEQVLNMLYWIPD----WDGVIPTPIILKPKPLWSG 574

Query: 607  KQVFSLLIRPNKKSPVVINLDA--KNKVYIPPKDKSFPNEMSINDGFVIIRGSEILSGVM 664
            KQ+ S+ I      P  I+L    +    + PKD          +G +II G +I+ GV+
Sbjct: 575  KQILSIAI------PTGIHLQRFDEGTTLLSPKD----------NGMLIIDG-QIIFGVV 617

Query: 665  DKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPSSDLR 724
            DK  +G      + + + R+ GP+  A   + + K+   +L + GFSIGI D        
Sbjct: 618  DKKTVGSSSG-GLIHVVTREKGPKICARLFSNLQKVVNYWLLHNGFSIGIGDTIADEKSM 676

Query: 725  DKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINE 784
             +  + +  A  K +E+    +   L  + G    ++ E  +   L++ R++ G      
Sbjct: 677  REITDAIVVAKRKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEARDKAGRSAEVN 736

Query: 785  LDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKTPQS 844
            L +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P+S
Sbjct: 737  LKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLPHFSKDDYSPES 796

Query: 845  KGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDDTV 904
            KGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD T 
Sbjct: 797  KGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDGTT 856

Query: 905  RTSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKN----ETGLLP---- 956
            R S   ++QF YG DG+D   +E  A  ++ I   D A    F  +    +  L P    
Sbjct: 857  RNSLGNVIQFIYGEDGMDAAHIEKQA--IDTIACSDAAFERRFKIDLLNPKHALDPSLLE 914

Query: 957  --YEIVRE------TDNVLKPLEE------KLIRYDNLGAVVP---KELIDDERYADRHD 999
               EI+ +       D   K L E      K+         +P   + +I + +   R D
Sbjct: 915  SGSEIIGDLKLQALLDEEFKQLSEDRQFLRKIFVDGEQNWPLPVNIRRIIQNAQQTFRID 974

Query: 1000 AERAFYKSLR--MY-MQEKAARLAQIRNTRGLLEMTQNGGDTSMEVVSSELQAS--VDQV 1054
              +    S+R  +Y ++E   +L  +R    +L+  Q    T    +     AS  V Q 
Sbjct: 975  HTKPTDLSIRDVIYGVKELQEKLLVLRGKSKILQEAQVNAVTLFCCLLRSRLASRRVIQE 1034

Query: 1055 YKITKKNVNAFLTIALHKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNV 1114
            Y++ K+     L+    ++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVAS  V
Sbjct: 1035 YRLNKQTFEWVLSNVEAQFLRSLVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKV 1094

Query: 1115 TLGVPRIKEIINASKVISTPIINAVLVNE--GDERAARVVKGRIEKTLLSDLA-----FY 1167
            T GVPR+KEI+N +K + TP +   L  E   D+  A++++  IE T L  +      +Y
Sbjct: 1095 TSGVPRLKEILNVAKNMKTPSLTVYLDEEHAADQEKAKLIRSAIEHTTLKSITVASEIYY 1154

Query: 1168 IQD----VYRGNMSYLEIRVDLATIEK-----------LQLEL---TMEDIAVALSRAPK 1209
              D    V   +   +++   L   E            L+LEL    M D  + + +  +
Sbjct: 1155 DPDPRSTVIEDDEEIIQLHFSLMDEETEQSLDYQSPWLLRLELDRAAMNDKDLTMGQVGE 1214

Query: 1210 LKIQTT---DIHILGKD--------KIHVNVYPEGMKAKSISTSAKEPSENEVFYKMQTL 1258
             KI+ T   D+ ++  +        +  V   P+ + A++      E  E+ +  +++  
Sbjct: 1215 -KIKETFKNDLFVIWSEDNAEKLVIRCRVVRDPKTLDAEA------EAEEDHMLKRIENT 1267

Query: 1259 RRSLPDVVVKGLPDISRAVINIRDDG------------KRELLVEGYGLREVMCTDGVIG 1306
               L  + ++G+ DI+R V+   D              +  L  +G  L EVMC  GV  
Sbjct: 1268 M--LESITLRGVEDITRVVMMKYDRKVPSPAGDYHKIPEWVLETDGVNLAEVMCVPGVDP 1325

Query: 1307 SKTITNHVLEVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGI 1366
            ++  TN  +++ +VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +G ++ +
Sbjct: 1326 ARIYTNSFIDIMNVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTSQGFLMSV 1385

Query: 1367 TRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVV 1426
            TR G ++     L   SFE+T + LF+A    + D   GVSE ++LGQ   +GTG+F V+
Sbjct: 1386 TRHGFNRSDTGALMRCSFEETVEILFEAGAAAELDDCRGVSENVLLGQVAPIGTGAFDVM 1445

>NDAI0A02130 Chr1 complement(477808..482997) [5190 bp, 1729 aa] {ON}
            Anc_7.314
          Length = 1729

 Score =  704 bits (1818), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/1506 (33%), Positives = 765/1506 (50%), Gaps = 163/1506 (10%)

Query: 11   KKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGVSSSSQECMTC 70
            + +  ++F   +  ++ A S  +I   +  D  + R  K GG  D R+G    + +C TC
Sbjct: 12   RTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTR-AKIGGLNDPRLGSIDRNLKCQTC 70

Query: 71   HGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDRRDFLKELRRP 130
               +  C GHFGHI LA PV HVG+     ++ + +C  C  +LL + +      E  R 
Sbjct: 71   QEGMNECPGHFGHIDLAKPVLHVGFIAKIKKVCESVCMHCGKLLLDEHN------EQMRQ 124

Query: 131  GIDNLRKMSILKKVIDQCKKQRRCLKCXXXXXXXXXXXXXXXXXSLKIIHDTFRWVGKKM 190
             I           V + CK +   + C                        T R  G K+
Sbjct: 125  AIAIKDSKKRFNAVWNLCKTK---MICDTDVPSDDDPTQLISRGGCGNAQPTVRKDGLKL 181

Query: 191  VPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCELLGINSTVRS 250
            V     W  E N      PE     +R    L+  + L +FK +  ED   LG N     
Sbjct: 182  V---GSWKKEKNTNDGDEPE-----QRV---LSTEEILNIFKHISPEDSTRLGFNEEF-- 228

Query: 251  GRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIKAGLAKGISIN 310
             RPE  I   LP PP  +RPS++  +S    EDDLT KL +I+  +  ++     G   +
Sbjct: 229  ARPEWMILNVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHNGAPHH 287

Query: 311  NMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGKQGRFRGNLSG 370
             + E    LQ  VA Y+++D    A  P A    G+  P++    RLKGK+GR RGNL G
Sbjct: 288  AIEEAESLLQFHVATYMDNDI---AGQPQALQKSGR--PVKSIRARLKGKEGRIRGNLMG 342

Query: 371  KRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLIINGPTVHPGA 430
            KRVDFS RTVIS DPNL +D+V VP+ +A+ LT+PE VT YN  +L QL+ NGP  HPGA
Sbjct: 343  KRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQLVRNGPNEHPGA 402

Query: 431  NYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSLHRLSILSHYA 490
             Y+++ N + R +LRY  +    + LQYG  VERH+ D D VLFNRQPSLH++S+++H  
Sbjct: 403  KYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHITDNDPVLFNRQPSLHKMSMMAHRV 460

Query: 491  KIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGEPI 550
            K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++ +S +P 
Sbjct: 461  KVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSAQSNKPC 520

Query: 551  IAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFD--IPPPAIMKPYYLWTGKQ 608
            +   QD + G   ++ +D+F +   +  +L  + D    +D  IP PAI+KP  LW+GKQ
Sbjct: 521  MGIVQDTLCGIRKLTLRDTFLEFDEVLNMLYWVPD----WDGVIPTPAIIKPKPLWSGKQ 576

Query: 609  VFSLLIRPNKKSPVVINLDA--KNKVYIPPKDKSFPNEMSINDGFVIIRGSEILSGVMDK 666
            V S+ I      P  I+L    +    + PKD          +G +++ G +I+ GV+DK
Sbjct: 577  VLSIAI------PRGIHLQRFDEGTTLLSPKD----------NGMLVVDG-QIIFGVVDK 619

Query: 667  SVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPSSDLRDK 726
              +G      + + + R+ GP   A     + K+   +L + GFS GI D         +
Sbjct: 620  KTVG-SSNGGLIHVVTREKGPTICAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGSTIKE 678

Query: 727  KEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELD 786
              E +  A  K +++    ++  L  + G    ++ E  +   L++ R++ G +    L+
Sbjct: 679  ITETIADAKRKVEDVTKEAQSNLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAEMNLN 738

Query: 787  NLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKTPQSKG 846
            +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P+SKG
Sbjct: 739  DLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGYGFVDRTLPHFSKDDYSPESKG 798

Query: 847  FVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDDTVRT 906
            FV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD T R 
Sbjct: 799  FVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDGTARN 858

Query: 907  SANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEI-VRETDN 965
            S   ++QF YG DG+D   +E   + ++ I   D A    F K       Y I +    N
Sbjct: 859  SLGNVIQFIYGEDGMDAAHIE--KQSLDTIGGSDAA----FEKR------YRIDLMNPKN 906

Query: 966  VLKP--LEEKL-----IRYDNLGAVVPKELIDDERYADR-------------------HD 999
             L P  LE        ++  +L     K+LI D ++  +                    +
Sbjct: 907  ALDPSLLESGSEITGDVKLQSLLDEEYKQLIKDRKFLRKIFVDGESNWPLPVNIRRIIQN 966

Query: 1000 AERAF-----------YKSLRMYMQEKAARLAQIRNTRGLLEMTQNGGDTSM-EVVSSEL 1047
            A++ F            + +   +++   RL  +R    +++  Q+   T    +V S L
Sbjct: 967  AQQTFRIDHSKPSDLTIRDIIFGLKDLEERLLVLRGKSEIIQKAQDDAITLFCCLVRSRL 1026

Query: 1048 QA-SVDQVYKITKKNVNAFLTIALHKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHF 1106
                + Q Y++TK+     L     ++ R+ V PG  VG + AQSIGEP TQMTL TFHF
Sbjct: 1027 STRRILQEYRLTKQAFEWVLNNVEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHF 1086

Query: 1107 AGVASMNVTLGVPRIKEIINASKVISTPIINAVLVNE--GDERAARVVKGRIEKTLLSDL 1164
            AGVAS  VT GVPR+KEI+N +K + TP +   L ++   D+  A+ ++  IE T L  +
Sbjct: 1087 AGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLKDDYSSDQEKAKFIRSAIEHTTLKSI 1146

Query: 1165 A-----FYIQD-----------VYRGNMSYL----EIRVDLATIEKLQLEL---TMEDIA 1201
                  +Y  D           + + + S L    E  +D  +   L+LEL    M D  
Sbjct: 1147 TVASEIYYDPDPRSTVIPEDDEIIQLHFSLLDDETEQSLDRQSPWLLRLELDRAAMNDKD 1206

Query: 1202 VALSRAPKLKIQT--TDIHIL----GKDKIHVN---VYPEGMKAKSISTSAKEPSENEVF 1252
            + + +  +   +T   D+ ++      +K+ +    V P+ M A++      E  E+ + 
Sbjct: 1207 LTMGQVGERIKETFRNDLFVIWSEDNAEKLIIRCRVVRPKSMDAET------EAEEDHML 1260

Query: 1253 YKMQTLRRSLPDVVVKGLPDISRAVINIRD------DGKRE------LLVEGYGLREVMC 1300
             K++     L ++ ++G+ +I R V+   D       G+ +      L  +G  L EVM 
Sbjct: 1261 KKIENTM--LENITLRGVENIERVVMMKYDRKVPSQSGEYQKVPEWVLETDGVNLSEVMT 1318

Query: 1301 TDGVIGSKTITNHVLEVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYK 1360
              GV  ++  TN  +++  VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +
Sbjct: 1319 VPGVDATRIYTNSFIDITEVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTTQ 1378

Query: 1361 GEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGT 1420
            G +  ITR G ++     L  +SFE+T + LF+A    + D   GVSE ++LGQ   +GT
Sbjct: 1379 GALTSITRHGFNRASTGALMRSSFEETVEILFEAGASAELDDCRGVSENVLLGQMAPIGT 1438

Query: 1421 GSFKVV 1426
            G+F V+
Sbjct: 1439 GAFDVM 1444

>NCAS0A13900 Chr1 (2728572..2733722) [5151 bp, 1716 aa] {ON} Anc_7.314
          Length = 1716

 Score =  695 bits (1793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/1496 (33%), Positives = 767/1496 (51%), Gaps = 143/1496 (9%)

Query: 11   KKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGVSSSSQECMTC 70
            + +  ++F   +  ++   S  +I   +  D  + R  K GG  D R+G    + +C TC
Sbjct: 12   RTVKEVQFGLFSPEEVRGISVAKIRFPETMDETQTR-AKIGGLNDPRLGSIDRNLKCQTC 70

Query: 71   HGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDRRDFLKELRRP 130
               +  C GHFGHI LA PVFHVG+     ++ + +C  C  +LL + +     +++R+ 
Sbjct: 71   QEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCESVCMHCGKLLLDEHN-----EQMRQA 125

Query: 131  -GIDNLRKMSILKKVIDQCKKQRRCLKCXXXXXXXXXXXXXXXXXSLKIIHDTFRWVGKK 189
              I + +K      V   CK +   + C                        + R  G K
Sbjct: 126  MAIKDSKKR--FNAVWTLCKTK---MICETDVPSDDDPTTLISRGGCGNAQPSIRKDGLK 180

Query: 190  MVPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCELLGINSTVR 249
            +V     W  E N      PE     +R    L+  + L +FK +  ED   +G +    
Sbjct: 181  LV---GSWKKEKNTSDGDEPE-----QRV---LSTEEILNIFKHISPEDSTRMGFSEEF- 228

Query: 250  SGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIKAGLAKGISI 309
              RPE  I   LP PP  +RPS++  +S    EDDLT KL +I+  +  ++     G   
Sbjct: 229  -ARPEWMILCVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHNGAPH 286

Query: 310  NNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGKQGRFRGNLS 369
            + + E    LQ  VA Y+++D    A  P A    G+  P++    RLKGK+GR RGNL 
Sbjct: 287  HAIEEAESLLQFHVATYMDNDI---AGQPQALQKSGR--PVKSIRARLKGKEGRIRGNLM 341

Query: 370  GKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLIINGPTVHPG 429
            GKRVDFS RTVIS DPNL +D+V VP+ +A+ LT+PE VT YN  +L QL+ NGP  HPG
Sbjct: 342  GKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQLVRNGPNEHPG 401

Query: 430  ANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSLHRLSILSHY 489
            A Y+++ N + R +LRY  +    + LQYG  VERH+ D D VLFNRQPSLH++S+++H 
Sbjct: 402  AKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDDDPVLFNRQPSLHKMSMMAHR 459

Query: 490  AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGEP 549
             K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++ +S +P
Sbjct: 460  VKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSAQSNKP 519

Query: 550  IIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFD--IPPPAIMKPYYLWTGK 607
             +   QD + G   ++ +D+F +   +  +L  + D    +D  IP PA++KP  LWTGK
Sbjct: 520  CMGIVQDTLCGIRKLTLRDTFIEFDQVLNMLYWVPD----WDGVIPTPAVLKPKPLWTGK 575

Query: 608  QVFSLLIRPNKKSPVVINLDA--KNKVYIPPKDKSFPNEMSINDGFVIIRGSEILSGVMD 665
            QV S  I      P  I+L    +    + PKD          +G ++I G +I+ GV+D
Sbjct: 576  QVLSAAI------PKGIHLQRFDEGTTLLSPKD----------NGMLVIDG-QIIFGVVD 618

Query: 666  KSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPSSDLRD 725
            K  +G      + + + R+ GP   A     + K+   +L + GFS GI D         
Sbjct: 619  KKTVGSSSG-GLIHVVTREKGPTICARLFGNIQKIVNFWLLHNGFSTGIGDTIADGQTIK 677

Query: 726  KKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINEL 785
            +  E +  A  K +++    +   L  + G    ++ E  +   L++ R++ G +    L
Sbjct: 678  EITETIAEAKKKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAEVNL 737

Query: 786  DNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKTPQSK 845
            ++LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P+SK
Sbjct: 738  NDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGFGFVDRTLPHFSKDDYSPESK 797

Query: 846  GFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDDTVR 905
            GFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD T R
Sbjct: 798  GFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDGTTR 857

Query: 906  TSANGIVQFTYGGDGLDP-------LDMEGNAKPVNFIRSW-------DHACNITFNKNE 951
             S   ++QF YG DG+D        LD  G +  V F R +       +H+ + T  ++ 
Sbjct: 858  NSLGNVIQFIYGEDGIDAAHIEKQTLDTIGGSD-VAFERRYRIDLLNPEHSLDPTLLESG 916

Query: 952  T---GLLPYEIVRETDNVLKPLEEKLIRYDNLGA-------VVPKELIDDERYADRHDAE 1001
            +   G L  + + + +      + + +R   +         V  + +I + +   R D  
Sbjct: 917  SEIAGDLKLQALLDEEYKQLVEDRRFLREIFVDGESNWPLPVNIRRIIQNAQQTFRIDHS 976

Query: 1002 RAFYKSLR---MYMQEKAARLAQIRNTRGLLEMTQNGGDTSME-VVSSELQAS-VDQVYK 1056
            +    ++R     ++E    L  +R    ++E  Q+   T    +V S L    + Q YK
Sbjct: 977  KPSDLTIRDIVFGIKELQEHLLVLRGKSEIIEKAQSDAITLFCCLVRSRLATRRILQEYK 1036

Query: 1057 ITKKNVNAFLTIALHKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTL 1116
            +TK+     L     ++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVAS  VT 
Sbjct: 1037 LTKQAFQWVLNNVESQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTS 1096

Query: 1117 GVPRIKEIINASKVISTPIINAVLVN--EGDERAARVVKGRIEKTLLSDLA-----FYIQ 1169
            GVPR+KEI+N +K + TP +   L +    D+  A+ ++  IE T L  +      +Y  
Sbjct: 1097 GVPRLKEILNVAKNMKTPSLTVYLKDGYSSDQEKAKFIRSAIEHTTLKSITVASEIYYDP 1156

Query: 1170 D-----------VYRGNMSYL----EIRVDLATIEKLQLEL---TMEDIAVALSRAPKLK 1211
            D           + + + S +    E  +D  +   L+LEL    M D  + + +  +  
Sbjct: 1157 DPRSTVIPEDDEIIQLHFSLMDDETEQSLDRQSPWLLRLELDRAAMNDKDLTMGQVGERI 1216

Query: 1212 IQT--TDIHIL----GKDKIHVN---VYPEGMKAKSISTSAKEPSENEVFYKMQTLRRSL 1262
             +T   D+ ++      +K+ +    V P+ + A++      E  E+ +  K++     L
Sbjct: 1217 KETFKNDLFVIWSEDNAEKLIIRCRVVRPKSLDAET------EAEEDHMLKKIENTM--L 1268

Query: 1263 PDVVVKGLPDISRAVINIRD------DGKRE------LLVEGYGLREVMCTDGVIGSKTI 1310
             ++ ++G+ +I R V+   D       G+ E      L  +G  L EVM   G+  ++  
Sbjct: 1269 ENITLRGVENIERVVMMKYDRKVPSATGEYEKVPEWVLETDGVNLSEVMTVPGIDATRIY 1328

Query: 1311 TNHVLEVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFG 1370
            TN  +++  VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +G +  +TR G
Sbjct: 1329 TNSFIDIMEVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHG 1388

Query: 1371 LSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVV 1426
             ++     L   SFE+T + LF+A    + D   GVSE ++LGQ   +GTG+F V+
Sbjct: 1389 FNRASTGALMRCSFEETVEILFEAGASAELDDCRGVSENVLLGQMAPIGTGAFDVM 1444

>TDEL0C02320 Chr3 complement(403851..409034) [5184 bp, 1727 aa] {ON}
            Anc_7.314 YDL140C
          Length = 1727

 Score =  691 bits (1782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/1483 (33%), Positives = 752/1483 (50%), Gaps = 140/1483 (9%)

Query: 11   KKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGVSSSSQECMTC 70
            + +  ++F   +  ++ A S  +I   +  D  + R  K GG  D R+G    + +C TC
Sbjct: 12   RTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTR-AKIGGLNDPRLGSIDRNLKCQTC 70

Query: 71   HGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDRRDFLKELRRP 130
               +  C GHFGHI LA PVFH+G+     ++ +C+C  C  +LL D +     +++R+ 
Sbjct: 71   QEGMNECPGHFGHIDLAKPVFHIGFITKIKKVCECVCMHCGKLLLDDHN-----EQMRQA 125

Query: 131  -GIDNLRKMSILKKVIDQCKKQRRCLKCXXXXXXXXXXXXXXXXXSLKIIHDTFRWVGKK 189
              I + +K      +   CK +   + C                        T R  G K
Sbjct: 126  CKIKDSKKR--FNAIWTLCKTK---MICESDVPSEEDPTKLISRGGCGNAQPTVRKDGLK 180

Query: 190  MVPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCELLGINSTVR 249
            +V     W  E N      PE +R        L   + L +FK +  ED   LG N    
Sbjct: 181  LV---GSWKKEKNTGDPEEPE-QRI-------LTMEEILNIFKHISKEDSNRLGFNEEF- 228

Query: 250  SGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIKAGLAKGISI 309
              RPE  I   LP PP  +RPS++  +S    EDDLT KL +I+  +  ++     G   
Sbjct: 229  -ARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHNGAPH 286

Query: 310  NNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGKQGRFRGNLS 369
            + + E    LQ  VA Y+++D    A  P A    G+  P++    RLKGK+GR RGNL 
Sbjct: 287  HAIEEAESLLQFHVATYMDNDI---AGQPQALQKSGR--PVKSIRARLKGKEGRIRGNLM 341

Query: 370  GKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLIINGPTVHPG 429
            GKRVDFS RTVIS DPNL +D+V VP+ +AK LT+PE VT YN  +L  L+ NGP  HPG
Sbjct: 342  GKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTFLVRNGPNEHPG 401

Query: 430  ANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSLHRLSILSHY 489
            A Y+++ N + R +LRY  +    + LQYG  VERH+ D D VLFNRQPSLH++S+++H 
Sbjct: 402  AKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHR 459

Query: 490  AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGEP 549
             K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P+S +P
Sbjct: 460  VKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKP 519

Query: 550  IIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFD--IPPPAIMKPYYLWTGK 607
             +   QD + G   ++ +D+F +L  +  +L  + D    +D  IP PAI+KP  LWTGK
Sbjct: 520  CMGIVQDTLCGIRKLTLRDNFIELDQVLNMLYWVPD----WDGVIPTPAIIKPKPLWTGK 575

Query: 608  QVFSLLIRPNKKSPVVINLDA--KNKVYIPPKDKSFPNEMSINDGFVIIRGSEILSGVMD 665
            Q+ S+ I      P  I+L    +    + PKD          +G +II G +I+ GV+D
Sbjct: 576  QILSIAI------PKGIHLQRFDEGTTLLSPKD----------NGMLIIDG-KIIFGVVD 618

Query: 666  KSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPSSDLRD 725
            K  +G      + + + R+ GPQ  A     + K+   +  + GFS GI D         
Sbjct: 619  KKTVGSSSG-GLIHVVTREKGPQICARLFGNIQKVVNYWFLHNGFSTGIGDTIADGQTMR 677

Query: 726  KKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINEL 785
            +  E +  A  K +++    +   L  + G    ++ E  +   L++ R++ G +    L
Sbjct: 678  EITETIADAKKKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAEVNL 737

Query: 786  DNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKTPQSK 845
             +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P+SK
Sbjct: 738  KDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESK 797

Query: 846  GFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDDTVR 905
            GFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD T R
Sbjct: 798  GFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDSTTR 857

Query: 906  TSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFN---KNETGLLPYEIVRE 962
             S   ++QF YG DG+D   +E  A  ++ I   D A    +     N   LL   ++  
Sbjct: 858  NSLGNVIQFVYGEDGMDASHIEKQA--IDTIGGSDSAFEKRYRIDLLNPDHLLDPSLLES 915

Query: 963  TDNVLKPLEEKLIRYDNLGAVVP----------------------KELIDDERYADRHDA 1000
               ++  L+ +++  +    +V                       + ++ + +   R D 
Sbjct: 916  GSEIVGDLKLQVLLDEEYKQLVEDRFFLRSVFVDGEPNWPLPVNIRRIVQNAQQTFRIDH 975

Query: 1001 ERAFYKSLR-MYMQEKAARLAQIRNTRGLLEMTQNGGDTSMEVVSSELQA-----SVDQV 1054
             +    S+R +Y   K  +  ++   RG  E+ +N    ++ +    +++      V + 
Sbjct: 976  TKPSDLSIRDVYFAVKNLQ-DKLLVLRGNSEIIKNAQQDAVSLFCCLMRSRLATRRVIEE 1034

Query: 1055 YKITKKNVNAFLTIALHKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNV 1114
            Y++TK+     L     ++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVAS  V
Sbjct: 1035 YRLTKQAFEWVLNNIEIQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKV 1094

Query: 1115 TLGVPRIKEIINASKVISTPIINAVLVN---------EGDERAARVVKGRIEKTLLSDLA 1165
            T GVPR+      +K I + I +  L +         + D R+  +     E   +  L 
Sbjct: 1095 TSGVPRLXXXXEKAKFIRSAIEHTTLKSVTVASEIYYDPDPRSTVIA----EDEEIIQLH 1150

Query: 1166 FYIQDVYRGNMSYLEIRVDLATIEKLQLEL---TMEDIAVALSRAPKLKIQTT---DIHI 1219
            F + D         E  +D  +   L+LEL    M D  + + +  + KI+ T   D+ +
Sbjct: 1151 FSLLD------DETEKSLDQQSPWLLRLELDRAAMNDKDLTMGQVGE-KIKETFKNDLFV 1203

Query: 1220 L----GKDKIHVNVYPEGMKAKSISTSAKEPSENEVFYKMQTLRRSLPDVVVKGLPDISR 1275
            +      +K+ +       K+  I T A+   E+ +  K++     L ++ ++G+ +I R
Sbjct: 1204 IWSEDNAEKLIIRCRVVRPKSMDIETEAE---EDHMLKKIENTM--LENITLRGVENIER 1258

Query: 1276 AVINIRD------DGKRE------LLVEGYGLREVMCTDGVIGSKTITNHVLEVNSVLGI 1323
             V+   D       G+        L  +G  L EVM   GV   +  TN  +++  VLGI
Sbjct: 1259 VVMMKYDRKVPSATGEYHKVPEWVLETDGVNLSEVMTVPGVDSKRIYTNSFIDIMEVLGI 1318

Query: 1324 EAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLAS 1383
            EA RA++  E+   +++ G  V+ RH+ LL DVMT +G +  +TR G ++     L   S
Sbjct: 1319 EAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSATGALMRCS 1378

Query: 1384 FEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVV 1426
            FE+T + LF+A    + D   GVSE +ILGQ   +GTGSF V+
Sbjct: 1379 FEETVEILFEAGACAEMDDCRGVSENVILGQMAPIGTGSFDVM 1421

>Kpol_162.1 s162 complement(211..4146) [3936 bp, 1311 aa] {ON}
            complement(211..4146) [3936 nt, 1312 aa]
          Length = 1311

 Score =  641 bits (1654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/1158 (36%), Positives = 634/1158 (54%), Gaps = 112/1158 (9%)

Query: 348  KPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEK 407
            +P++    RLKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP+ +AK LT+PE 
Sbjct: 2    RPVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEV 61

Query: 408  VTRYNKRKLQQLIINGPTVHPGANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLE 467
            VT YN  +L QL+ NGP  HPGA Y+++ N + R +LRY  +    + LQYG  VERH+ 
Sbjct: 62   VTPYNIDRLTQLVRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIM 119

Query: 468  DGDVVLFNRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEA 527
            D D VLFNRQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE 
Sbjct: 120  DNDPVLFNRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEET 179

Query: 528  RAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAK 587
            RAE   L  V   +++P+S +P +   QD + G   ++ +DSF +   +  +L  + D  
Sbjct: 180  RAELSQLCAVPMQIVSPQSNKPCMGIVQDTLCGIRKLTLRDSFIEFDQVLNMLYWVPD-- 237

Query: 588  LQFD--IPPPAIMKPYYLWTGKQVFSLLIRPNKKSPVVINLDA--KNKVYIPPKDKSFPN 643
              +D  IP PAI+KP  LWTGKQ+ S+ I      P  I+L    +    + PKD     
Sbjct: 238  --WDGVIPQPAILKPKPLWTGKQILSIAI------PKGIHLQRFDEGTTMLSPKD----- 284

Query: 644  EMSINDGFVIIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCAR 703
                 +G ++I G +I+ GV+DK  +G      + + + R+ GPQ  A     + K+   
Sbjct: 285  -----NGMLVIDG-QIVFGVVDKKTVGSSSG-GLIHVVTREKGPQVCAKMFGNIQKVVNF 337

Query: 704  YLGNRGFSIGISDVTPSSDLRDKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLE 763
            +L + GFS GI D     +   +  E +  A  K +E+    +   L  + G    ++ E
Sbjct: 338  WLLHNGFSTGIGDTIADGETMKEITETIAEAKKKVEEVTKEAQANLLTAKHGMTLRESFE 397

Query: 764  AKIGGLLSKVREEVGDVCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRV 823
              +   L++ R++ G +    L++ N    M + GSKGS +N++QM A VGQQ + G R+
Sbjct: 398  DNVVRFLNEARDKAGRLAEVNLNDTNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRI 457

Query: 824  PDGFQDRSLPHFQKNSKTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETG 883
              GF DR+LPHF K+  +P+SKGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETG
Sbjct: 458  AFGFVDRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETG 517

Query: 884  YMSRRLMKSLEDLSCQYDDTVRTSANGIVQFTYGGDGLDP-------LDMEGNAKPVNFI 936
            Y+ RRL+K+LED+   YD T R S   ++QF YG DG+D        +D  G +      
Sbjct: 518  YIQRRLVKALEDIMVHYDSTTRNSLGNVIQFVYGEDGIDASYIEKQSIDTIGGSNQAFEK 577

Query: 937  R------SWDHACNITFNKNETGLL-PYEIVRETDNVLKPL--EEKLIRYDNLGA----- 982
            R      S +H+ + T  ++ + ++   +I    D   K L  + + +R   +       
Sbjct: 578  RYRIDLMSPEHSLDTTLLESGSEIIGDVKIQSMLDEEYKQLVNDRRFLRNVFIDGEQNWP 637

Query: 983  --VVPKELIDDERYADRHDAERAFYKSLR--MY-MQEKAARLAQIRNTRGLLEMTQNGGD 1037
              V  + ++ + +   R D  +    ++R  +Y ++E  ++L  +R    ++E  QN   
Sbjct: 638  LPVNIRRIVQNAQQTFRIDHTKPSDLTIRDVVYGVKELESKLLVLRGKSKIIEEAQNDAI 697

Query: 1038 TSM-EVVSSELQA-SVDQVYKITKKNVNAFLTIALHKYHRAKVEPGTAVGAIGAQSIGEP 1095
            T    ++ S L A  V + Y++TK+  +  L+    ++ R+ V PG  VG + AQSIGEP
Sbjct: 698  TLFCCLLRSRLAARRVLEEYRLTKQAFDWVLSNIESQFLRSIVHPGEMVGVLAAQSIGEP 757

Query: 1096 GTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVNEG--DERAARVVK 1153
             TQMTL TFHFAGVAS  VT GVPR+KEI+N +K + TP     L  E   D+  A+ ++
Sbjct: 758  ATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSSTVYLEPEYAIDQEKAKFIR 817

Query: 1154 GRIEKTLLSDLA-----FYIQD-----------VYRGNMSYLEIRVDLATIEK----LQL 1193
              IE T L  +      +Y  D           + + + S L+   + A   +    L+L
Sbjct: 818  SAIEHTTLKSVTVASEIYYDPDPRSTVIPDDEEIIQLHFSLLDDETEKALDNQSPWLLRL 877

Query: 1194 EL---TMEDIAVALSRAPKLKIQTT---DIHIL----GKDKIHVN---VYPEGMKAKSIS 1240
            EL    M D  + + +  + KI+ T   D+ ++      DK+ +    V P+ + A++  
Sbjct: 878  ELDRAAMNDKDLTMGQVGE-KIKETFKNDLFVIWSEDNADKLIIRCRVVRPKSLDAET-- 934

Query: 1241 TSAKEPSENEVFYKMQTLRRSLPDVVVKGLPDISRAVINIRD------DGKRE------L 1288
                E  E+ +  K++     L  + ++G+ DI R V+   D      +G  E      L
Sbjct: 935  ----EAEEDHMLKKIENTM--LESITLRGVEDIERVVMMKYDRKMPSENGAYEKVPEWVL 988

Query: 1289 LVEGYGLREVMCTDGVIGSKTITNHVLEVNSVLGIEAARASIVGEIDYTMSNHGMSVDPR 1348
              +G  L EVM   GV  ++  TN  +++  VLGIEA RA++  E+   +++ G  V+ R
Sbjct: 989  ETDGVNLLEVMTVTGVDPTRIYTNSFIDITEVLGIEAGRAALYREVYNVIASDGSYVNYR 1048

Query: 1349 HIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSE 1408
            H+ LL DVMT +G +  +TR G ++     L   SFE+T + LF+A    + D   GVSE
Sbjct: 1049 HMALLVDVMTTQGSLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSE 1108

Query: 1409 CIILGQTMSVGTGSFKVV 1426
             +ILGQ   VGTG+F V+
Sbjct: 1109 NVILGQMAPVGTGAFDVM 1126

>CAGL0I03828g Chr9 complement(328922..334069) [5148 bp, 1715 aa] {ON}
            highly similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140c RPO21 DNA-directed RNA polymerase II
          Length = 1715

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/1516 (32%), Positives = 746/1516 (49%), Gaps = 183/1516 (12%)

Query: 11   KKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGVSSSSQECMTC 70
            + +  ++F   +  +I A S  +I   +  D  + R  K GG  D R+G    + +C TC
Sbjct: 12   RTVKEVQFGLFSPEEIRAISVAKIRLPETMDETQTR-AKIGGLNDPRLGSIDRNLKCQTC 70

Query: 71   HGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDRRDFLKELRRP 130
               +  C GHFGHI LA PVFH+G+     ++ + +C  C  +LL + +      E  R 
Sbjct: 71   QEGMNECPGHFGHIDLAKPVFHIGFITKIKKVCESLCMHCGKLLLDEHN------EQMRQ 124

Query: 131  GIDNLRKMSILKKVIDQCKKQRRCLKCXXXXXXXXXXXXXXXXXSLKIIHDTFRWVGKKM 190
             I           V   CK +   + C                        T R  G K+
Sbjct: 125  AIQIKDPKKRFNAVWSLCKTK---MVCETDVPSEDDPTKLISRGGCGNTQPTIRKDGLKL 181

Query: 191  VP--EKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCELLGINSTV 248
            V   +KD+  G+ +E     PE     +R    L+  + L +FK +  ED   LG N   
Sbjct: 182  VGSWKKDKSTGDADE-----PE-----QRV---LSTEEILNIFKHISPEDSYRLGFNEEF 228

Query: 249  RSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIKAGLAKGIS 308
               RPE  I   LP PP  +RPS++  +S    EDDLT KL +I+  +  ++     G  
Sbjct: 229  --ARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHNGAP 285

Query: 309  INNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGKQGRFRGNL 368
             + + E    LQ  VA Y+++D    A  P A    G  +P++    RLKGK+GR RGNL
Sbjct: 286  HHAVEEAESLLQFHVATYMDNDI---AGQPQALQKSG--RPVKSIRARLKGKEGRIRGNL 340

Query: 369  SGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLIINGPTVHP 428
             GKRVDFS RTVIS DPNL +D+V VP+ +A+ LT+PE VT YN  +L QL+ NGP  HP
Sbjct: 341  MGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLSQLVRNGPNEHP 400

Query: 429  GANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSLHRLSILSH 488
            GA Y+++ N + R +LRY  +    + LQYG  VERH+ D D VLFNRQPSLH++S+++H
Sbjct: 401  GAKYVIRDNGD-RIDLRYSKRSGDVQ-LQYGWKVERHIMDDDPVLFNRQPSLHKMSMMAH 458

Query: 489  YAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGE 548
              K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P+S +
Sbjct: 459  RVKVVPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNK 518

Query: 549  PIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFD--IPPPAIMKPYYLWTG 606
            P +   QD + G   ++ +D+F +   +  +L  + D    +D  IP PAI+KP  LW+G
Sbjct: 519  PCMGIVQDTLCGIRKLTLRDTFLEFDQVLNMLYWVPD----WDGVIPTPAIIKPKPLWSG 574

Query: 607  KQVFSLLIRPNKKSPVVINLDA--KNKVYIPPKDKSFPNEMSINDGFVIIRGSEILSGVM 664
            KQ+ S+ I      P  I+L    +    + PKD          +G ++I G EI+ GV+
Sbjct: 575  KQILSVAI------PKGIHLQRFDEGTTLLSPKD----------NGMLVIDG-EIIFGVV 617

Query: 665  DKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPSSDLR 724
            DK  +G      + + + R+ GP   A     + K+   +L + GFS GI D        
Sbjct: 618  DKKTVG-SSSGGLIHVVTREKGPTICARLFGNIQKVVNFWLLHNGFSTGIGDTVADGQTM 676

Query: 725  DKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINE 784
             +  E +  A  K + +    +   L  + G    ++ E  +   L++ R+  G +    
Sbjct: 677  REISETIAEAKQKVEAVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDRAGRLAEMN 736

Query: 785  LDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKTPQS 844
            L +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P+S
Sbjct: 737  LKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGFGFVDRTLPHFSKDDYSPES 796

Query: 845  KGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDDTV 904
            KGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD T 
Sbjct: 797  KGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDGTT 856

Query: 905  RTSANGIVQFTYGGDGLDP-------LDMEGNAKPVNFIRSWDHACNITFNKNETGLLP- 956
            R S   ++QF YG DG+D        LD  G +    F R +      T N  E  LL  
Sbjct: 857  RNSLGNVIQFIYGEDGMDAGHIEKQSLDTMGGSDQA-FERRYRIDLLNTSNSLEPSLLES 915

Query: 957  -YEIVRETDNVLKPLEEKLIRYDNLGAVVPKELIDDERYADR--HDAERAFYKSLRMYMQ 1013
              EI+ +   V   L+E+            K+L+ D R+      D E ++   + +   
Sbjct: 916  GSEIIGDL-KVQMALDEEY-----------KQLVKDRRFLRTIFSDGESSWPLPVNI--- 960

Query: 1014 EKAARLAQIRNTRGLLEMTQNGGDTSMEVVSS---------ELQASVDQVYKITKKNVNA 1064
                R+ Q       ++ T+    T  E+++S          L++  + + K     V  
Sbjct: 961  ---RRIIQNAQQTFRIDHTKPSDLTIPEIINSVRDLQDRLLVLRSKSEIIKKAQDDAVTL 1017

Query: 1065 FLTI---------ALHKYHRAKVEPGTAVGAIGAQ---SIGEPGTQMTLKTFHFAGVASM 1112
            F  +          L +Y   K      +  + AQ   SI  PG  + +      G  + 
Sbjct: 1018 FCCLLRSRLATRRVLQEYRLTKEAFEWVLNNVEAQFLRSIVHPGEMVGVLAAQSIGEPAT 1077

Query: 1113 NVTL---------------GVPRIKEIINASKVISTPIINAVLVNE--GDERAARVVKGR 1155
             +TL               GVPR+KEI+N +K + TP +   L  E   D+  A++V+  
Sbjct: 1078 QMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPEYSADQEKAKLVRSA 1137

Query: 1156 IEKTLLSDLA-----FYIQD-----------VYRGNMSYL----EIRVDLATIEKLQLEL 1195
            IE T L  +      +Y  D           + + + S L    E  +D  +   L+LEL
Sbjct: 1138 IEHTTLKSVTVASEIYYDPDPRSTVIPEDDEIIQLHFSLLDDETEKLLDQQSPWLLRLEL 1197

Query: 1196 ---TMEDIAVALSRAPKLKIQTT---DIHIL----GKDKIHVN---VYPEGMKAKSISTS 1242
                M D  + + +  + +I+ T   D+ ++      +K+ +    V P+ + A++    
Sbjct: 1198 DRAAMNDKDLTMGQVGE-RIKDTFKNDLFVIWSEDNAEKLIIRCRVVRPKALDAET---- 1252

Query: 1243 AKEPSENEVFYKMQTLRRSLPDVVVKGLPDISRAVINIRD------DGKRE------LLV 1290
              E  E+ +  K++     L ++ ++G+  I R V+   D       G+ +      L  
Sbjct: 1253 --EAEEDHMLKKIENTM--LENITLRGIEGIERVVMMKYDRKVPNETGEYQKVPEWVLET 1308

Query: 1291 EGYGLREVMCTDGVIGSKTITNHVLEVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHI 1350
            +G  L EVM   GV  ++  TN  +++  VLGIEA RA++  E+   +++ G  V+ RH+
Sbjct: 1309 DGVNLSEVMTVPGVDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHM 1368

Query: 1351 QLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECI 1410
             LL DVMT +G +  +TR G ++     L   SFE+T + LF+A    + D   GVSE +
Sbjct: 1369 ALLVDVMTTQGGLTSVTRHGFNRSSTGALMRCSFEETVEILFEAGASAELDDCRGVSENV 1428

Query: 1411 ILGQTMSVGTGSFKVV 1426
            ILGQ   +GTG+F V+
Sbjct: 1429 ILGQMAPIGTGAFDVM 1444

>Kwal_55.21464 s55 (850323..851285) [963 bp, 320 aa] {OFF} YOR116C
            (RPO31) - RNA polymerase III large subunit [contig 130]
            FULL
          Length = 320

 Score =  519 bits (1336), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 250/312 (80%), Positives = 282/312 (90%)

Query: 1140 LVNEGDERAARVVKGRIEKTLLSDLAFYIQDVYRGNMSYLEIRVDLATIEKLQLELTMED 1199
            LVN  DERAARVVKGRIEKTLLSD+AFYIQDVY+ N+S+L++++DL TIEKLQLELT+ED
Sbjct: 4    LVNMNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNLSFLQVKIDLGTIEKLQLELTIED 63

Query: 1200 IAVALSRAPKLKIQTTDIHILGKDKIHVNVYPEGMKAKSISTSAKEPSENEVFYKMQTLR 1259
            IAVA++RA KLKI   D+ I+GKDK+++NVYPEG K KSISTSAKEP ENE+FY++Q LR
Sbjct: 64   IAVAITRASKLKIAAQDVSIIGKDKVNINVYPEGSKLKSISTSAKEPIENELFYRVQHLR 123

Query: 1260 RSLPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTITNHVLEVNS 1319
            RSLP +VVKGLPDI+RAVINI+ DG RELLVEGYGLR+VM TDGV+G KT TNH+LEV S
Sbjct: 124  RSLPGIVVKGLPDIARAVINIKSDGSRELLVEGYGLRDVMTTDGVVGHKTKTNHILEVVS 183

Query: 1320 VLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVL 1379
            VLGIEAAR SIVGEIDYTMSNHGMSVDPRH+QLLGDVMTYKGEVLGITRFGLSKMRDSVL
Sbjct: 184  VLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEVLGITRFGLSKMRDSVL 243

Query: 1380 QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVVKYNDVSERDLKVR 1439
            QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMS+GTG+FKVVK  ++S  +LK +
Sbjct: 244  QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTNLSSEELKPK 303

Query: 1440 PTLFESLASETA 1451
             TLFESL   TA
Sbjct: 304  ATLFESLCGNTA 315

>KNAG0C03970 Chr3 complement(778936..784101) [5166 bp, 1721 aa] {ON}
           Anc_7.314 YDL140C
          Length = 1721

 Score =  561 bits (1446), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 348/916 (37%), Positives = 505/916 (55%), Gaps = 58/916 (6%)

Query: 11  KKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGVSSSSQECMTC 70
           + +  ++F   +  ++ A S  +I   +  D  + R  K GG  D R+G    + +C TC
Sbjct: 12  RTVKEVQFGLFSPEEVRAISVAKIKFPETMDETQTR-AKIGGLNDPRLGSIDRNLKCQTC 70

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDRRDFLKELRRP 130
              ++ C GHFGHI LA PVFHVG+     ++ +C+C  C  +LL + +     +++R+ 
Sbjct: 71  QEGMSECPGHFGHIDLAKPVFHVGFITKIKKVCECVCMHCGKLLLDENN-----EQMRQV 125

Query: 131 -GIDNLRKMSILKKVIDQCKKQRRCLKCXXXXXXXXXXXXXXXXXSLKIIHDTFRWVGKK 189
             I + +K          CK +   + C                        T R  G K
Sbjct: 126 MAIKDPKKR--FNATWALCKTK---MVCETDVPSENDPTKLVSRGGCGNTQPTVRKDGLK 180

Query: 190 MVPEKDRWIGEWNEILT-HHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCELLGINSTV 248
           +V       G W    T    E E+ V      L+  + L +FK + +ED   LG N   
Sbjct: 181 LV-------GSWKRKKTIEGEEPEQRV------LSTEEILNIFKHISTEDFIRLGFNEEF 227

Query: 249 RSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIKAGLAKGIS 308
              RPE  I   LP PP  +RPS++  +S    EDDLT KL +I+  +  ++     G  
Sbjct: 228 --SRPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHNGAP 284

Query: 309 INNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGKQGRFRGNL 368
            + + E    LQ  VA Y+++D    A  P A    G+  P++    RLKGK+GR RGNL
Sbjct: 285 HHAIEEAESLLQFHVATYMDNDI---AGQPQALQKSGR--PVKSIRARLKGKEGRIRGNL 339

Query: 369 SGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLIINGPTVHP 428
            GKRVDFS RTVIS DPNL +D+V VP+ +A+ LT+PE VT YN  +L QL+ NGP  HP
Sbjct: 340 MGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQLVRNGPNEHP 399

Query: 429 GANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSLHRLSILSH 488
           GA Y++++N + R +LRY  +    + LQYG  VERH+ D D VLFNRQPSLH++S+++H
Sbjct: 400 GAKYVIRENGD-RIDLRYSKRAGDVQ-LQYGWKVERHIMDDDPVLFNRQPSLHKMSMMAH 457

Query: 489 YAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGE 548
             K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P+S +
Sbjct: 458 KVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNK 517

Query: 549 PIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFD--IPPPAIMKPYYLWTG 606
           P +   QD + G  +++ +D+F +L  +  +L  + D    +D  IP PAI+KP  LWTG
Sbjct: 518 PCMGIVQDTLCGIRILTLRDTFLELDHVLNMLYWVPD----WDGVIPTPAILKPKPLWTG 573

Query: 607 KQVFSLLIRPNKKSPVVINLDAKNKVYIPPKDKSFPNEMSINDGFVIIRGSEILSGVMDK 666
           KQ+ S+ I PN    + +    +    + PKD          +G +II G +I+ GV+DK
Sbjct: 574 KQILSVAI-PNG---IHLQRFDEGTTLLSPKD----------NGMLIIDG-QIIFGVVDK 618

Query: 667 SVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPSSDLRDK 726
             +G      + + + R+ GPQ  A     + K+   +L + GFS GI D         +
Sbjct: 619 KTVGSSSG-GLIHVVTREKGPQTCARLFGNIQKVVNFWLLHNGFSTGIGDTIADGATIKE 677

Query: 727 KEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELD 786
             E +  A  K +E+    +   L  + G    ++ E  +   L++ R++ G +    L+
Sbjct: 678 ITETIAEAKKKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAEVNLN 737

Query: 787 NLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKTPQSKG 846
           + N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P+SKG
Sbjct: 738 DTNFVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGFGFVDRTLPHFSKDDYSPESKG 797

Query: 847 FVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDDTVRT 906
           FV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD+T R 
Sbjct: 798 FVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRN 857

Query: 907 SANGIVQFTYGGDGLD 922
           S   ++QF YG DG+D
Sbjct: 858 SLGNVIQFIYGEDGID 873

 Score =  180 bits (457), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 134/418 (32%), Positives = 217/418 (51%), Gaps = 54/418 (12%)

Query: 1055 YKITKKNVNAFLTIALHKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNV 1114
            Y++TK+  N  L     ++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVAS  V
Sbjct: 1034 YRLTKEAFNWVLNNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKV 1093

Query: 1115 TLGVPRIKEIINASKVISTPIINAVLVNE--GDERAARVVKGRIEKTLLSDLA-----FY 1167
            T GVPR+KEI+N +K + TP +   L ++   D+  A++++  IE T L  +      +Y
Sbjct: 1094 TSGVPRLKEILNVAKNMKTPSLTVYLKDDYSSDQEKAKLIRSAIEHTTLKSVTVASEIYY 1153

Query: 1168 IQD-----------VYRGNMSYL----EIRVDLATIEKLQLEL---TMEDIAVALSRAPK 1209
              D           + + + S L    E  +D  +   L+LEL    M D  + + +  +
Sbjct: 1154 DPDPRSTVIEEDEEIIQLHFSLLDDEMESSLDQQSPWLLRLELDRAAMNDKDLTMGQVGE 1213

Query: 1210 LKIQT--TDIHIL----GKDKIHVN---VYPEGMKAKSISTSAKEPSENEVFYKMQTLRR 1260
               +T   D+ ++      +K+ +    V P+ + A++      E  E+ +  K++    
Sbjct: 1214 RIKETFKNDLFVIWSEDNAEKLIIRCRVVRPKSLDAET------EAEEDHMLKKIENTM- 1266

Query: 1261 SLPDVVVKGLPDISRAVINIRD------DGKRELLVE------GYGLREVMCTDGVIGSK 1308
             L ++ ++G+ +I R V+   D       G+ + + E      G  L EVM   GV  ++
Sbjct: 1267 -LENITLRGVENIERVVMMKYDRKVPNESGEYQKVPEWVLESDGVNLAEVMQVPGVDATR 1325

Query: 1309 TITNHVLEVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITR 1368
              TN  +++  VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +G +  +TR
Sbjct: 1326 IYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTR 1385

Query: 1369 FGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVV 1426
             G ++     L   SFE+T + LF+A    + D   GVSE ++LGQ   +GTG+F V+
Sbjct: 1386 HGFNRSNTGALMRCSFEETVEILFEAGAAAELDDCRGVSENVLLGQMAPIGTGAFDVM 1443

>KAFR0B01060 Chr2 complement(197351..202408) [5058 bp, 1685 aa] {ON}
           Anc_7.314 YDL140C
          Length = 1685

 Score =  555 bits (1430), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 350/925 (37%), Positives = 502/925 (54%), Gaps = 65/925 (7%)

Query: 11  KKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGVSSSSQECMTC 70
           + +  ++F   +  ++ A S  ++   +  D  + R  K GG  D R+G    + +C TC
Sbjct: 12  RTVKEVQFGLFSPEEVRAISVAKVRFPETMDETQTR-AKIGGLNDPRLGSIDRNLKCQTC 70

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDR--RDFLKELR 128
              +  C GHFGHI LA PVFHVG+     ++ + +C  C  +LL + +   R  LK   
Sbjct: 71  QEGMNECPGHFGHIDLAKPVFHVGFISKIKKVCESVCMHCGKLLLDEHNEQMRQVLK--- 127

Query: 129 RPGIDNLRKMSILKKVIDQCKKQRRCLKCXXXXXXXXXXXXXXXXXSLKIIHDTFRWVGK 188
              I + +K      V   CK +   + C                        T R  G 
Sbjct: 128 ---IKDPKKR--FNAVWSLCKTK---MICETDVPSENDPTQLISRGGCGNAQPTVRKDGL 179

Query: 189 KMVPEKDRWIGEW--NEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCELLGINS 246
           K+V       G W  ++  +   E E+ V    + LN      +FK +  ED   LG + 
Sbjct: 180 KLV-------GSWKKDKATSDGEEPEQRVLGVEEILN------IFKHISPEDSTKLGFDE 226

Query: 247 TVRSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIKAGLAKG 306
                RPE  I   LP PP  +RPS++  +S    EDDLT KL +I+  +  ++     G
Sbjct: 227 EF--ARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHNG 283

Query: 307 ISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGKQGRFRG 366
              + + E    LQ  VA Y+++D    A  P A    G+  P++    RLKGK+GR RG
Sbjct: 284 APHHAIEEAESLLQFHVATYMDNDI---AGQPQALQKSGR--PVKSIRARLKGKEGRIRG 338

Query: 367 NLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLIINGPTV 426
           NL GKRVDFS RTVIS DPNL +D+V VP+ +A+ LT+PE VT YN  +L QL+ NGP  
Sbjct: 339 NLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQLVRNGPNE 398

Query: 427 HPGANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSLHRLSIL 486
           HPGA Y+++ N + R +LRY  +    + LQYG  VERH+ D D VLFNRQPSLH++S++
Sbjct: 399 HPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDDDPVLFNRQPSLHKMSMM 456

Query: 487 SHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKS 546
           SH  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P+S
Sbjct: 457 SHRVKVVPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQS 516

Query: 547 GEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFD--IPPPAIMKPYYLW 604
            +P +   QD + G  +++ KD+F +   +  +L  + D    +D  IP PAI+KP  LW
Sbjct: 517 NKPCMGIVQDTLCGIRILTLKDTFLEFDHVLNMLYWVPD----WDGIIPTPAILKPKPLW 572

Query: 605 TGKQVFSLLIRPNKKSPVVINLDA--KNKVYIPPKDKSFPNEMSINDGFVIIRGSEILSG 662
           TGKQ+ S  I      P  I+L    +    + PKD          +G +II G +I+ G
Sbjct: 573 TGKQILSAAI------PKGIHLQRFDEGTTLLSPKD----------NGMLIIDG-QIIFG 615

Query: 663 VMDKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPSSD 722
           V+DK  +G      + + + R+ GPQ  +     + K+   +L + GFS GI D   + +
Sbjct: 616 VVDKKTVGSSSG-GLIHVVTREKGPQVCSRLFGNIQKVVNFWLLHNGFSTGIGDTIANGE 674

Query: 723 LRDKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCI 782
              +  E +  A  K +E+    +   L  + G    ++ E  +   L++ R++ G +  
Sbjct: 675 TIKEITETIAEAKKKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAE 734

Query: 783 NELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKTP 842
             L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P
Sbjct: 735 VNLNDTNYVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGYGFVDRTLPHFSKDDYSP 794

Query: 843 QSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDD 902
           +SKGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD 
Sbjct: 795 ESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDG 854

Query: 903 TVRTSANGIVQFTYGGDGLDPLDME 927
           T R S   I+QF YG DG+D   +E
Sbjct: 855 TTRNSLGNIIQFIYGEDGIDASHIE 879

 Score =  180 bits (457), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 134/423 (31%), Positives = 216/423 (51%), Gaps = 56/423 (13%)

Query: 1051 VDQVYKITKKNVNAFLTIALHKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVA 1110
            V Q Y++TK++ +  +     ++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVA
Sbjct: 1031 VIQEYRLTKESFDWVINNIESQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVA 1090

Query: 1111 SMNVTLGVPRIKEIINASKVISTPIINAVLVNE--GDERAARVVKGRIEKTLLSDLAFYI 1168
            S  VT GVPR+KEI+N +K + TP +   L  +   D+  A+ ++  IE T L  +    
Sbjct: 1091 SKKVTSGVPRLKEILNVAKNMKTPSLTVYLEEKYAADQERAKYIRSAIEHTTLKSVTVAS 1150

Query: 1169 QDVYRGNMSYLEIRVDLATIEKLQLELTMEDIAVAL-SRAPKL----------------- 1210
            +  Y  +     I  D   I+ L   L  E++  +L  ++P L                 
Sbjct: 1151 EIYYDPDPRSTVIEDDEEIIQ-LHFSLLDEEMEASLDQQSPWLLRLELDRAAMNDKDLTM 1209

Query: 1211 -----KIQTT---DIHIL----GKDKIHVN---VYPEGMKAKSISTSAKEPSENEVFYKM 1255
                 +I+ T   D+ ++      +K+ +    V P+G+ A++      E  E+ +  K+
Sbjct: 1210 GQVGERIKETFKKDLFVIWSEDNAEKLIIRCRVVRPKGLDAET------EAEEDHMLKKI 1263

Query: 1256 QTLRRSLPDVVVKGLPDISRAVINIRD------DGKRE------LLVEGYGLREVMCTDG 1303
            +     L ++ ++G+ +I R V+   D       G+ +      L  +G  L EVM   G
Sbjct: 1264 ENTM--LENITLRGVENIERVVMMKYDRKVPSKTGEFQKVPEWVLETDGVNLAEVMTIPG 1321

Query: 1304 VIGSKTITNHVLEVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEV 1363
            V  ++  TN  +++  VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +G +
Sbjct: 1322 VDTTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTCQGGL 1381

Query: 1364 LGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSF 1423
              +TR G ++     L   SFE+T + LF+A    + D   GVSE ++LGQ   +GTG+F
Sbjct: 1382 TSVTRHGFNRANTGALMRCSFEETVEILFEAGASAELDDCRGVSENVLLGQMAPIGTGAF 1441

Query: 1424 KVV 1426
             V+
Sbjct: 1442 GVM 1444

>CAGL0E05500g Chr5 (539213..544144) [4932 bp, 1643 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341w RPA190 DNA-directed RNA polymerase I
          Length = 1643

 Score =  438 bits (1126), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 314/971 (32%), Positives = 490/971 (50%), Gaps = 113/971 (11%)

Query: 252  RPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIK------AGLAK 305
            + + +    L  PP   R    + D    N  +    L++I+ TS LI+      + L K
Sbjct: 337  KADMFFMDVLVVPPTRFRLPSKLGDEVHENSQNQL--LSKILTTSLLIRDLNDELSTLQK 394

Query: 306  G--------ISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRL 357
                     I  + +M  +  +Q  V  +I+S            + GGKV PI G  Q L
Sbjct: 395  DKVSLEDRRIIFSRLMNAFVTIQNDVNSFIDSTK-------AQGNTGGKV-PIPGVKQAL 446

Query: 358  KGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQ 417
            + K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP + A  LT+PE VT YN  +L+
Sbjct: 447  EKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELR 506

Query: 418  QLIINGPTVHPGANYLLKKNEEARRNLRYGDKLKLAKNL--------------QYGDVVE 463
            Q IINGP   PGA+ +  +NE+       G  L+  K L                   V 
Sbjct: 507  QAIINGPDKWPGASQI--QNEDGSLISLVGMTLEQRKALANQLMTPSSNPYTHTLNKKVY 564

Query: 464  RHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVP 522
            RH+++ D+VL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H P
Sbjct: 565  RHIKNRDIVLMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFP 624

Query: 523  QTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLL-- 580
            Q E ARAEA NL    +  LTP SG P+    QD I+    +++KDSFF      Q +  
Sbjct: 625  QNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIYG 684

Query: 581  ------SMMSDAKLQFDIPPPAIMKPYYLWTGKQVFSLLIRPNKKSPVV--INLDAKNKV 632
                     + AKL     PPAI KP  LWTGKQ+ + ++  N   P +  INL + NK+
Sbjct: 685  CIRPEDGHATRAKLV--TLPPAIHKPIPLWTGKQIITTVLL-NVTPPDMPGINLKSSNKI 741

Query: 633  YIPPKDKSFPNEMSINDGFVIIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAAN 692
                K++ +      ND  VI +  ++L G++DKS  G   K+ + +++   YGP+ AA 
Sbjct: 742  ----KNEYWGKHSEEND--VIFKDGQLLCGILDKSQYG-ASKYGIVHSLHEVYGPETAAK 794

Query: 693  TMNRMAKLCARYLGNRGFSIGISDVTPSSD----LRDKKEEMVRFAYAKCDELIDMFKNG 748
             ++ + +L   Y+ N  F+ G+ D+  +SD      D  +E V        E+ ++ K+ 
Sbjct: 795  VLSVLGRLFTNYIMNTAFTCGMDDLRLTSDGNKWRSDILKESVDIGRQAAAEVTNLDKDT 854

Query: 749  ---------KLETQPGCNEEQTL-----EAKIGGLLSKVREEVGDVCINELDNLNAPLIM 794
                     +LE     N +  +      AK+  + SKV  +       +    N+   M
Sbjct: 855  PSNDPELLKRLEEILRDNNKLGILDAVSSAKVNTITSKVVSQCVPGGTMKKFPENSMQAM 914

Query: 795  ATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKTPQSKGFVRNSFFS 854
            A  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F+       + G+++  F+S
Sbjct: 915  ALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYIKGRFYS 974

Query: 855  GLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDDTVRTSANGIVQF 914
            G+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YD++VR +   ++QF
Sbjct: 975  GIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDADGTLIQF 1034

Query: 915  TYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIVRETDNVLKPLEEKL 974
             YGGD +D +  E +    NF      A    +N       P  +V   D       E  
Sbjct: 1035 LYGGDAVDVIK-ESHMTEFNFCLDNYDALLKKYN-------PSALVEHVD------VETA 1080

Query: 975  IRYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAARLAQIRNTRGLLEMTQN 1034
            ++Y        K+ + + +   +H  E+ + ++L+         L++    + L  +++N
Sbjct: 1081 LKYS-------KKTLKNRK---KHKDEKHYKQTLKY-----DPVLSKYNPAKYLGAVSEN 1125

Query: 1035 GGDTSMEVVSSELQASVDQVYKITKKNVNAFLTIALHKYHRAKVEPGTAVGAIGAQSIGE 1094
              D  +E+   +   +  +   I +K   A + +   KY R+ + PG AVG I +QS+GE
Sbjct: 1126 FQD-KLELFLDKSSKTFKEYESINEKKFRALMQL---KYMRSLINPGEAVGIIASQSVGE 1181

Query: 1095 PGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNEGDERAARVVK 1153
            P TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   + N+  +  A    
Sbjct: 1182 PSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPIWNDVSDETADTFC 1241

Query: 1154 GRIEKTLLSDL 1164
              I K +LS++
Sbjct: 1242 KSISKVILSEV 1252

 Score = 90.1 bits (222), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 52/163 (31%), Positives = 89/163 (54%), Gaps = 2/163 (1%)

Query: 1265 VVVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTIT-NHVLEVNSVLGI 1323
             +++ +P I R +    ++GKR L+ EG   + +   +  I    IT N +  V    G+
Sbjct: 1477 TIIRQVPHIDRCIRPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDIASVLQTYGV 1536

Query: 1324 EAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLAS 1383
            EAAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S
Sbjct: 1537 EAARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-S 1595

Query: 1384 FEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVV 1426
            +E T   L  A    +++ +E  S  I+LG+  +VGTG+F ++
Sbjct: 1596 YETTCQFLTKAVLDNEREQLESPSARIVLGKLNNVGTGAFDIL 1638

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 51/117 (43%), Gaps = 3/117 (2%)

Query: 12  KISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGVSSSSQECMTCH 71
           +IS ++F  L +ADI   S   IT   + D        +GG  D  +G    +  C TC 
Sbjct: 10  EISSVDFGILTSADIRNLSAKRITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CGTCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDRRDFLKELR 128
            +   C GH GHI+L +P ++  +F      L+  C  C    L   D   +  +LR
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSACLFCHHFKLKSLDVHRYACKLR 123

>Kwal_26.6979 s26 complement(150350..155314) [4965 bp, 1654 aa] {ON}
            YOR341W (RPA190) - RNA polymerase I subunit 190 (alpha)
            [contig 46] FULL
          Length = 1654

 Score =  431 bits (1109), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 312/976 (31%), Positives = 490/976 (50%), Gaps = 123/976 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVTMQDSPASNEDDLTVKLTEIVWTSSLIK---------- 300
            R + +    +  PP   R PS   ++   ++++ L   L++I+ TS LI+          
Sbjct: 345  RADMFFLEVVIVPPTRFRLPSKLGEEIHENSQNQL---LSKILTTSLLIRDLNEEMSKLQ 401

Query: 301  ----AGLAKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQR 356
                +   K +  N +M  +  +Q  V  +I+S            S GGKV PI G  Q 
Sbjct: 402  KDKVSAQDKIVIFNRLMNAFVTIQNDVNAFIDSTKAQ-------GSAGGKV-PIPGVKQA 453

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKL 416
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP + A  LT+PE VT YN  +L
Sbjct: 454  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAEL 513

Query: 417  QQLIINGPTVHPGANYLLKKNEEARRNLRYG----DKLKLAKNL----------QYGDVV 462
            +Q +INGP   PGA+ +  +NE+       G     +  LA  L               V
Sbjct: 514  RQAVINGPDKWPGASQI--QNEDGSLVSLVGMTTEQRKALANQLLTPSSHSSTHSLNKKV 571

Query: 463  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHV 521
             RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 572  YRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHF 631

Query: 522  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLS 581
            PQ E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSFF      Q + 
Sbjct: 632  PQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREEYQQYIY 691

Query: 582  MM------SDAKLQFDIPPPAIMKPYYLWTGKQVFS-LLIRPNKKSPVVINLDAKNKVYI 634
                       + +    PPA+MKP  LWTGKQ+ + +L+         INL +KNK+  
Sbjct: 692  GCIRPEDGHATRNKLVTVPPAVMKPVPLWTGKQIITTVLLNVTPADMPGINLISKNKI-- 749

Query: 635  PPKDKSFPNEMSINDGFVIIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTM 694
              K+  +    + ND  VI +  E+L G++DKS  G   K+ + +++   YGP  +A  +
Sbjct: 750  --KNDYWGKHSTEND--VIFKNGELLCGILDKSQYG-ASKYGIVHSLHEVYGPAVSAKVL 804

Query: 695  NRMAKLCARYLGNRGFSIGISDVTPS-------SDLRDKKEEMVRFAYAKCDEL------ 741
            + + +L   Y+    F+ G+ D+  +       SD+     ++ R A A+   L      
Sbjct: 805  SVLGRLFTNYITATAFTCGMDDLRLTDDGNKWRSDILKTSTDVGRAAAAEVTNLDPDVSA 864

Query: 742  --IDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCI-----NELDNLNAPLIM 794
               ++ K  + E     N+   L+A     ++ +  +V   C+      +  N N+   M
Sbjct: 865  NDTELLKRLE-EILRDDNKLGILDAVTSSKVNTITSQVVSKCVPGGTMKKFPN-NSMQAM 922

Query: 795  ATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKTPQSKGFVRNSFFS 854
            A  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F+       + G+++  F+S
Sbjct: 923  ALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMISGKTLPSFKPFETDAMAGGYIKGRFYS 982

Query: 855  GLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDDTVRTSANGIVQF 914
            G+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YD++VR +   ++QF
Sbjct: 983  GIRPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDADGTLIQF 1042

Query: 915  TYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIVRETDNVLKPLEEKL 974
             YGGD +D +  E +     F      A    +N       P  ++   D       E  
Sbjct: 1043 LYGGDAVD-VTQESHMTEFKFCADNYDALLKKYN-------PSALIEHLD------VESA 1088

Query: 975  IRYDNLGAVVPKELIDDERYADR--HDAERAFYKSLRMYMQEKAARLAQIRNTRGLLEMT 1032
            ++Y        K+ + + +  +R  H A++  Y  +          +++   ++ L  ++
Sbjct: 1089 LKYS-------KKALKNRKKNERVPHFAQKVKYDPV----------VSKFNPSKYLGSVS 1131

Query: 1033 QNGGDTSMEVVSS--ELQASVDQVYKITKKNVNAFLTIALHKYHRAKVEPGTAVGAIGAQ 1090
            +N  D     + S  EL  S D V      N   F  +   KY R+ + PG AVG I +Q
Sbjct: 1132 ENFQDKLESFIDSNNELFKSRDSV------NEKKFRALMQLKYMRSLINPGEAVGIIASQ 1185

Query: 1091 SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIIN-AVLVNEGDERA 1148
            S+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   +L +  D +A
Sbjct: 1186 SVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILADVTDSQA 1245

Query: 1149 ARVVKGRIEKTLLSDL 1164
                K  I K +LS++
Sbjct: 1246 DTFCKS-ITKVMLSEV 1260

 Score = 88.2 bits (217), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 89/162 (54%), Gaps = 2/162 (1%)

Query: 1266 VVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTIT-NHVLEVNSVLGIE 1324
            V++ + +I R V    ++GKR L+ EG   +E+   D  +    IT N V  V    G+E
Sbjct: 1487 VIREVKNIDRCVHPEPENGKRILVTEGVNFQEMWDQDAFVDVNGITSNDVSSVLKTYGVE 1546

Query: 1325 AARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1384
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1547 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1605

Query: 1385 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVV 1426
            E T   L  A    + + ++  S  ++LG+  +VGTG+F V+
Sbjct: 1606 ETTCQFLTKAVLDNESENLDSPSARLVLGKLNNVGTGAFDVL 1647

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 59/134 (44%), Gaps = 6/134 (4%)

Query: 12  KISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGVSSSSQECMTCH 71
           +I+ ++F  + A DI   S ++IT   + D        +GG  D  +G    +  C TC 
Sbjct: 10  EITSVDFGVMTAQDIRNFSAMQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CATCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDRRDF---LKELR 128
            +   C GH GHI+L +P ++  +F      L+  C  C    L   +   +   LK L+
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFSQLYIYLRSSCLYCHGFRLKAPEVHRYACKLKLLQ 126

Query: 129 RPGIDNLRKMSILK 142
              ID   ++  L+
Sbjct: 127 YGLIDECHRLDELR 140

>ZYRO0D04532g Chr4 (374177..379180) [5004 bp, 1667 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1667

 Score =  430 bits (1105), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 310/977 (31%), Positives = 493/977 (50%), Gaps = 119/977 (12%)

Query: 249  RSGRPETYIWRYLPAPPVCIR-PSVTMQDSPASNEDDLTVKLTEIVWTSSLIK------A 301
            +S  P+ +    +  PP   R PS   ++   + ++ L   L++++ TS LI+      +
Sbjct: 349  KSVTPDVFFMEVVLVPPTRFRLPSKLGEEVHENTQNQL---LSKVLTTSLLIRDLNDEMS 405

Query: 302  GLAKG--------ISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGF 353
             L K         +  + +M  +  +Q  V  +I+S            S GGKV PI G 
Sbjct: 406  NLQKDKVSVEDRRVIFSRLMNAFVTIQNDVNSFIDSTKAQ-------GSTGGKV-PIPGV 457

Query: 354  CQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNK 413
             Q L+ K+G FR ++ GKRV+ + R+VISPDPN+  +E+ VP + A  LT+PE VT YN 
Sbjct: 458  KQALEKKEGLFRKHMMGKRVNHAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNI 517

Query: 414  RKLQQLIINGPTVHPGANYLLKKNEEA-----------RRNLRYGDKLKLAKNLQYGDV- 461
             +L+Q +INGP   PGA  +  +NE+            +RN      L  + N     + 
Sbjct: 518  AELRQAVINGPDKWPGATQI--QNEDGSLVSLVGMTLEQRNALANQLLTPSSNPATHTLN 575

Query: 462  --VERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMN 518
              V RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN
Sbjct: 576  KKVFRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMN 635

Query: 519  LHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQ 578
            +H PQ E AR+EA NL    +  LTP SG P+    QD I+    +++KDSFF      Q
Sbjct: 636  MHFPQNENARSEAFNLANTDSQYLTPTSGSPLRGLIQDHISAGVWLTNKDSFFTRDQYQQ 695

Query: 579  LLSMM------SDAKLQFDIPPPAIMKPYYLWTGKQVFSLLIRPNKKSPVV-INLDAKNK 631
             +            + +    PPA+MKP  LWTGKQ+ + +I     + +  INL +KNK
Sbjct: 696  YIYGCIRPEDGHSTRPKIVTVPPAVMKPVPLWTGKQIITTVIMNVTPADMPGINLLSKNK 755

Query: 632  VYIPPKDKSFPNEMSINDGFVIIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAA 691
            +    K++ +    + N+  VI +   +L G++DKS  G   K+ + +++   YGP+ AA
Sbjct: 756  I----KNEYWGQGSTENE--VIFKDGALLCGILDKSQYG-ASKYGIVHSLHEVYGPETAA 808

Query: 692  NTMNRMAKLCARYLGNRGFSIGISDVTPSSDLRDKKEEMVRFAYAKCDELIDMFKNGKLE 751
              ++ + +L   ++ N  FS G+ D+  +++    ++++++ +     +      N  L 
Sbjct: 809  KVLSVLGRLFTNFITNTAFSCGMDDLRLTAEGNKDRKDLLKTSTDVGRQAAAEVTN--LP 866

Query: 752  TQPGCNEEQTLE--------------------AKIGGLLSKVREEVGDVCINELDNLNAP 791
            T    N+ + L+                    +K+  + SKV   V      +    N+ 
Sbjct: 867  TDTPSNDPELLKRLEEILRDDNKSGILDAVTSSKVNSVTSKVVSTVIPKGTMKKFPQNSM 926

Query: 792  LIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKTPQSKGFVRNS 851
              MA  G+KGST+NVSQ++ ++GQQ + G RVP     ++LP F+       + G+++  
Sbjct: 927  QAMALSGAKGSTVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDSMAGGYIKGR 986

Query: 852  FFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDDTVRTSANGI 911
            F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YD+TVR     +
Sbjct: 987  FYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGIHVSYDNTVRDGDGTL 1046

Query: 912  VQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIVRETDNVLKPLE 971
            VQF YGGD +D    E +    +F      A    +N       P  +V   D       
Sbjct: 1047 VQFLYGGDAVDTTK-ESHMTQFDFCLENYDALLRKYN-------PSALVEHLD------V 1092

Query: 972  EKLIRYDNLGAVVPKELIDDE---RYADRHDAERAFYKSLRMYMQEKAARLAQIRNTRGL 1028
            E  ++Y    A+  ++ ID E   + +D++D   + Y          A  L  +      
Sbjct: 1093 ESALKYSK-KALKSRKKIDKEPHYKNSDKYDPVLSKYNP--------AKYLGSVS----- 1138

Query: 1029 LEMTQNGGDTSMEVVSSELQASVDQVYKITKKNVNAFLTIALHKYHRAKVEPGTAVGAIG 1088
             E  Q+  +  ++  S +L+        I +K   A + +   KY R+ V PG AVG I 
Sbjct: 1139 -EKFQDKLEGFLDSHSKQLKLHSG----INEKKFRALMQL---KYMRSLVNPGEAVGIIA 1190

Query: 1089 AQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNEGDER 1147
            AQS+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP ++  + N   + 
Sbjct: 1191 AQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIVMTASAAIKTPQMSLPVWNHVSDD 1250

Query: 1148 AARVVKGRIEKTLLSDL 1164
             A +    I K +LS++
Sbjct: 1251 QASIFCKSITKVVLSEV 1267

 Score = 80.1 bits (196), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 84/162 (51%), Gaps = 2/162 (1%)

Query: 1266 VVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTI-TNHVLEVNSVLGIE 1324
            V++ +P ISR +       +R L  EG   + +   +  I    I +N V  V    G+E
Sbjct: 1500 VIREVPHISRCIPGEPVGDRRMLTTEGVNFQAMWDQEMFIDVDGIRSNDVAAVLRTYGVE 1559

Query: 1325 AARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1384
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S +++ S+
Sbjct: 1560 AARNTIVYEINNVFSRYAISVSFRHLDLIADLMTRQGNYLAFNRQGMETSTSSFMKM-SY 1618

Query: 1385 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVV 1426
            E T   L  A     ++ ++  S  I+LG+  +VGTG+F V+
Sbjct: 1619 ETTCQFLTKAVLDNDREKLQSPSARIVLGKLNNVGTGAFDVL 1660

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 52/117 (44%), Gaps = 3/117 (2%)

Query: 12  KISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGVSSSSQECMTCH 71
           +IS ++F+  +A +I   S  +IT   + D        +GG  D  +G    +  C TC 
Sbjct: 10  EISSVDFNVFSAEEIRNLSAKQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CATCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDRRDFLKELR 128
            +   C GH GHI+L +P ++  +F      L+  C  C    L   +   F  +LR
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFSQLYIYLRSSCLYCHRFRLRSIEVNRFACKLR 123

>KLLA0F23243g Chr6 (2165407..2170368) [4962 bp, 1653 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1653

 Score =  429 bits (1103), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 309/975 (31%), Positives = 483/975 (49%), Gaps = 115/975 (11%)

Query: 254  ETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIK------------- 300
            + +    L  PP   R    + D    N  +    L++I+ TS LI+             
Sbjct: 353  DMFFMEVLIVPPTRFRLPSKLGDEVHENTQNQL--LSKILTTSLLIRDLNDEMSRLQKDK 410

Query: 301  -AGLAKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKG 359
             +   + +  N +M  +  +Q  V  +I+S           SS G KV PI G  Q L+ 
Sbjct: 411  VSADDRKVIFNRLMNAFVTIQNDVNAFIDSTK-------AQSSSGNKV-PIPGLKQALEK 462

Query: 360  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQL 419
            K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP + A  LT+PE VT YN  +L+Q 
Sbjct: 463  KEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNVAELRQA 522

Query: 420  IINGPTVHPGANYLLKKNEEARRNLRYGDKLKLAKNL-------QYGDV-------VERH 465
            +INGP   PGA  +  +NE+       G  L+  K L          DV       V RH
Sbjct: 523  VINGPDKWPGATQI--QNEDGSFVSLVGMTLEQRKALANQLLTPSTHDVAHSINKKVYRH 580

Query: 466  LEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQT 524
            +++ DVV+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ 
Sbjct: 581  IKNRDVVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQN 640

Query: 525  EEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMM- 583
            E A+AEA+NL    +  LTP SG P+    QD I+    ++ KDSFF      Q +    
Sbjct: 641  ENAKAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCI 700

Query: 584  -----SDAKLQFDIPPPAIMKPYYLWTGKQVFS-LLIRPNKKSPVVINLDAKNKVYIPPK 637
                    + +    PPA+MKP  LWTGKQ+ + +L+     +   INL++KNK+    K
Sbjct: 701  RPEDGHATRNKLVTIPPAVMKPEPLWTGKQIITTVLLNTCPANMPGINLNSKNKI----K 756

Query: 638  DKSFPNEMSINDGFVIIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTMNRM 697
            ++ +      N+  V+ +  ++L G++DKS  G   K  + +++   YGP  AA  ++ +
Sbjct: 757  NEYWGKSSEENN--VVFKDGQLLCGILDKSQYG-ASKFGIVHSLHEVYGPDVAAKVLSVL 813

Query: 698  AKLCARYLGNRGFSIGISDVTPSS-------DLRDKKEEMVRFAYAKCDELIDMFK--NG 748
             +L   Y+    F+ G+ D+  ++       D+     ++ R A A+   L    K  +G
Sbjct: 814  GRLFTNYITATAFTCGMDDLRLTAEGNKWRNDILQTSVDIGRVAAAEVTNLDKDVKSDDG 873

Query: 749  KL-----ETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELDNLNAPL----IMATCGS 799
            +L     E     N+   L+A     ++ +  +V   C+ +      P      MA  G+
Sbjct: 874  ELLKRLEEILRDDNKLGILDAITSSKVNSITSQVVSKCVPDGTMKKFPYNSMQAMALSGA 933

Query: 800  KGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKTPQSKGFVRNSFFSGLTPP 859
            KGS +NVSQ++ ++GQQ + G RVP     ++LP F+      ++ G+++  F+SG+ P 
Sbjct: 934  KGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDARAGGYIKGRFYSGIRPQ 993

Query: 860  EFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDDTVRTSANGIVQFTYGGD 919
            E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YD++VR     ++QF YGGD
Sbjct: 994  EYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDGDGTLIQFLYGGD 1053

Query: 920  GLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIVRETDNVLKPLEEKLIRYDN 979
             +D             I    H     F            V   D +LK       +Y+ 
Sbjct: 1054 AVD-------------ITKESHMTEFKF-----------CVDNYDALLK-------KYNP 1082

Query: 980  LGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAAR--LAQIRNTRGLLEMTQNGGD 1037
               V   ++    +Y+ +    R     L  Y Q       L++   ++ L  +++N  D
Sbjct: 1083 SALVDHLDVESALKYSKKTLKNRKKNSKLPHYAQTSKYDPVLSKFNPSKYLGAVSENFQD 1142

Query: 1038 TSMEVVSSELQASVDQVYKITKKNVN--AFLTIALHKYHRAKVEPGTAVGAIGAQSIGEP 1095
               + +S+      D  +K   +NVN   F  +   KY R+ + PG AVG I +QS+GEP
Sbjct: 1143 KLEKFISTN-----DDFFK-KDENVNEKKFRALMQLKYMRSLINPGEAVGIIASQSVGEP 1196

Query: 1096 GTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNEGDERAARVVKG 1154
             TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   + ++  +  A     
Sbjct: 1197 STQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQLTMPIRDDVSDELADTFCK 1256

Query: 1155 RIEKTLLSDLAFYIQ 1169
             I K +LS++   +Q
Sbjct: 1257 NITKVMLSEVIDKVQ 1271

 Score = 87.4 bits (215), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 53/162 (32%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1266 VVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTI-TNHVLEVNSVLGIE 1324
            +++ +P I R V    ++GKR L+ EG   + +   D  I    I +N V  V    G+E
Sbjct: 1488 IIRQVPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQDDFIDINGIRSNDVAAVLKTYGVE 1547

Query: 1325 AARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1384
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1548 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGNYLAFNRQGMESSTSSLMKM-SY 1606

Query: 1385 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVV 1426
            E T   L  A    + + ++  S  I++G+   VGTGSF ++
Sbjct: 1607 ETTCQFLTKAVLDNEHEELKSPSAKIVMGKLNGVGTGSFDLL 1648

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 58/134 (43%), Gaps = 12/134 (8%)

Query: 12  KISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGVSSSSQECMTCH 71
           +I+ I+FS L + +I   S  ++T   + D      Q  GG  D  +G    +  C TC 
Sbjct: 10  EITSIDFSVLTSDEIRKLSAKQVTNPTVLDNLGHPIQ--GGLYDLALGAFLKNL-CATCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDRRDFLKELR--- 128
            +   C GH GHI+L +P ++  +F      L+  C  C    L   +   +  +LR   
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLFCHHFRLKSSEVHLYACKLRLLQ 126

Query: 129 ------RPGIDNLR 136
                 R  IDN+R
Sbjct: 127 YALIDERYQIDNIR 140

>YOR341W Chr15 (960987..965981) [4995 bp, 1664 aa] {ON}  RPA190RNA
            polymerase I largest subunit A190
          Length = 1664

 Score =  429 bits (1103), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 308/975 (31%), Positives = 489/975 (50%), Gaps = 121/975 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVTMQDSPASNEDDLTVKLTEIVWTSSLIK------AGLA 304
            + +++    L  PP   R PS   ++   ++++ L   L++++ TS LI+      + L 
Sbjct: 351  KADSFFMDVLVVPPTRFRLPSKLGEEVHENSQNQL---LSKVLTTSLLIRDLNDDLSKLQ 407

Query: 305  KG--------ISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQR 356
            K         +  + +M  +  +Q  V  +I+S         G +SG  KV PI G  Q 
Sbjct: 408  KDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQ-----GRTSG--KV-PIPGVKQA 459

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKL 416
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP + A  LT+PE VT YN  +L
Sbjct: 460  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAEL 519

Query: 417  QQLIINGPTVHPGANYLLKKNEEA-----------RRNLRYGDKLKLAKNLQYGDV---V 462
            +Q +INGP   PGA  +  +NE+            +R       L  + N+    +   V
Sbjct: 520  RQAVINGPDKWPGATQI--QNEDGSLVSLIGMSVEQRKALANQLLTPSSNVSTHTLNKKV 577

Query: 463  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDEMNLHV 521
             RH+++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 578  YRHIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHF 637

Query: 522  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLS 581
            PQ E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSFF      Q + 
Sbjct: 638  PQNENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIY 697

Query: 582  MM------SDAKLQFDIPPPAIMKPYYLWTGKQVFSLLIRPNKKSPVV--INLDAKNKVY 633
                       + +    PP I KPY LWTGKQ+ + ++  N   P +  INL +KNK+ 
Sbjct: 698  GCIRPEDGHTTRSKIVTLPPTIFKPYPLWTGKQIITTVLL-NVTPPDMPGINLISKNKIK 756

Query: 634  IPPKDK-SFPNEMSINDGFVIIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAAN 692
                 K S  NE+   DG        +L G++DKS  G   K+ + +++   YGP+ AA 
Sbjct: 757  NEYWGKGSLENEVLFKDG-------ALLCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAK 808

Query: 693  TMNRMAKLCARYLGNRGFSIGISDVTPSSDLRDKKEEMVRFAYAKCDELIDMFKNGKLET 752
             ++ + +L   Y+    F+ G+ D+  +++    + ++++ +     E      N   +T
Sbjct: 809  VLSVLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGREAAAEVTNLDKDT 868

Query: 753  QP--------------GCNEEQTLEAKIGGLLSKVREEVGDVCINELDNLNAPL----IM 794
                              N+   L+A     ++ +  +V   C+ +      P      M
Sbjct: 869  PADDPELLKRLQEILRDNNKSGILDAVTSSKVNAITSQVVSKCVPDGTMKKFPCNSMQAM 928

Query: 795  ATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKTPQSKGFVRNSFFS 854
            A  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F+       + G+V+  F+S
Sbjct: 929  ALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYS 988

Query: 855  GLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDDTVRTSANGIVQF 914
            G+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YD+++R +   +VQF
Sbjct: 989  GIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLVQF 1048

Query: 915  TYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIVRETDNVLKPLEEKL 974
             YGGD +D +  E +     F     +A    +N       P  ++   D       E  
Sbjct: 1049 MYGGDAID-ITKESHMTQFEFCLDNYYALLKKYN-------PSALIEHLD------VESA 1094

Query: 975  IRYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAARLAQIRNTRGLLEMTQN 1034
            ++Y        K L    +Y  +H  E  + +S++         LA+    + L  +++N
Sbjct: 1095 LKYSK------KTL----KYRKKHSKEPHYKQSVKY-----DPVLAKYNPAKYLGSVSEN 1139

Query: 1035 GGDTSMEVVSSELQASVDQVYKITKK----NVNAFLTIALHKYHRAKVEPGTAVGAIGAQ 1090
              D        +L++ +D+  K+ K     N   F  +   KY R+ + PG AVG I +Q
Sbjct: 1140 FQD--------KLESFLDKNSKLFKSSDGVNEKKFRALMQLKYMRSLINPGEAVGIIASQ 1191

Query: 1091 SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNEGDERAA 1149
            S+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP +   + N+  +  A
Sbjct: 1192 SVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASAAIKTPQMTLPIWNDVSDEQA 1251

Query: 1150 RVVKGRIEKTLLSDL 1164
                  I K LLS++
Sbjct: 1252 DTFCKSISKVLLSEV 1266

 Score = 89.7 bits (221), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 88/162 (54%), Gaps = 2/162 (1%)

Query: 1266 VVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTIT-NHVLEVNSVLGIE 1324
            +++ +P I R V    ++GKR L+ EG   + +   +  I    IT N V  V    G+E
Sbjct: 1497 IIRQIPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLKTYGVE 1556

Query: 1325 AARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1384
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S +++ S+
Sbjct: 1557 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1615

Query: 1385 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVV 1426
            E T   L  A    +++ ++  S  I++G+  +VGTGSF V+
Sbjct: 1616 ETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVL 1657

 Score = 42.0 bits (97), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 51/117 (43%), Gaps = 3/117 (2%)

Query: 12  KISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGVSSSSQECMTCH 71
           +I+ ++F  L A +I   S  +IT   + D        +GG  D  +G    +  C TC 
Sbjct: 10  EITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRNL-CSTCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDRRDFLKELR 128
            +   C GH GHI+L +P ++  +F      L+  C  C    L   +   +  +LR
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLR 123

>TDEL0H04000 Chr8 (680730..685727) [4998 bp, 1665 aa] {ON} Anc_7.51
            YOR341W
          Length = 1665

 Score =  425 bits (1093), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 305/974 (31%), Positives = 486/974 (49%), Gaps = 119/974 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVTMQDSPASNEDDLTVKLTEIVWTSSLIKAGLAKGISIN 310
            + + +    +  PP   R PS   ++   + ++ L   L++I+ TS LI+    +  +I 
Sbjct: 350  KADNFFMEVVLVPPTRFRLPSKMGEEVHENTQNQL---LSKILTTSLLIRDLNDEMSTIQ 406

Query: 311  NMMEHWDYLQLTVAMYINS-----DSVNPAMLPGASSGGGKVK-PIRGFCQRLKGKQGRF 364
                  D  ++  +  +N+     + VN  +    + G    K P+ G  Q L+ K+G F
Sbjct: 407  KDKVSVDDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQGSASSKIPVPGVKQALEKKEGLF 466

Query: 365  RGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLIINGP 424
            R ++ GKRV+++ R+VISPDPN+  +E+ VP + A  LT+PE VT YN  +L+Q +INGP
Sbjct: 467  RKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNIAELRQAVINGP 526

Query: 425  TVHPGANYLLKKNEEARRNLRYGDKLKLAKNLQ--------------YGDVVERHLEDGD 470
               PGA+ +  +NE+       G  L+  K L                   V RH+++ D
Sbjct: 527  DKWPGASQI--QNEDGTLVSLVGMTLEQRKALANQLMTPSSNVSTHPLNKKVYRHIKNRD 584

Query: 471  VVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARA 529
            VVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARA
Sbjct: 585  VVLMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARA 644

Query: 530  EAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLL------SMM 583
            EA NL    +  LTP SG P+    QD I+    ++ KDSFF      Q +         
Sbjct: 645  EAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREEYQQYIYGCIRPEHG 704

Query: 584  SDAKLQFDIPPPAIMKPYYLWTGKQVFS-LLIRPNKKSPVVINLDAKNKVYIPPKDKSFP 642
              ++ +    PPA++KP  LWTGKQ+ S +L+         INL++ NK+    K++ + 
Sbjct: 705  HASRGKIVTMPPAVLKPVPLWTGKQIISTVLLNVTPADMPGINLESNNKI----KNEYWG 760

Query: 643  NEMSINDGFVIIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCA 702
               + ND  VI +  E++ G++DKS  G   K+ + +++   YGP+ AA  ++ + +L  
Sbjct: 761  KGSTEND--VIFKNGELVCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAKVLSVLGRLFT 817

Query: 703  RYLGNRGFSIGISDVTPSSDLRDKKEEMV-------RFAYAKCDEL--------IDMFKN 747
             Y+    F+ G+ D+  +++    + E++       R A A+   L        +++ K 
Sbjct: 818  NYITATAFTCGMDDLRLTAEGNKSRSEILKTSIDIGRQAAAEVTNLDKDTPSDDVELLKR 877

Query: 748  GKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELDNLNAPL----IMATCGSKGST 803
             + E     N+   L+A     ++ V  +V   C+ +      P      MA  G+KGS 
Sbjct: 878  LE-EILRDENKSGILDAVTSSKVNTVTSKVVSTCVPDGTMKKFPYNSMQAMALSGAKGSN 936

Query: 804  LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKTPQSKGFVRNSFFSGLTPPEFLF 863
            +NVSQ++ ++GQQ + G RVP     ++LP F+       + G+++  F+SG+ P E+ F
Sbjct: 937  VNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDSMAGGYIKGRFYSGIKPQEYYF 996

Query: 864  HAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDDTVRTSANGIVQFTYGGDGLDP 923
            H ++GREGL+DTAVKT+ +GY+ R L K LE +   YD++VR     ++QF YGGD +D 
Sbjct: 997  HCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDGDGSLIQFLYGGDAVD- 1055

Query: 924  LDMEGNAKPVNFIRSWDHACNITFN--------KNETGLLPYEIV---RETDNVLKPLEE 972
            +  E +    +F R    A    +N          ET L   + V   R+ ++     E+
Sbjct: 1056 VTKESHMTQFDFCRENYDALLKKYNPVALAEHLDVETALQYSKKVSKNRKKNSKTAHYEQ 1115

Query: 973  KLIRYDN-LGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAARLAQIRNTRGLLEM 1031
            K ++YD  L    P + +              F+  L  Y+++KA               
Sbjct: 1116 K-VKYDPVLAKYNPAKYLG--------SVSEKFHDKLESYLEDKAKEFK----------- 1155

Query: 1032 TQNGGDTSMEVVSSELQASVDQVYKITKKNVNAFLTIALHKYHRAKVEPGTAVGAIGAQS 1091
                   S E VS+              K   A + +   KY R+ + PG AVG I +QS
Sbjct: 1156 -------SRESVSA--------------KRFRALMQL---KYMRSLINPGEAVGIIASQS 1191

Query: 1092 IGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNEGDERAAR 1150
            +GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   + ++  +  A 
Sbjct: 1192 VGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASSAIKTPQMTLPIWDDVSDEQAD 1251

Query: 1151 VVKGRIEKTLLSDL 1164
            +    I K +LS++
Sbjct: 1252 LFCKSISKVVLSEV 1265

 Score = 89.4 bits (220), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 55/162 (33%), Positives = 88/162 (54%), Gaps = 2/162 (1%)

Query: 1266 VVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTIT-NHVLEVNSVLGIE 1324
            V++ +P I R V +   + KR L+ EG   + +   +  I    IT N V  V    G+E
Sbjct: 1497 VIREVPHIDRCVHSEPVNNKRMLVTEGVNFQAMWDQEAFIDVDAITSNDVASVLRTYGVE 1556

Query: 1325 AARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1384
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1557 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1615

Query: 1385 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVV 1426
            E T   L  A    +++ +E  S  I+LG+  +VGTGSF ++
Sbjct: 1616 ETTCQFLTKAVLDNEREELESPSARIVLGKLSNVGTGSFDLL 1657

 Score = 41.2 bits (95), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 45/99 (45%), Gaps = 3/99 (3%)

Query: 12  KISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGVSSSSQECMTCH 71
           +I+ ++F+ L   DI   S  +IT   + D        +GG  D  +G    +  C TC 
Sbjct: 10  EITSLDFNILTPQDIRNLSAKQITNPTVLD--NLGHPISGGLYDLSLGAFLRNL-CSTCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDC 110
            +   C GH GHI+L +P ++  +F      L+  C  C
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSCCLFC 105

>Skud_15.506 Chr15 (901437..906434) [4998 bp, 1665 aa] {ON} YOR341W
            (REAL)
          Length = 1665

 Score =  425 bits (1093), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 308/998 (30%), Positives = 488/998 (48%), Gaps = 126/998 (12%)

Query: 234  LKSEDCELLGI-----NSTVRSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVK 288
             K E C L  +     N + +  + +++    +  PP   R    + D    N  +   +
Sbjct: 328  FKKEQCVLQYVFHSRPNLSRKVVKADSFFMDVIVVPPTRFRLPSKLGDEVHENSQN---Q 384

Query: 289  LTEIVWTSSLIKAGLAKGIS---------------INNMMEHWDYLQLTVAMYINSDSVN 333
            L   V T+SL+   L   +S                + +M  +  +Q  V  +I+S    
Sbjct: 385  LLSKVLTTSLLIRDLNDDLSKLQKDKVSLEDRKVIFSRLMNAFVTIQNDVNAFIDSTKAQ 444

Query: 334  PAMLPGASSGGGKVKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVA 393
                 G +SG  KV PI G  Q L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ 
Sbjct: 445  -----GRTSG--KV-PIPGVKQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIG 496

Query: 394  VPQLVAKVLTFPEKVTRYNKRKLQQLIINGPTVHPGANYLLKKNEEARR----NLRYGDK 449
            VP + A  LT+PE VT YN  +L+Q +INGP   PGA  +  +NE+        + +  +
Sbjct: 497  VPPVFAVKLTYPEPVTAYNIAELRQAVINGPDKWPGATQI--QNEDGSLVSLIGMSFEQR 554

Query: 450  LKLAKNL----------QYGDVVERHLEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTF 498
              LA  L               V RH+++ DVVL NRQP+LH+ S++ H  ++ P  +T 
Sbjct: 555  KALANQLLTPSSNVSTHTLNKKVYRHIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTL 614

Query: 499  RLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFI 558
            RL+      YNADFDGDEMN+H PQ E ARAEA+NL    +  LTP SG P+    QD I
Sbjct: 615  RLHYANTGAYNADFDGDEMNMHFPQNENARAEALNLANTDSQYLTPTSGSPVRGLIQDHI 674

Query: 559  TGSYLISHKDSFFDLGSLTQLLSMM------SDAKLQFDIPPPAIMKPYYLWTGKQVFSL 612
            +    ++ KDSFF      Q +            + +    PP I KPY LWTGKQ+ + 
Sbjct: 675  SAGVWLTSKDSFFTREQYQQYIYGCIRPEDGHTTRSKIVTLPPTIFKPYPLWTGKQIITT 734

Query: 613  LIRPNKKSPVV--INLDAKNKVYIPPKDK-SFPNEMSINDGFVIIRGSEILSGVMDKSVL 669
            ++  N   P +  INL +KNK+      K S  +E+   DG        +L G++DKS  
Sbjct: 735  VLL-NVTPPDMPGINLISKNKIKNEYWGKGSLESEVLFKDG-------ALLCGILDKSQY 786

Query: 670  GDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPSSDLRDKKEE 729
            G   K+ + +++   YGP+ AA  ++ + +L   Y+    F+ G+ D+  +++    + +
Sbjct: 787  G-ASKYGIVHSLHEVYGPEVAAKVLSVLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTD 845

Query: 730  MVRFAYAKCDELIDMFKNGKLETQP--------------GCNEEQTLEAKIGGLLSKVRE 775
            +++ +     +      N   ET                  N+   L+A     ++ +  
Sbjct: 846  ILKTSVDTGRQAAAEVTNLDKETPSDDPELLKRLQEILRDNNKSGILDAVTSSKVNVITS 905

Query: 776  EVGDVCINELDNLNAPL----IMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRS 831
            +V   C+ +      P      MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++
Sbjct: 906  QVVSKCVPDGTMKKFPCNSMQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKT 965

Query: 832  LPHFQKNSKTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMK 891
            LP F+       + G+V+  F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K
Sbjct: 966  LPSFKPYETDAMAGGYVKGRFYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTK 1025

Query: 892  SLEDLSCQYDDTVRTSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNE 951
             LE +   YD+++R +   ++QF YGGD +D +  E +     F     +A    +N   
Sbjct: 1026 QLEGVHVSYDNSIRDADGTLIQFMYGGDAVD-ITKESHMTQFEFCLDNYYALLKKYN--- 1081

Query: 952  TGLLPYEIVRETDNVLKPLEEKLIRYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMY 1011
                P  ++   D       E  ++Y        K L    +Y  +H  E  + +S++  
Sbjct: 1082 ----PSALIEHLD------VESALKYSK------KTL----KYRKKHSKEPHYKQSMKY- 1120

Query: 1012 MQEKAARLAQIRNTRGLLEMTQNGGDTSMEVVSSELQASVDQVYKITKK----NVNAFLT 1067
                   LA+    + L  +++N  D        +L++ +D+  K+ K     N   F  
Sbjct: 1121 ----DPVLAKYSPAKYLGSVSENFQD--------KLESFLDENSKLFKSTDGVNEKKFRA 1168

Query: 1068 IALHKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-N 1126
            +   KY R+ + PG AVG I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  
Sbjct: 1169 LMQLKYMRSLINPGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMT 1228

Query: 1127 ASKVISTPIINAVLVNEGDERAARVVKGRIEKTLLSDL 1164
            AS  I TP +   + ++  +  A      I K LLS++
Sbjct: 1229 ASAAIKTPQMTLPIWDDVSDEQADTFCKSISKVLLSEV 1266

 Score = 90.5 bits (223), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 91/169 (53%), Gaps = 6/169 (3%)

Query: 1259 RRSLPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTIT-NHVLEV 1317
            RRS    +++ +P I R V    ++GKR L+ EG   + +   +  I    IT N V  V
Sbjct: 1495 RRS----IIRQIPRIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAV 1550

Query: 1318 NSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDS 1377
                G+EAAR +IV EI+   S + +SV  RH+ LL D+MT +G  L   R G+     S
Sbjct: 1551 LKTYGVEAARNTIVNEINNVFSRYAISVSFRHLDLLADMMTRQGTYLAFNRQGMETSTSS 1610

Query: 1378 VLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVV 1426
             +++ S+E T   L  A    +++ ++  S  I++G+  +VGTGSF V+
Sbjct: 1611 FMKM-SYETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVL 1658

 Score = 42.0 bits (97), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 51/117 (43%), Gaps = 3/117 (2%)

Query: 12  KISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGVSSSSQECMTCH 71
           +I+ ++F  L A +I   S  +IT   + D        +GG  D  +G    +  C TC 
Sbjct: 10  EITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRNL-CSTCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDRRDFLKELR 128
            +   C GH GHI+L +P ++  +F      L+  C  C    L   +   +  +LR
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLR 123

>Smik_15.519 Chr15 (910592..915589) [4998 bp, 1665 aa] {ON} YOR341W
            (REAL)
          Length = 1665

 Score =  425 bits (1093), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 286/867 (32%), Positives = 445/867 (51%), Gaps = 96/867 (11%)

Query: 345  GKVKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTF 404
            GKV P+ G  Q L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP + A  LT+
Sbjct: 449  GKV-PVPGVKQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTY 507

Query: 405  PEKVTRYNKRKLQQLIINGPTVHPGANYLLKKNEEARRNLRYGDKLKLAKNL-------- 456
            PE VT YN  +L+Q +INGP   PGA  +  +NE+       G  L+  K L        
Sbjct: 508  PEPVTAYNIAELRQAVINGPDKWPGATQI--QNEDGSLVSLIGMSLEQRKALANQLLTPS 565

Query: 457  ------QYGDVVERHLEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYN 509
                       V RH+++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YN
Sbjct: 566  SNVSTHTLNKKVYRHIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYN 625

Query: 510  ADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDS 569
            ADFDGDEMN+H PQ E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDS
Sbjct: 626  ADFDGDEMNMHFPQNENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDS 685

Query: 570  FFDLGSLTQLLSMM------SDAKLQFDIPPPAIMKPYYLWTGKQVFSLLIRPNKKSPVV 623
            FF      Q +            + +    PP I KPY LWTGKQ+ + ++  N   P +
Sbjct: 686  FFTREQYQQYIYGCIRPEDGHTTRSKIVTLPPTIFKPYPLWTGKQIITTVLL-NVTPPDM 744

Query: 624  --INLDAKNKVYIPPKDK-SFPNEMSINDGFVIIRGSEILSGVMDKSVLGDGKKHSVFYT 680
              INL +KNK+      K S  NE+   DG        +L G++DKS  G   K+ + ++
Sbjct: 745  PGINLLSKNKIKNEYWGKGSLENEVLFKDG-------ALLCGILDKSQYG-ASKYGIVHS 796

Query: 681  ILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPSSDLRDKKEEMVRFAY----A 736
            +   YGP+ AA  ++ + +L   Y+    F+ G+ D+  +++    + ++++ +      
Sbjct: 797  LHEVYGPEVAAKVLSVLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGRQ 856

Query: 737  KCDELIDMFKNGKL----------ETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELD 786
               E+ ++ K+             E     N+   L+A     ++ +  +V   C+ +  
Sbjct: 857  AAAEVTNLDKDTPADDPELLKRLQEILRDNNKSGILDAVTSSKVNSITSQVVSKCVPDGT 916

Query: 787  NLNAPL----IMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKTP 842
                P      MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F+      
Sbjct: 917  MKKFPYNSMQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDA 976

Query: 843  QSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDD 902
             + G+V+  F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YD+
Sbjct: 977  MAGGYVKGRFYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDN 1036

Query: 903  TVRTSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIVRE 962
            ++R +   +VQF YGGD +D +  E +     F     +A    +N       P  ++  
Sbjct: 1037 SIRDADGTLVQFMYGGDAID-ITKESHMTQFEFCLDNYYALLKKYN-------PSALIEH 1088

Query: 963  TDNVLKPLEEKLIRYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAARLAQI 1022
             D       E  ++Y        K L    +Y  +H  E  + +S++         LA+ 
Sbjct: 1089 LD------VESALKYSK------KTL----KYRKKHIKEPHYKQSIKY-----DPVLAKY 1127

Query: 1023 RNTRGLLEMTQNGGDTSMEVVSSELQASVDQVYKITKK----NVNAFLTIALHKYHRAKV 1078
               + L  +++N  D        +L++ +D+  K+ K     N   F  +   KY R+ +
Sbjct: 1128 NPAKYLGSVSENFQD--------KLESFLDKGSKLFKSADGVNEKKFRALMQLKYMRSLI 1179

Query: 1079 EPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIIN 1137
             PG AVG I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP + 
Sbjct: 1180 NPGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASAAIKTPQMT 1239

Query: 1138 AVLVNEGDERAARVVKGRIEKTLLSDL 1164
              + ++  +  A      I K LLS++
Sbjct: 1240 LPIWDDVSDEQADTFCKSISKVLLSEV 1266

 Score = 89.4 bits (220), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 88/162 (54%), Gaps = 2/162 (1%)

Query: 1266 VVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTIT-NHVLEVNSVLGIE 1324
            +++ +P I R V    ++GKR L+ EG   + +   +  I    IT N V  V    G+E
Sbjct: 1498 IIRQIPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLKTYGVE 1557

Query: 1325 AARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1384
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S +++ S+
Sbjct: 1558 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1616

Query: 1385 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVV 1426
            E T   L  A    +++ ++  S  I++G+  +VGTGSF V+
Sbjct: 1617 ETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVL 1658

 Score = 42.0 bits (97), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 51/117 (43%), Gaps = 3/117 (2%)

Query: 12  KISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGVSSSSQECMTCH 71
           +I+ ++F  L A +I   S  +IT   + D        +GG  D  +G    +  C TC 
Sbjct: 10  EITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRNL-CSTCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDRRDFLKELR 128
            +   C GH GHI+L +P ++  +F      L+  C  C    L   +   +  +LR
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLR 123

>TPHA0H02800 Chr8 (659254..664200) [4947 bp, 1648 aa] {ON} Anc_7.51
            YOR341W
          Length = 1648

 Score =  424 bits (1091), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 312/1047 (29%), Positives = 504/1047 (48%), Gaps = 165/1047 (15%)

Query: 307  ISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGKQGRFRG 366
            I  + +M  +  +Q  V  +I+S            +  GK+ P+ G  Q L+ K+G FR 
Sbjct: 412  IIFSRLMNAFVTIQNDVNSFIDSSK-------AQGNNSGKL-PVPGVKQALEKKEGLFRK 463

Query: 367  NLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLIINGPTV 426
            ++ GKRV+++ R+VISPDPN+  DE+ VP + A  LT+PE VT YN  +L+Q +INGP  
Sbjct: 464  HMMGKRVNYAARSVISPDPNIETDEIGVPPVFATKLTYPEPVTSYNIAELRQAVINGPDK 523

Query: 427  HPGANYLLKKNEEARRNLRYGDKLKLAKNL--------------QYGDVVERHLEDGDVV 472
             PGA  +  +NE+       G  ++  K L                   V RH+++ DVV
Sbjct: 524  WPGATQI--QNEDGSLVSLIGMTVEQRKALANQLMTPSSNPATHTLNKKVYRHIKNRDVV 581

Query: 473  LFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEA 531
            + NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARAEA
Sbjct: 582  IMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEA 641

Query: 532  INLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMM------SD 585
             NL    +  LTP SG P+    QD I+    ++ KDS+F      Q +           
Sbjct: 642  FNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSYFTREQYQQYIYGCIRPEDGHS 701

Query: 586  AKLQFDIPPPAIMKPYYLWTGKQVFSLLIRPNKKSPV---VINLDAKNKVYIPPKDKSFP 642
            A  +    PPAI+KP  LWTGKQ+ + ++     SPV    INL +KNK+    KD+ + 
Sbjct: 702  ANNKLLTIPPAIIKPVPLWTGKQIITTVLL--NVSPVDMPGINLKSKNKI----KDEYWG 755

Query: 643  NEMSINDGFVIIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCA 702
                 N+  V+ +   +L G++DKS  G   K+ + + +   YGP+ AA  ++ + +L  
Sbjct: 756  QHSEENE--VLFKDGALLCGILDKSQYG-ASKYGIVHALQEVYGPEVAAKVLSVLGRLFT 812

Query: 703  RYLGNRGFSIGISDVTPSSDLRDKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTL 762
             Y+ N  F+ G+ D+  + +    + ++++ +       +D  +   +E     N E+  
Sbjct: 813  NYITNTAFTCGMDDLRLTDEGNKWRTDILKTS-------VDRGRQAAVEV---TNLEKDT 862

Query: 763  EAKIGGLLSKVREEVGD---------VCINELDNLNAPLI-------------------M 794
             A    LL ++ E + D         V  ++++ + + ++                   M
Sbjct: 863  SADDSELLKRLEEILRDDNKSGILDAVTSSKVNAITSQVVSKCVPGGTMKRFPENSMQSM 922

Query: 795  ATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKTPQSKGFVRNSFFS 854
            A  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F+       + G+++  F+S
Sbjct: 923  ALSGAKGSNVNVSQIMCLLGQQALEGRRVPIMVSGKTLPSFKPFETDAMAGGYIKGRFYS 982

Query: 855  GLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDDTVRTSANGIVQF 914
            G+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YD+TVR     +++F
Sbjct: 983  GIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNTVRDGDGTLIEF 1042

Query: 915  TYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIVRETDNVLKPLEEKL 974
             YGGD +D           +++  +D   +                   D++LK      
Sbjct: 1043 LYGGDAVD-------VTKESYMNQFDFCLD-----------------NYDSLLK------ 1072

Query: 975  IRYDNLGAVVPKELIDDE-RYADRHDAERAFYKSLRMYMQ--EKAARLAQIRNTRGLLEM 1031
             RY N  A++    +D   +Y+ +    R   K++  Y+Q  +    LA+    + L  +
Sbjct: 1073 -RY-NPAALIDFLDVDSALKYSKKTLKHRKKNKNVPHYLQNIKYDPVLAKYNPAKYLGSV 1130

Query: 1032 TQNGGDTSMEVVSSELQASVDQVYKITKK-NVNAFLTIALHKYHRAKVEPGTAVGAIGAQ 1090
            ++   D     + S       Q++K  K  N   F  +   KY R+ + PG AVG I +Q
Sbjct: 1131 SEKFQDKLENFLDSN-----SQLFKSHKSVNEKKFRALMQLKYMRSLINPGEAVGIIASQ 1185

Query: 1091 SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNEGDERAA 1149
            S+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   ++++  +  A
Sbjct: 1186 SVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILDDVTDDQA 1245

Query: 1150 RVVKGRIEKTLLSD---------------------LAFYIQDVYR--------------G 1174
             +    I K +LS+                     + FY QD Y                
Sbjct: 1246 DIFAKSISKVILSEVIDSVSVTETTTSQSRSYVISMKFYEQDEYNEEYDISKEELQNVVA 1305

Query: 1175 NMSYLEIRVDLATIEKLQLELTMEDIAVALSRAPKLKIQTTDIHILGKDKIHVNVYPEGM 1234
            N     + + +    K Q + T  D+ +A+   PK ++    +  L    +  N   +  
Sbjct: 1306 NNFLTSLEIAIHKEIKKQKKTTASDVGIAI---PKAQLALAAVEGLSSKVMEDNDEEQSR 1362

Query: 1235 KAKSISTSAKEPSENEVFYKMQTLRRS 1261
            K    + S  EP E+E+    +T+R +
Sbjct: 1363 KKTKQAVSYDEPDEDEI----ETMREA 1385

 Score = 90.5 bits (223), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 55/162 (33%), Positives = 89/162 (54%), Gaps = 2/162 (1%)

Query: 1266 VVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTIT-NHVLEVNSVLGIE 1324
            VV+ +P+I R V    ++GKR L+ EG   + +   +  +    IT N V  V    G+E
Sbjct: 1481 VVRQVPNIDRCVHPNAENGKRVLVTEGVNFQAMWEQNDFVNVDGITSNDVSSVLKTYGVE 1540

Query: 1325 AARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1384
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1541 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGSYLAFNRQGMETSTSSLMKM-SY 1599

Query: 1385 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVV 1426
            E T   L  A    +++ +   S  I+LG+  +VGTG+F V+
Sbjct: 1600 ETTCQFLTKAVLDNEREELNSPSARIVLGKLNNVGTGAFDVL 1641

 Score = 43.1 bits (100), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 47/99 (47%), Gaps = 3/99 (3%)

Query: 12  KISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGVSSSSQECMTCH 71
           +I+ ++FS L+A +I   S  +IT   + D        +GG  D  +G    +  C TC 
Sbjct: 10  EITSVDFSILSAEEIRNLSTKQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CSTCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDC 110
            +   C GH GHI+L +P ++  +F      L+  C  C
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLFC 105

>Suva_8.391 Chr8 (702691..707688) [4998 bp, 1665 aa] {ON} YOR341W
            (REAL)
          Length = 1665

 Score =  424 bits (1090), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 286/867 (32%), Positives = 445/867 (51%), Gaps = 96/867 (11%)

Query: 345  GKVKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTF 404
            GKV PI G  Q L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP + A  LT+
Sbjct: 449  GKV-PIPGVKQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTY 507

Query: 405  PEKVTRYNKRKLQQLIINGPTVHPGANYLLKKNEEARRNLRYGDKLKLAKNL-------- 456
            PE VT YN  +L+Q +INGP   PGA  +  +NE+       G  L+  K L        
Sbjct: 508  PEPVTAYNIAELRQAVINGPDKWPGATQI--QNEDGSLVSLIGMSLEQRKALANQLLTPS 565

Query: 457  ------QYGDVVERHLEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYN 509
                       V RH+++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YN
Sbjct: 566  SNVSTHTLNKKVYRHIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYN 625

Query: 510  ADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDS 569
            ADFDGDEMN+H PQ E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDS
Sbjct: 626  ADFDGDEMNMHFPQNENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDS 685

Query: 570  FFDLGSLTQLLSMM------SDAKLQFDIPPPAIMKPYYLWTGKQVFSLLIRPNKKSPVV 623
            FF      Q +            + +    PPAI KPY LWTGKQ+ + ++  N   P +
Sbjct: 686  FFTREQYQQYIYGCIRPEDGHTTRNKIITLPPAIFKPYPLWTGKQIITTVLL-NVTPPDM 744

Query: 624  --INLDAKNKVYIPPKDK-SFPNEMSINDGFVIIRGSEILSGVMDKSVLGDGKKHSVFYT 680
              INL + NK+      K S  NE+   DG        +L G++DKS  G   K+ + ++
Sbjct: 745  PGINLISTNKIKNEYWGKGSLENEVLFKDG-------ALLCGILDKSQYG-ASKYGIVHS 796

Query: 681  ILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPSSDLRDKKEEMVRFAY----A 736
            +   YGP+ AA  ++ + +L   Y+    F+ G+ D+  +++    + ++++ +      
Sbjct: 797  LHEVYGPEVAAKVLSVLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGRQ 856

Query: 737  KCDELIDMFKNGKL----------ETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELD 786
               E+ ++ K+             E     N+   L+A     ++ +  +V   C+ +  
Sbjct: 857  AAAEVTNLNKDTPADDAELLKRLQEILRDNNKSGILDAVTSSKVNVITSQVVSKCVPDGT 916

Query: 787  NLNAPL----IMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKTP 842
                P      MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F+      
Sbjct: 917  MKKFPCNSMQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDA 976

Query: 843  QSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDD 902
             + G+V+  F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YD+
Sbjct: 977  MAGGYVKGRFYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDN 1036

Query: 903  TVRTSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIVRE 962
            ++R +   +VQF YGGD +D +  E +     F     +A    +N       P  ++  
Sbjct: 1037 SIRDADGTLVQFMYGGDAVD-ITKESHMTQFEFCLDNYYALLKKYN-------PSALIEH 1088

Query: 963  TDNVLKPLEEKLIRYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAARLAQI 1022
             D       E  ++Y        K L    +Y  +H  E  + ++++         LA+ 
Sbjct: 1089 LD------VESALKYSK------KTL----KYRKKHSKEPHYKQAVKY-----DPVLAKY 1127

Query: 1023 RNTRGLLEMTQNGGDTSMEVVSSELQASVDQVYKITKK----NVNAFLTIALHKYHRAKV 1078
               + L  +++N  D        +L++ +D+  K+ K     N   F  +   KY R+ +
Sbjct: 1128 NPAKYLGSVSENFQD--------KLESFLDKNSKLFKSADGVNEKKFRALMQLKYMRSLI 1179

Query: 1079 EPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIIN 1137
             PG AVG I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP + 
Sbjct: 1180 NPGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASSAIKTPQMT 1239

Query: 1138 AVLVNEGDERAARVVKGRIEKTLLSDL 1164
              + ++  +  A      I K LLS++
Sbjct: 1240 LPIWDDVSDEQADTFCKSISKVLLSEV 1266

 Score = 88.2 bits (217), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 53/162 (32%), Positives = 88/162 (54%), Gaps = 2/162 (1%)

Query: 1266 VVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTIT-NHVLEVNSVLGIE 1324
            +++ +P I R V    ++GKR L+ EG   + +   +  I    IT N V  V    G+E
Sbjct: 1498 IIRQIPRIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLRTYGVE 1557

Query: 1325 AARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1384
            AAR ++V EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S +++ S+
Sbjct: 1558 AARNTVVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1616

Query: 1385 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVV 1426
            E T   L  A    +++ ++  S  I++G+  +VGTGSF V+
Sbjct: 1617 ETTCQFLTKAVLDNEREQLDSPSARIVVGRLNNVGTGSFDVL 1658

 Score = 41.2 bits (95), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 45/99 (45%), Gaps = 3/99 (3%)

Query: 12  KISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGVSSSSQECMTCH 71
           +I+ ++F  L A +I   S  +IT   + D        +GG  D  +G    +  C TC 
Sbjct: 10  EITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRNL-CSTCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDC 110
            +   C GH GHI+L +P ++  +F      L+  C  C
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFC 105

>KNAG0D04970 Chr4 (905179..910194) [5016 bp, 1671 aa] {ON} Anc_7.51
            YOR341W
          Length = 1671

 Score =  424 bits (1089), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 289/904 (31%), Positives = 455/904 (50%), Gaps = 100/904 (11%)

Query: 307  ISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGKQGRFRG 366
            I  + +M  +  +Q  V  +I+S            S GG V P+ G  Q L+ K+G FR 
Sbjct: 422  IIFSRLMNGFVTIQNDVNAFIDSTKAQ-------GSTGGNV-PVPGVKQALEKKEGLFRK 473

Query: 367  NLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLIINGPTV 426
            ++ GKRV+++ R+VISPDPN+  +E+ VP + A  LT+PE VT YN  +L+Q +INGP  
Sbjct: 474  HMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQAVINGPDK 533

Query: 427  HPGANYLLKKNEEARRNLRYGDKLKLAKNLQ---------------YGDVVERHLEDGDV 471
             PGA  L  +NE+       G  L+  K L                    V RH+++ D+
Sbjct: 534  WPGA--LQIQNEDGSLVSLIGMTLEQRKALANQLMTPSYVGGATHTLNKKVYRHIKNRDI 591

Query: 472  VLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAE 530
            V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARAE
Sbjct: 592  VIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAE 651

Query: 531  AINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMM------S 584
            A NL    +  LTP SG P+    QD I+    ++ KDSFF      Q +          
Sbjct: 652  AFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRPEDGH 711

Query: 585  DAKLQFDIPPPAIMKPYYLWTGKQVFS-LLIRPNKKSPVVINLDAKNKVYIPPKDKSFPN 643
              + +    PPA+ KP  LWTGKQ+ + +L+         INL + NK+    K++ +  
Sbjct: 712  ATRPKLVTVPPAVWKPVPLWTGKQIITTVLLNVTPADMPGINLKSNNKI----KNEYWGK 767

Query: 644  EMSINDGFVIIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCAR 703
                N+  V+ +  E+L G++DK+  G   K+ + +++   YGP  AA  ++ + +L   
Sbjct: 768  SSEENE--VLFKNGELLCGILDKNQYG-ASKYGIVHSLHEVYGPDIAAKVLSVLGRLFTN 824

Query: 704  YLGNRGFSIGISDVTPSSDLRDKKEEMVRFAYAKCDELIDMFKNGKLETQPG-------- 755
            Y+    F+ G+ D+  +++    ++++++ +     E      N + +T           
Sbjct: 825  YIMATAFTCGMDDLRLTAEGNKWRKDILKTSVDTGREAAAEVTNLEKDTTADDPELLKRL 884

Query: 756  ------CNEEQTLEAKIGGLLSKVREEVGDVCINELDNLNAPL----IMATCGSKGSTLN 805
                   N+   L+A     ++ +  +V   C+ +      P      MA  G+KGS +N
Sbjct: 885  QEVLRDNNKSGILDAVTSSKVNAITSKVVSTCVPDGTMKKFPYNSMQAMALSGAKGSNVN 944

Query: 806  VSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKTPQSKGFVRNSFFSGLTPPEFLFHA 865
            VSQ++ ++GQQ + G RVP     ++LP F+       + G+V+  F+SG+ P E+ FH 
Sbjct: 945  VSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGIKPQEYYFHC 1004

Query: 866  ISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDDTVRTSANGIVQFTYGGDGLDPLD 925
            ++GREGL+DTAVKT+ +GY+ R L K LE +   YD++VR     ++QF YGGD +D + 
Sbjct: 1005 MAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSVRDGDGTLIQFLYGGDAVD-VT 1063

Query: 926  MEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIVRETDNVLKPLEEKLIRYDNLGAVVP 985
             E +    +F      A    +N       P  ++   D       E  ++Y        
Sbjct: 1064 KESHMTKFDFCLENYDALLKKYN-------PSALIEHLD------VESALKYSK------ 1104

Query: 986  KELIDDERYADRHDAERAFYKSLRMYMQEKAARLAQIRNTRGLLEMTQNGGDTSMEVVSS 1045
            K L    +Y  +H A+ A YK    Y       LA+    + L  +++   D        
Sbjct: 1105 KSL----KYRKKH-AKEAHYKQSPKY----DPVLAKYNPAKYLGSVSEKFQD-------- 1147

Query: 1046 ELQASVDQVYKITKKNVN----AFLTIALHKYHRAKVEPGTAVGAIGAQSIGEPGTQMTL 1101
            +L+  +D+  K+ K N +     F  +   KY R+ + PG AVG I +QS+GEP TQMTL
Sbjct: 1148 KLETFIDKNSKLFKHNDDISEKKFRALMQLKYMRSLINPGEAVGIIASQSVGEPSTQMTL 1207

Query: 1102 KTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNEGDERAARVVKGRIEKTL 1160
             TFHFAG  + NVTLG+PR++EII  AS  I TP +   ++++  ++ A      I K L
Sbjct: 1208 NTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILDDVSDQQADTFSKSISKVL 1267

Query: 1161 LSDL 1164
            LS++
Sbjct: 1268 LSEV 1271

 Score = 86.3 bits (212), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 53/162 (32%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1266 VVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTIT-NHVLEVNSVLGIE 1324
            ++  +P I R V    ++GKR L+ EG   + +   +  I    IT N V  V  V G+E
Sbjct: 1501 IINQVPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQEDFIDVDGITSNDVSAVLKVYGVE 1560

Query: 1325 AARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1384
            AAR +IV EI      + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1561 AARNTIVNEISNVFGRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1619

Query: 1385 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVV 1426
            E T   L  A    +++ ++  S  I++G+  +VGTGSF ++
Sbjct: 1620 ETTCQFLTKAVLDHERENLDSPSARIVVGKLNNVGTGSFDIL 1661

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 52/117 (44%), Gaps = 3/117 (2%)

Query: 12  KISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGVSSSSQECMTCH 71
           +IS ++F   +A ++ A S  +IT   + D        +GG  D  +G    +  C +C 
Sbjct: 10  RISSVDFDVFSAKEVRALSVKQITNPTVLD--NLGHPISGGLYDLALGAFLRNM-CASCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDRRDFLKELR 128
            +   C GH GHI+L +P ++  +F      L+  C  C    L   +   F  +LR
Sbjct: 67  LDEKFCPGHLGHIELPVPCYNPLFFNQLYIYLRSSCLFCYRFRLKALEVHAFAMKLR 123

>KLTH0D01628g Chr4 complement(157597..162561) [4965 bp, 1654 aa] {ON}
            highly similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1654

 Score =  422 bits (1086), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 307/975 (31%), Positives = 488/975 (50%), Gaps = 121/975 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVTMQDSPASNEDDLTVKLTEIVWTSSLIK---------- 300
            R + +    +  PP   R PS   ++   + ++ L   L++I+ TS LI+          
Sbjct: 346  RADMFFLEVVIVPPTRFRLPSKLGEEIHENTQNQL---LSKILTTSLLIRDLNEEMSKLQ 402

Query: 301  ----AGLAKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQR 356
                +   K +  N +M  +  +Q  V  +I+S            + GGKV PI G  Q 
Sbjct: 403  KDKVSVEDKKVIFNRLMNAFVTIQNDVNAFIDSTKAQ-------GNTGGKV-PIPGVKQA 454

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKL 416
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP + A  LT+PE VT YN  +L
Sbjct: 455  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAEL 514

Query: 417  QQLIINGPTVHPGANYLLKKNEEARRNLRYG----DKLKLAKNL----------QYGDVV 462
            +Q +INGP   PGA  +  +NE+       G     +  LA  L               V
Sbjct: 515  RQAVINGPDKWPGATQI--QNEDGSLVSLVGMTTEQRKALANQLLTPSSHSATHSLNKKV 572

Query: 463  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHV 521
             RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 573  YRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHF 632

Query: 522  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLS 581
            PQ E ARAEA NL    +  LTP SG P+    QD I+    +++KDSFF      Q + 
Sbjct: 633  PQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREEYQQYIY 692

Query: 582  MM------SDAKLQFDIPPPAIMKPYYLWTGKQVFS-LLIRPNKKSPVVINLDAKNKVYI 634
                       + +    PPA+ KP  LWTGKQ+ + +L+         INL +KNK+  
Sbjct: 693  GCIRPEDGHATRNKLLTVPPAVFKPVPLWTGKQIITTVLLNVTPADMPGINLLSKNKI-- 750

Query: 635  PPKDKSFPNEMSINDGFVIIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTM 694
              K++ +    + ND  V+ +  E+L G++DKS  G   K+ + +++   YGP  +A  +
Sbjct: 751  --KNEYWGKGSTEND--VVFKNGELLCGILDKSQYG-ASKYGIVHSLHEVYGPDVSAKVL 805

Query: 695  NRMAKLCARYLGNRGFSIGISDVTPS-------SDLRDKKEEMVRFAYAKCDELIDMFKN 747
            + + +L   Y+    F+ G+ D+  +       SD+     ++ R A A+   L      
Sbjct: 806  SVLGRLFTNYITATAFTCGMDDLRLTEEGNKWRSDILKTSTDVGRVAAAEVTNLDKDVSA 865

Query: 748  GKLETQPGCNE-----------EQTLEAKIGGLLSKVREE-VGDVCINELDNLNAPLIMA 795
               E      E           +    +K+  + S+V  + V D  + +  N N+   MA
Sbjct: 866  NDSELLKRLEEILRDDNKLGILDAVTSSKVNSITSQVVSKCVPDGTMKKFPN-NSMQAMA 924

Query: 796  TCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKTPQSKGFVRNSFFSG 855
              G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F+       + G+++  F+SG
Sbjct: 925  LSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDAMAGGYIKGRFYSG 984

Query: 856  LTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDDTVRTSANGIVQFT 915
            + P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YD++VR +   ++QF 
Sbjct: 985  IKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDADGTLIQFL 1044

Query: 916  YGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIVRETD--NVLKPLEEK 973
            YGGD +D +  E +     F      A    +N       P  ++   D  + LK   +K
Sbjct: 1045 YGGDAVD-VTQESHMTQFKFCADNYDALLKKYN-------PAALIEHLDVESALK-YSKK 1095

Query: 974  LIRYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAARLAQIRNTRGLLEMTQ 1033
             +++      VP            H +++  Y  +          +++   ++ L  +++
Sbjct: 1096 ALKHRKKTEKVP------------HYSQKVKYDPV----------VSKFNPSKYLGSVSE 1133

Query: 1034 NGGDTSMEVVSS--ELQASVDQVYKITKKNVNAFLTIALHKYHRAKVEPGTAVGAIGAQS 1091
            N  D     + S  +L  S D V   ++K   A + +   KY R+ + PG AVG I +QS
Sbjct: 1134 NFQDKLESFIDSNNDLFKSRDTV---SEKKFRALMQL---KYMRSLINPGEAVGIIASQS 1187

Query: 1092 IGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIIN-AVLVNEGDERAA 1149
            +GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   +L +  D +A 
Sbjct: 1188 VGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILADVTDPQAD 1247

Query: 1150 RVVKGRIEKTLLSDL 1164
               K  + K +LS++
Sbjct: 1248 TFCKS-VTKVMLSEV 1261

 Score = 89.4 bits (220), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 56/162 (34%), Positives = 89/162 (54%), Gaps = 2/162 (1%)

Query: 1266 VVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTIT-NHVLEVNSVLGIE 1324
            V++ + +I R V    ++GKR L+ EG   +E+   D  I    IT N V  V    G+E
Sbjct: 1487 VIREVKNIDRCVHPEPENGKRILVTEGVNFQEMWDQDAFIDVNGITSNDVASVLKTYGVE 1546

Query: 1325 AARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1384
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1547 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1605

Query: 1385 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVV 1426
            E T   L  A    + + ++  S  I+LG+  +VGTG+F V+
Sbjct: 1606 ETTCQFLTKAVLDNECENLDSPSARIVLGKLNNVGTGAFDVL 1647

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 59/134 (44%), Gaps = 6/134 (4%)

Query: 12  KISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGVSSSSQECMTCH 71
           +I+ ++F  + A DI   S ++IT   + D        +GG  D  +G    +  C TC 
Sbjct: 10  EITSVDFGVMTAQDIRNFSAMQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CATCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDRRDF---LKELR 128
            +   C GH GHI+L +P ++  +F      L+  C  C    L   +   +   LK L+
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFSQLYIFLRSSCLYCHGFRLKASEVHRYACKLKLLQ 126

Query: 129 RPGIDNLRKMSILK 142
              ID   K+  L+
Sbjct: 127 YGLIDECYKLDELR 140

>Kpol_1040.3 s1040 complement(6642..11612) [4971 bp, 1656 aa] {ON}
            complement(6642..11612) [4971 nt, 1657 aa]
          Length = 1656

 Score =  420 bits (1079), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 302/986 (30%), Positives = 481/986 (48%), Gaps = 143/986 (14%)

Query: 252  RPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIK------AGLAK 305
            + +T+    +  PP   R    + D    N  +    L++I+ TS LI+      + L K
Sbjct: 346  KADTFFMEVVLVPPTRFRLPSKLGDEVHENTQNQL--LSKILTTSLLIRDLNDEMSKLQK 403

Query: 306  G--------ISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRL 357
                     +  + +M  +  +Q  V  +I+S            + GGKV PI G  Q L
Sbjct: 404  DKVSLQDRRVIFSRLMNAFVTIQNDVNAFIDSTK-------AQGNTGGKV-PIPGVKQAL 455

Query: 358  KGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQ 417
            + K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP + A  LT+PE VT YN  +L+
Sbjct: 456  EKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELR 515

Query: 418  QLIINGPTVHPGANYLLKKNEEARRNLRYGDKLKLAKNL--------------QYGDVVE 463
            Q +INGP   PGA+ +  +NE+       G  L+  K L                   V 
Sbjct: 516  QAVINGPDKWPGASQI--QNEDGSLVSLIGMTLEQRKALANQLMTPSSNIATHTLNKKVY 573

Query: 464  RHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVP 522
            RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H P
Sbjct: 574  RHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFP 633

Query: 523  QTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLL-- 580
            Q E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSFF      Q +  
Sbjct: 634  QNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYG 693

Query: 581  ----SMMSDAKLQFDIPPPAIMKPYYLWTGKQVFS-LLIRPNKKSPVVINLDAKNKVYIP 635
                      + +    PPA+ KP  LWTGKQ+ + +L+         INL++ NK+   
Sbjct: 694  CIRPEHGHTTRSKIVTVPPAVFKPVPLWTGKQIITTVLLNVTPSDMPGINLNSSNKI--- 750

Query: 636  PKDKSFPNEMSINDGFVIIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTMN 695
             K++ + N  + ND  VI +  E+L G++DKS  G   K+ + +++   YGP  AA  ++
Sbjct: 751  -KNEYWGNGSTEND--VIFKNGELLCGILDKSQYG-ASKYGIVHSLHEVYGPDVAAKVLS 806

Query: 696  RMAKLCARYLGNRGFSIGISDVTPSSDLRDKKEEMVRFAYAKCDELIDMFKNGKLETQPG 755
             + +L   Y+    F+ G+ D+  + +    ++++++ +     +      N + ET   
Sbjct: 807  VLGRLFTNYITATAFTCGMDDLRLTDEGNKWRKDILKTSVDTGRQAACEVTNLEKETASD 866

Query: 756  CNE-----EQTL-------------EAKIGGLLSKVREE-VGDVCINELDNLNAPLIMAT 796
             +E     E+ L              +K+  + SKV  + V D  + +    N+   MA 
Sbjct: 867  DSELLKRLEEILRDDNKSGILDAVTSSKVNSITSKVVSKCVPDGTMKKFP-YNSMQAMAL 925

Query: 797  CGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKTPQSKGFVRNSFFSGL 856
             G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F+       + G+++  F+SG+
Sbjct: 926  SGAKGSNVNVSQIMCLLGQQALEGRRVPTMVSGKTLPSFKPFETDAMAGGYIKGRFYSGI 985

Query: 857  TPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDDTVRTSANGIVQFTY 916
             P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YD++VR     ++QF Y
Sbjct: 986  KPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDGDGTLIQFLY 1045

Query: 917  GGDGLDPLDMEGNAKPVNF--------IRSWDHACNITFNKNETGL--LPYEIVRETDNV 966
            GGD +D +  E +     F        ++ ++ +  I     ET L            N 
Sbjct: 1046 GGDSVD-VTKESHLTQFEFCLENYDSLLKKYNPSALIEHLDVETALKYSKKASKSRKKNR 1104

Query: 967  LKPLEEKLIRYD-NLGAVVPKELID--DERYADR----HDAERAFYKSLRMYMQEKAARL 1019
              P  E+ I+YD  L    P + +    E++ D+     D+  + ++S +   ++K   L
Sbjct: 1105 KVPHYEQNIKYDPALAKFNPAKYLGAVSEKFQDKLELFLDSNASLFESDKSVNEKKFRAL 1164

Query: 1020 AQIRNTRGLLEMTQNGGDTSMEVVSSELQASVDQVYKITKKNVNAFLTIALHKYHRAKVE 1079
             Q++  R L+                                                  
Sbjct: 1165 MQLKYMRSLI-------------------------------------------------N 1175

Query: 1080 PGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINA 1138
            PG +VG I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +  
Sbjct: 1176 PGESVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTL 1235

Query: 1139 VLVNEGDERAARVVKGRIEKTLLSDL 1164
             ++++  +  A V    I K LLS++
Sbjct: 1236 PILDDVSDDQADVFSKSISKVLLSEV 1261

 Score = 90.5 bits (223), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 56/163 (34%), Positives = 89/163 (54%), Gaps = 2/163 (1%)

Query: 1265 VVVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTIT-NHVLEVNSVLGI 1323
             V++ +P I R V    ++GKR L+ EG   + +   +  IG   IT N V  V    G+
Sbjct: 1488 TVIRQVPFIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIGVDGITSNDVSAVLKTYGV 1547

Query: 1324 EAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLAS 1383
            EAAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S
Sbjct: 1548 EAARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-S 1606

Query: 1384 FEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVV 1426
            +E T   L  A    + + ++  S  I+LG+  +VGTG+F V+
Sbjct: 1607 YETTCQFLTKAVLDNENEELKSPSARIVLGKLNNVGTGAFDVL 1649

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 46/99 (46%), Gaps = 3/99 (3%)

Query: 12  KISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGVSSSSQECMTCH 71
           +I+ I+FS L A +I   S  +IT   + D        +GG  D  +G    +  C TC 
Sbjct: 10  EITSIDFSILTAQEIRNLSAKQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CSTCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDC 110
            +   C GH GHI+L +P ++  +F      L+  C  C
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLFC 105

>KAFR0K00540 Chr11 complement(114196..119184) [4989 bp, 1662 aa] {ON}
            Anc_7.51 YOR341W
          Length = 1662

 Score =  419 bits (1078), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 283/865 (32%), Positives = 443/865 (51%), Gaps = 91/865 (10%)

Query: 345  GKVKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTF 404
            GKV P+ G  Q L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP + A  LT+
Sbjct: 448  GKV-PVPGVKQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTY 506

Query: 405  PEKVTRYNKRKLQQLIINGPTVHPGANY----------LLKKNEEARRNLRYGDKLKLAK 454
            PE VT +N  +L+Q +INGP   PGA            L+  + E R+ L        + 
Sbjct: 507  PEPVTSFNIAELRQAVINGPDKWPGATQIQNEDGSLVSLIGMSAEQRKALANQLMTPTSH 566

Query: 455  N---LQYGDVVERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNA 510
            N         V RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNA
Sbjct: 567  NGATHTLNKKVYRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNA 626

Query: 511  DFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSF 570
            DFDGDEMN+H PQ E ARAEA NL    +  LTP SG P+    QD I+    +++KDSF
Sbjct: 627  DFDGDEMNMHFPQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSF 686

Query: 571  FDLGSLTQLL--------SMMSDAKLQFDIPPPAIMKPYYLWTGKQVFSLLIRPNKKSPV 622
            F      Q +           + AKL     PPA+MKP  LWTGKQ+ + ++  N   P 
Sbjct: 687  FTREQYQQYIYGCIRPEDGHATRAKLA--TVPPAVMKPVPLWTGKQIITTVLL-NITPPD 743

Query: 623  V--INLDAKNKVYIPPKDKSFPNEMSINDGFVIIRGSEILSGVMDKSVLGDGKKHSVFYT 680
            +  INL + NK+        +  + S N+  VI +  E+L G++DKS  G   K+ + + 
Sbjct: 744  MPGINLKSSNKI-----KNDYWGKGS-NENEVIFKNGELLCGILDKSQYG-ASKYGIIHC 796

Query: 681  ILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPSSDLRDKKEEMVRFAYAKCDE 740
            +   YGP  +A  ++ + +L   Y+    F+ G+ D+  + +    ++E+++ +     E
Sbjct: 797  LHEVYGPDVSAKALSVLGRLFTNYITATAFTCGMDDLRLTEEGNKWRKEILKTSVDTGRE 856

Query: 741  LIDMFKNGKLETQPG--------------CNEEQTLEAKIGGLLSKVREEVGDVCI--NE 784
                  N   +T                  N+   L+A     ++ +  +V   C+    
Sbjct: 857  AAAEVTNLPKDTPSNDPELLKRLEEIIRDNNKSGILDAVTSSKVNTITSKVVSTCVPGGT 916

Query: 785  LDNL--NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKTP 842
            +     N+   MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F+      
Sbjct: 917  MKKFPENSMQSMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDA 976

Query: 843  QSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDD 902
            ++ G+++  F+SG+ P E+ FH ++GREGL+DTAVKTA +GY+ R L K LE +   YD+
Sbjct: 977  RAGGYIKGRFYSGIRPQEYYFHCMAGREGLIDTAVKTASSGYLQRCLTKQLEGVHVSYDN 1036

Query: 903  TVRTSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIVRE 962
            ++R +   ++Q  YGGD +D +  E +    NF      A    +N       P  ++  
Sbjct: 1037 SIRDADGTLIQMLYGGDAID-VTKESHLTKFNFCLENYDALLKKYN-------PSALIEH 1088

Query: 963  TDNVLKPLEEKLIRYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAARLAQI 1022
             D       E  ++Y        K L    +Y  +H A+ A Y+    Y       L++ 
Sbjct: 1089 LD------VETALKYSK------KSL----KYRKKH-AKEAHYQQTVKY----DPILSKY 1127

Query: 1023 RNTRGLLEMTQNGGDTSMEVV--SSELQASVDQVYKITKKNVNAFLTIALHKYHRAKVEP 1080
               + L  +++N  D     +  +S+L  S + V      N   F  +   KY R+ + P
Sbjct: 1128 NPAKYLGSVSENFQDQLENFLHDNSKLLKSHEDV------NEKKFRALMQLKYMRSLINP 1181

Query: 1081 GTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAV 1139
            G AVG I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   
Sbjct: 1182 GEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIIMTASAAIKTPQMTLP 1241

Query: 1140 LVNEGDERAARVVKGRIEKTLLSDL 1164
            ++++  +  A      I K +LS++
Sbjct: 1242 ILDDVTDEQADTFAKSISKVVLSEV 1266

 Score = 87.8 bits (216), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 55/162 (33%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1266 VVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTI-TNHVLEVNSVLGIE 1324
            V++ +P I R V    ++GKR L+ EG     +   +  I    I +N V  V    G+E
Sbjct: 1495 VIRQVPKIDRCVHPEPENGKRVLVTEGVNFNAMWDQEDFIDVDGIRSNDVSAVLKTYGVE 1554

Query: 1325 AARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1384
            AAR ++V EI+   S + +SV  RH+ LL D+MT +G  L   R G+     S++++ S+
Sbjct: 1555 AARNTVVNEINNVFSRYAISVSFRHLDLLADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1613

Query: 1385 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVV 1426
            E T   L  A    +++ +   S  I+LG+  +VGTGSF V+
Sbjct: 1614 ETTCQFLTKAVLDNEREELNTPSARIVLGKLNNVGTGSFDVL 1655

 Score = 47.0 bits (110), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 53/117 (45%), Gaps = 3/117 (2%)

Query: 12  KISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGVSSSSQECMTCH 71
           +I+ ++FS L + DI + S  +I    + D        +GG  D  +G    +  C TC 
Sbjct: 10  EITSVDFSILTSKDIRSLSAKQIINPTVLD--NLGHPISGGLYDLSLGAFLRNL-CTTCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDRRDFLKELR 128
            +   C GH GHI+L +PV++  +F      L+  C  C    L   +   F  +L+
Sbjct: 67  LDEKFCPGHVGHIELPVPVYNPLFFNQLYIYLRSSCLFCHHFRLKSAEVHRFALKLK 123

>NDAI0H01200 Chr8 complement(280165..285174) [5010 bp, 1669 aa] {ON}
            Anc_7.51
          Length = 1669

 Score =  417 bits (1071), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 286/868 (32%), Positives = 446/868 (51%), Gaps = 96/868 (11%)

Query: 344  GGKVKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLT 403
            GGKV PI G  Q L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP + A  LT
Sbjct: 451  GGKV-PIPGVKQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLT 509

Query: 404  FPEKVTRYNKRKLQQLIINGPTVHPGANYLLKKNEEARR----NLRYGDKLKLAKNLQ-- 457
            +PE VT YN  +L+Q +INGP   PGA  +  +NE+        +    +  LA  L   
Sbjct: 510  YPEPVTSYNIAELRQAVINGPDKWPGAAQI--QNEDGSLVSLVGMSAEQRKALANQLMTP 567

Query: 458  --------YGDVVERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPY 508
                        V RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      Y
Sbjct: 568  SSNVGTHTLNKKVYRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAY 627

Query: 509  NADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKD 568
            NADFDGDEMN+H PQ E ARAEA NL    +  LTP SG P+    QD I+    ++ KD
Sbjct: 628  NADFDGDEMNMHFPQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKD 687

Query: 569  SFFDLGSLTQLLSMM------SDAKLQFDIPPPAIMKPYYLWTGKQVFS-LLIRPNKKSP 621
            SFF      Q +            + +    PP I KP  LWTGKQ+ S +L+       
Sbjct: 688  SFFTREQYQQYIYGCIRPEDGHATRPKLITLPPTIYKPVPLWTGKQIISTVLLNVTPADM 747

Query: 622  VVINLDAKNKVYIPPKDKSFPNEMSINDGFVIIRGSEILSGVMDKSVLGDGKKHSVFYTI 681
              INL + NK+    K++ +    S N+  V+ +  E+L G++DKS  G   K  + +++
Sbjct: 748  PGINLTSSNKI----KNEYWGK--SSNENEVLFKNGELLCGILDKSQYG-ASKFGIVHSL 800

Query: 682  LRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPS-------SDLRDKKEEMVRFA 734
               YGP  AA  ++ + +L   Y+ +  F+ G+ D+  S       SD+     +  R A
Sbjct: 801  HEVYGPSIAAKVLSVLGRLFTNYIMSTAFTCGMDDLRLSEEGNKWRSDILKTSVDTGREA 860

Query: 735  YAKCDEL--------IDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELD 786
             A+   L         ++ K  + E     N+   L+A     ++ +  +V   C+ +  
Sbjct: 861  AAEVTNLDKDTAADDAELLKRLE-EILRDNNKSGILDAVTSSKVNSITSKVVSKCVPDGT 919

Query: 787  NLNAPL----IMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKTP 842
                P      MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F+      
Sbjct: 920  MKKFPYNSMQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDA 979

Query: 843  QSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDD 902
             + G+++  F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YD+
Sbjct: 980  MAGGYIKGRFYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDN 1039

Query: 903  TVRTSANGIVQFTYGGDGLDPLDMEGNAKPVNF-IRSWDHACNITFNKNETGLLPYEIVR 961
            +VR     ++QF YGGD +D +  E +    +F + ++D   N     N + L+ +  V 
Sbjct: 1040 SVRDGDGTLIQFLYGGDAVD-VTKESHMTEFDFCLDNYDALLN---KYNPSALIEHLDV- 1094

Query: 962  ETDNVLKPLEEKLIRYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAARLAQ 1021
                      E  ++Y        K L + +++     A+ A +K+   Y       L++
Sbjct: 1095 ----------ETALKYSK------KTLKNRKKH-----AKEAHHKNATKY----DPVLSK 1129

Query: 1022 IRNTRGLLEMTQNGGDTSMEVVSSELQASVDQVYKITKKNVNA----FLTIALHKYHRAK 1077
                + L  +++   D        +L++ +D+  K+ K + N     F  +   KY R+ 
Sbjct: 1130 FNPAKYLGSVSEKFQD--------KLESYLDKNSKLFKSHDNVSEKKFRALMQLKYMRSL 1181

Query: 1078 VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPII 1136
            + PG AVG I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +
Sbjct: 1182 INPGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQM 1241

Query: 1137 NAVLVNEGDERAARVVKGRIEKTLLSDL 1164
               +  +  +  A      I K +LS++
Sbjct: 1242 TLPIWQDVSDEQADTFCKSISKVVLSEV 1269

 Score = 90.9 bits (224), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 88/162 (54%), Gaps = 2/162 (1%)

Query: 1266 VVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTIT-NHVLEVNSVLGIE 1324
            +++ +P I R V    ++GKR L+ EG     +   +  I    IT N V  V    G+E
Sbjct: 1502 IIREVPHIDRCVHPEPENGKRVLVTEGVNFEAMWDQEAFIDVDGITSNDVASVLKTYGVE 1561

Query: 1325 AARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1384
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1562 AARNTIVNEINNVFSRYAISVSYRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1620

Query: 1385 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVV 1426
            E T   L  A    +++ +E  S  I++G+  +VGTGSF ++
Sbjct: 1621 ETTLQFLTKAVLDNEREELESPSARIVMGKLNNVGTGSFDIL 1662

 Score = 40.8 bits (94), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 52/117 (44%), Gaps = 3/117 (2%)

Query: 12  KISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGVSSSSQECMTCH 71
           +I+ ++F  L + +I   S  +IT   + D        +GG  D  +G    +  C +C 
Sbjct: 10  EITSVDFGILTSEEIRQLSAKQITNPTVLD--NLGHPISGGLYDLSLGAFLRNL-CSSCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDRRDFLKELR 128
            +   C GH GHI+L +P ++  +F      L+  C  C  + L   +   F  +LR
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRTSCLFCHHLKLKQIEVHRFACKLR 123

>TBLA0E01930 Chr5 (468692..473671) [4980 bp, 1659 aa] {ON} Anc_7.51
            YOR341W
          Length = 1659

 Score =  416 bits (1069), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 300/973 (30%), Positives = 479/973 (49%), Gaps = 117/973 (12%)

Query: 252  RPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIK------AGLAK 305
            +P+ +    +  PP   R    + D    N  +    L++I+ TS LI+      + L K
Sbjct: 353  KPDAFFMDVIVVPPTRFRLPSKLGDEVHENTQNQL--LSKILTTSLLIRDLNDEMSKLQK 410

Query: 306  G--------ISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRL 357
                     +  + +M  +  +Q  V  +I+S           ++GG  V P  G  Q L
Sbjct: 411  DKVSLEDRRVIFSRLMNAFVTIQNDVNSFIDSSKAQ------GNTGGNDVIP--GVKQAL 462

Query: 358  KGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQ 417
            + K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP + A  LT+PE VT YN  +L+
Sbjct: 463  EKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTSYNIAELR 522

Query: 418  QLIINGPTVHPGANYLLKKNEEARRNLRYGDKLKLAKNLQ--------------YGDVVE 463
            Q +INGP   PGA  +  +NE+       G  L+  K L                   V 
Sbjct: 523  QAVINGPDKWPGA--IQIQNEDGTLVSLIGMTLEQRKALANQLMTPSSNSSSHVLNKKVY 580

Query: 464  RHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVP 522
            RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H P
Sbjct: 581  RHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFP 640

Query: 523  QTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLL-- 580
            Q E ARAE++ L    +  LTP SG P+    QD I+    +++KDSFF      Q +  
Sbjct: 641  QNENARAESLFLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIYG 700

Query: 581  ------SMMSDAKLQFDIPPPAIMKPYYLWTGKQVFS-LLIRPNKKSPVVINLDAKNKVY 633
                     + AK+     PP I KP  LWTGKQ+ + +L+         INL +KNK+ 
Sbjct: 701  CIRPEDGHATRAKIV--TLPPTIFKPIPLWTGKQIITTVLLNITPSDMPGINLHSKNKI- 757

Query: 634  IPPKDKSFPNEMSINDGFVIIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANT 693
               K++ +      N+  VI +   +L G++DK+  G   K+ + +++   YGP  AA  
Sbjct: 758  ---KNEYWGK--GSNENEVIFKDGALLCGILDKNQYG-SSKYGIVHSLHELYGPDVAAKV 811

Query: 694  MNRMAKLCARYLGNRGFSIGISDVTPSSD----LRDKKEEMVRFAYAKCDELIDMFKNGK 749
            ++ + +L   Y+    F+ G+ D+  + +     RD  +  V        E+ ++ K+  
Sbjct: 812  LSVLGRLFTNYITATAFTCGMDDLRLTDEGNKWRRDILKTSVDTGRQAAAEVTNLSKDTP 871

Query: 750  L----------ETQPGCNEEQTLEAKIGGLLSKVREEVGDVCI--NELDNL--NAPLIMA 795
                       E     N+   L+A     ++ +  +V   C+    +     N+   MA
Sbjct: 872  ADDPELLKRLEEILRDDNKSGILDAVTSSKVNAITSKVVSTCVPGGTMKKFPYNSMQAMA 931

Query: 796  TCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKTPQSKGFVRNSFFSG 855
              G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F+       + G+++  F+SG
Sbjct: 932  LSGAKGSNVNVSQIMCLLGQQALEGRRVPTMVSGKTLPSFKPYETDAMAGGYIKGRFYSG 991

Query: 856  LTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDDTVRTSANGIVQFT 915
            + P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YD+TVR     +++F 
Sbjct: 992  IKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNTVRDGDGTLIEFL 1051

Query: 916  YGGDGLDPLDMEGNAKPVNFIRSWDHACNITFN-KNETGLLPYEIVRETDNVLKPLEEKL 974
            YGGD +D             +    +     F  +N  GL           V K     L
Sbjct: 1052 YGGDAVD-------------VTKESYMTQFKFCLENYDGL-----------VKKYNPSAL 1087

Query: 975  IRYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAAR--LAQIRNTRGLLEMT 1032
            I + N+ + +        +Y+ +    R  + S+  Y+Q       LA+   ++ L  ++
Sbjct: 1088 IEHLNVESAL--------KYSKKALKYRKKHSSVPHYLQNSKYDPVLAKYNPSKYLGSVS 1139

Query: 1033 QNGGDTSMEVVSSELQASVDQVYKITKKNVNAFLTIALHKYHRAKVEPGTAVGAIGAQSI 1092
            +   D  +E   +E    V     + +K   A + +   KY R+ ++PG +VG I +QS+
Sbjct: 1140 EKFQD-KLEEFLNENSKLVKSTEGVNEKKFRALMQL---KYMRSLIDPGESVGIIASQSV 1195

Query: 1093 GEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNEGDERAARV 1151
            GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +N  ++N+   + A  
Sbjct: 1196 GEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASSSIKTPQMNLPILNDVSNQQAET 1255

Query: 1152 VKGRIEKTLLSDL 1164
                I K LLS +
Sbjct: 1256 FCKSITKVLLSQV 1268

 Score = 94.4 bits (233), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 56/162 (34%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1266 VVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTIT-NHVLEVNSVLGIE 1324
            V++ +P+I R V    ++G R L+ EG   + +   D  I    IT N V  V    G+E
Sbjct: 1492 VIREVPNIERCVYPEANNGDRSLITEGVNFQAMWDQDTFIDVDKITSNDVSAVLRTYGVE 1551

Query: 1325 AARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1384
            AAR +IV EID   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1552 AARNTIVNEIDRVFSTYAISVSSRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1610

Query: 1385 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVV 1426
            E T   L  A    + + +   S  I+LG+  +VGTGSF ++
Sbjct: 1611 ETTCQFLTKAVLDNEHEELNSPSARIVLGKLNNVGTGSFDIL 1652

 Score = 40.8 bits (94), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 47/108 (43%), Gaps = 3/108 (2%)

Query: 12  KISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGVSSSSQECMTCH 71
           +I+ ++F  L++  I   S  +IT   + D        +GG  D  +G    +  C TC 
Sbjct: 10  EITSVDFEILSSDQIRNLSAKQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CSTCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKD 119
            +   C GH GHI+L +P ++  +F      L+  C  C    L   D
Sbjct: 67  QDEKFCPGHQGHIELPVPCYNPLFFNQLFIYLRSSCLYCHHFRLKSLD 114

>NCAS0F00730 Chr6 complement(143500..148524) [5025 bp, 1674 aa] {ON}
            Anc_7.51 YOR341W
          Length = 1674

 Score =  415 bits (1066), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 286/906 (31%), Positives = 463/906 (51%), Gaps = 105/906 (11%)

Query: 307  ISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGKQGRFRG 366
            I  + +M  +  +Q  V  +I+S            + GGK+ PI G  Q L+ K+G FR 
Sbjct: 426  IIFSRLMNAFVTIQNDVNAFIDSTK-------AQGTAGGKL-PIPGVKQALEKKEGLFRK 477

Query: 367  NLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLIINGPTV 426
            ++ GKRV+++ R+VISPDPN+  +E+ VP + A  LT+PE VT YN  +L+Q +INGP  
Sbjct: 478  HMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQAVINGPDK 537

Query: 427  HPGANY----------LLKKNEEARRNLRYGDKLKLAKNLQYGDV---VERHLEDGDVVL 473
             PGA            L+  + E R+ L     +  + N+    +   V RH+++ D+V+
Sbjct: 538  WPGATQIQNEDGSLVSLIGMSTEQRKALA-NQLMTPSSNITTHTLNKKVYRHIKNRDIVI 596

Query: 474  FNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAI 532
             NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARAEA 
Sbjct: 597  MNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEAS 656

Query: 533  NLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMM------SDA 586
            NL    +  LTP SG P+    QD I+    ++ KDSFF      Q +            
Sbjct: 657  NLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRPEDGHAT 716

Query: 587  KLQFDIPPPAIMKPYYLWTGKQVFS-LLIRPNKKSPVVINLDAKNKVYIPPKDKSFPNEM 645
            + +    PP I KP  LWTGKQ+ S +L+     +   INL + NK+    K++ +    
Sbjct: 717  RSKLITMPPTIHKPVPLWTGKQIISTVLLNITPANMPGINLKSSNKI----KNEYWGTGS 772

Query: 646  SINDGFVIIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYL 705
              N+  V+ +  E+L G++DKS  G   K  + +++   YGP  AA  ++ + +L   Y+
Sbjct: 773  QENE--VLFKNGELLCGILDKSQYG-ASKFGIVHSLHEVYGPSVAAKVLSVLGRLFTNYI 829

Query: 706  GNRGFSIGISDVTPSSDLRDKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLE-- 763
             +  F+ G+ D+  + +    + ++++ +     E      N  L+     N+ + L+  
Sbjct: 830  MSTAFTCGMDDLRLTEEGNKWRSDILKTSVDTGREAAAEVTN--LDKDTPANDPELLKRL 887

Query: 764  ------------------AKIGGLLSKVREE-VGDVCINELDNLNAPLIMATCGSKGSTL 804
                              +K+  + SKV  + V D  + +    N+   MA  G+KGS +
Sbjct: 888  QEILRDNNKSGILDAVTSSKVNSITSKVVSKCVPDGTMKKFP-YNSMQAMALSGAKGSNV 946

Query: 805  NVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKTPQSKGFVRNSFFSGLTPPEFLFH 864
            NVSQ++ ++GQQ + G RVP     ++LP F+       + G+V+  F+SG+ P E+ FH
Sbjct: 947  NVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGIKPQEYYFH 1006

Query: 865  AISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDDTVRTSANGIVQFTYGGDGLDPL 924
             ++GREGL+DTAVKT+ +GY+ R L K LE +   YD++VR +   ++QF YGGD +D +
Sbjct: 1007 CMAGREGLIDTAVKTSRSGYLQRCLTKQLEGIHISYDNSVRDTDGTLIQFLYGGDAVD-V 1065

Query: 925  DMEGNAKPVNF-IRSWDHACNITFNKNETGLLPYEIVRETDNVLKPLEEKLIRYDNLGAV 983
              E +    +F + ++D   N     N + L+ +  V           E  ++Y      
Sbjct: 1066 TKESHMTEFDFCLDNYDALLN---KYNPSALIEHLDV-----------ESALKYS----- 1106

Query: 984  VPKELIDDERYADRHDAERAFYKSLRMYMQEKAARLAQIRNTRGLLEMTQNGGDTSMEVV 1043
              K+ + + +   +H  E  + ++++         L++    + L  +++   D      
Sbjct: 1107 --KKSLKNRK---KHIKEPHYKQNIKY-----DPVLSKFNPAKYLGSVSEKFQD------ 1150

Query: 1044 SSELQASVDQVYKITKK----NVNAFLTIALHKYHRAKVEPGTAVGAIGAQSIGEPGTQM 1099
              +L+  +D+  K+ K     N   F  +   KY R+ + PG AVG I +QS+GEP TQM
Sbjct: 1151 --KLEGYLDKNSKLFKSHDSVNEKKFRALMQLKYMRSLINPGEAVGIIASQSVGEPSTQM 1208

Query: 1100 TLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNEGDERAARVVKGRIEK 1158
            TL TFHFAG  + NVTLG+PR++EII  AS  I TP +   + N+  +  A      I K
Sbjct: 1209 TLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPIWNDVSDEQADTFCKSISK 1268

Query: 1159 TLLSDL 1164
             +LS++
Sbjct: 1269 VVLSEV 1274

 Score = 90.1 bits (222), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 53/162 (32%), Positives = 88/162 (54%), Gaps = 2/162 (1%)

Query: 1266 VVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTIT-NHVLEVNSVLGIE 1324
            +++ +P I R +    ++GKR L+ EG     +   +  I    IT N V  V    G+E
Sbjct: 1505 IIREVPHIDRCIHPEPENGKRVLVTEGVNFEAMWDQEAFIDVDGITSNDVASVLKTYGVE 1564

Query: 1325 AARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1384
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1565 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1623

Query: 1385 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVV 1426
            E T   L  A    +++ +E  S  I++G+  +VGTGSF ++
Sbjct: 1624 ETTLQFLTKAVLDNEREELESPSARIVMGKLNNVGTGSFDIL 1665

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 51/117 (43%), Gaps = 3/117 (2%)

Query: 12  KISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGVSSSSQECMTCH 71
           +I+ ++F  L + +I   S  +IT   + D        TGG  D  +G    +  C TC 
Sbjct: 10  EITSVDFGILTSDEIRQLSAKQITNPTVLD--NLGHPITGGLYDLSLGAFLRNL-CSTCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDRRDFLKELR 128
            +   C GH GHI+L +P ++  +F      L+  C  C    L   +   F  +LR
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRTSCLFCHHFRLRSIEVHRFASKLR 123

>ADR374C Chr4 complement(1372609..1377531) [4923 bp, 1640 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOR341W
            (RPA190)
          Length = 1640

 Score =  406 bits (1044), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 304/970 (31%), Positives = 481/970 (49%), Gaps = 111/970 (11%)

Query: 252  RPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIK------AGLAK 305
            + + +    +  PP   R    + D    N  +    L++I+ TS LI+      + L K
Sbjct: 331  KADMFFMEVIVVPPTRFRLPSKLGDEVHENTQNQL--LSKILTTSLLIRDLNEEMSKLQK 388

Query: 306  G--------ISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRL 357
                     I  N +M  +  +Q  V  +I+S            S GGKV PI G  Q L
Sbjct: 389  DKVSLEDRKIIFNRLMNAFVTIQNDVNAFIDSTKAQ-------GSTGGKV-PIPGVKQAL 440

Query: 358  KGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQ 417
            + K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP + A  LT+PE VT YN  +++
Sbjct: 441  EKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNIAEMR 500

Query: 418  QLIINGPTVHPGANYLLKKNEEARR----NLRYGDKLKLAKNLQ----YGDV------VE 463
            Q +INGP   PGA  +  +NE+        +    +  LA  L     +G        V 
Sbjct: 501  QAVINGPDKWPGATQI--QNEDGSLVSLVGMTSDQRKALANQLMTPSTHGSTHTLNKKVY 558

Query: 464  RHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVP 522
            RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H P
Sbjct: 559  RHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFP 618

Query: 523  QTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLSM 582
            Q E AR+EA  L    +  LTP SG P+    QD I+    +++KDSFF      Q +  
Sbjct: 619  QNENARSEAFTLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIYG 678

Query: 583  M------SDAKLQFDIPPPAIMKPYYLWTGKQVFS-LLIRPNKKSPVVINLDAKNKVYIP 635
                     ++ +    PPA++KP  LWTGKQ+ + +L+         INL +KNK+   
Sbjct: 679  CIRPEDGHASRSKIITVPPAVVKPVPLWTGKQIITTVLLNATPADIPGINLVSKNKIKNE 738

Query: 636  PKDKS-FPNEMSINDGFVIIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTM 694
               KS + NE       VI +   +L G++DKS  G   K+ + +++   YGP  ++  +
Sbjct: 739  YWGKSSYENE-------VIFKNGALLCGILDKSQYG-ASKYGIVHSLHELYGPDVSSKVL 790

Query: 695  NRMAKLCARYLGNRGFSIGISDVTPSS-------DLRDKKEEMVRFAYAKCDEL------ 741
            + + +L   Y+ +  F+ G+ D+  +        D+  K  ++ R A A+   L      
Sbjct: 791  SILGRLFTNYITSTAFTCGMDDLRLTDEGNKWRIDILKKSTDIGRAAAAEVTNLGGDVRP 850

Query: 742  --IDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELDNLNAPL----IMA 795
               ++ K  + E     N+   L+A     ++ +  EV   C+ +      P      MA
Sbjct: 851  DDAELLKRLE-EILRDDNKLGILDAVTSSKVNTITSEVVSKCVPDGTMKKFPYNSMQAMA 909

Query: 796  TCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKTPQSKGFVRNSFFSG 855
              G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F+      ++ G+++  F+SG
Sbjct: 910  LSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDAKAGGYIKGRFYSG 969

Query: 856  LTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDDTVRTSANGIVQFT 915
            + P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YD+TVR     +VQF 
Sbjct: 970  IKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNTVRDGDGTLVQFL 1029

Query: 916  YGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIVRETDNVLKPLEEKLI 975
            YGGD +D +  E +     F      A    +N       P  +++  D       E  +
Sbjct: 1030 YGGDAID-VTKESHMSEFKFCVDNYDALLKRYN-------PSALIQHLD------VESAL 1075

Query: 976  RYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAARLAQIRNTRGLLEMTQNG 1035
            +Y        K+ ++   YA RHD     Y  +          L++   ++ L  +++N 
Sbjct: 1076 KYSKKAMKNRKKNLNLPHYA-RHDK----YDPV----------LSKYNPSKFLGSVSENF 1120

Query: 1036 GDTSMEVVSSELQASVDQVYKITKKNVNAFLTIALHKYHRAKVEPGTAVGAIGAQSIGEP 1095
             D     + S       Q   + +K   A + +   KY R+ + PG AVG I +QS+GEP
Sbjct: 1121 QDKLESFIDSNASLFKGQA-TVNEKKFRALMQL---KYMRSLINPGEAVGIIASQSVGEP 1176

Query: 1096 GTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNEGDERAARVVKG 1154
             TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   ++ +  +  A +   
Sbjct: 1177 STQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILPDVTDETADIFCK 1236

Query: 1155 RIEKTLLSDL 1164
               K +LS++
Sbjct: 1237 NTTKVILSEV 1246

 Score = 91.3 bits (225), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 55/162 (33%), Positives = 90/162 (55%), Gaps = 2/162 (1%)

Query: 1266 VVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTIT-NHVLEVNSVLGIE 1324
            V+K +P+I R V    ++GKR L+ EG   + +   +  I    IT N V  V    G+E
Sbjct: 1473 VIKEVPNIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVNGITSNDVSAVLKTYGVE 1532

Query: 1325 AARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1384
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1533 AARNTIVNEINNVFSRYAISVSYRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1591

Query: 1385 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVV 1426
            E T   L  A    +++ ++  S  ++LG+  SVGTG+F ++
Sbjct: 1592 ETTCQFLTKAVLDNEREELKSPSAKLVLGKLNSVGTGAFDIL 1633

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 49/99 (49%), Gaps = 3/99 (3%)

Query: 12  KISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGVSSSSQECMTCH 71
           +IS ++FS ++AA+I A S  +IT   + D   G   + GG  D  +G    +  C TC 
Sbjct: 10  EISSVDFSVMSAAEIRALSVKQITNPTVLD-HLGHPIR-GGLYDLSLGAFLRNL-CATCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDC 110
            +   C GH GHI+L +P +   +F      L+  C  C
Sbjct: 67  LDEKFCSGHQGHIELPVPCYSPLFFNQLYIYLRSSCLYC 105

>SAKL0B10736g Chr2 (925889..930841) [4953 bp, 1650 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1650

 Score =  404 bits (1037), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 296/912 (32%), Positives = 462/912 (50%), Gaps = 113/912 (12%)

Query: 305  KGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGKQGRF 364
            + +  N +M  +  +Q  V  +I+       +     + GGKV PI G  Q L+ K+G F
Sbjct: 405  RKVIFNRLMNAFVTIQNDVNAFID-------VTKAQGNTGGKV-PIPGVKQALEKKEGLF 456

Query: 365  RGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLIINGP 424
            R ++ GKRV+++ R+VISPDPN+  +E+ VP + A  LT+PE VT YN  +L+Q +INGP
Sbjct: 457  RKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNIAELRQAVINGP 516

Query: 425  TVHPGANYLLKKNEEARRNLRYGDKLKLAKNLQ--------------YGDVVERHLEDGD 470
               PGA  +  +NE+       G  L+  K L                   V RH+++ D
Sbjct: 517  DKWPGATQI--QNEDGSLVSLIGMTLEQRKALANQLMTPSTHNSTHILNKKVYRHIKNRD 574

Query: 471  VVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARA 529
            +V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARA
Sbjct: 575  IVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARA 634

Query: 530  EAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMM------ 583
            EA NL    +  LTP SG P+    QD I+    ++ KDSFF      Q +         
Sbjct: 635  EAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRPEDG 694

Query: 584  SDAKLQFDIPPPAIMKPYYLWTGKQVFSLLIRPNKKSPVV--INLDAKNKVYIPPKDKSF 641
               + +    PPA++KP  LWTGKQ+ + ++  N   P +  INL +KNK+        +
Sbjct: 695  HATRNKIVTVPPAVVKPVPLWTGKQIITTVLL-NSTPPEMPGINLISKNKI-----KNEY 748

Query: 642  PNEMSINDGFVIIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLC 701
              E S N+  VI +  E+L G++DKS  G   K  + +++   YGP  A   ++ + +L 
Sbjct: 749  WGEGS-NESEVIFKNGELLCGILDKSQYG-ASKFGIVHSLHEVYGPDIAGKVLSVLGRLF 806

Query: 702  ARYLGNRGFSIGISDVTPSSDLRDKKEEMVR----FAYAKCDELIDMFKNGKL------- 750
              Y+    F+ G+ D+  + +    + E+++       A   E+ ++  + K        
Sbjct: 807  TNYITATAFTCGMDDLRLTEEGNKWRTEILKTSVDIGRAAAAEVTNLEGDVKADDPELLK 866

Query: 751  ---ETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELDNLNAPL----IMATCGSKGST 803
               E     N+   L+A     ++ +  +V   C+ +      P      MA  G+KGS 
Sbjct: 867  RLEEILRDDNKLGILDAVTSSKVNVITSQVVSKCVPDGTMKKFPYNSMQAMALSGAKGSN 926

Query: 804  LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKTPQSKGFVRNSFFSGLTPPEFLF 863
            +NVSQ++ ++GQQ + G RVP     ++LP F+      ++ G+++  F+SG+ P E+ F
Sbjct: 927  VNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDARAGGYIKGRFYSGIRPQEYYF 986

Query: 864  HAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDDTVRTSANGIVQFTYGGDGLDP 923
            H ++GREGL+DTAVKT+ +GY+ R L K LE +   YD+TVR     ++QF YGGD +D 
Sbjct: 987  HCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNTVRDGDGTLIQFLYGGDAVD- 1045

Query: 924  LDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIVRETDNVLKPLEEKLIRYDNLGAV 983
                        +    H     F            V   D +LK       +Y N  A+
Sbjct: 1046 ------------VTKESHMTEFKF-----------CVDNYDALLK-------KY-NPSAL 1074

Query: 984  VPKELIDDE---RYADRHDAERAFYKSLRMYMQ--EKAARLAQIRNTRGLLEMTQNGGDT 1038
            +  E +D E   +Y+ +    R   + +  Y    +    L++   ++ L  +++N  D 
Sbjct: 1075 I--EHLDVESALKYSKKAMKNRKKNEKIPHYAHNIKYDPVLSKYNPSKYLGSVSENFQD- 1131

Query: 1039 SMEVVSSELQASVDQVYKI--TKKNVN--AFLTIALHKYHRAKVEPGTAVGAIGAQSIGE 1094
                   +L+  +D   K+  +K NVN   F  +   KY R+ + PG AVG I +QS+GE
Sbjct: 1132 -------KLEKFIDSNSKLLKSKDNVNEKKFRALMQLKYMRSLINPGEAVGIIASQSVGE 1184

Query: 1095 PGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIIN-AVLVNEGDERAARVV 1152
            P TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   +L +  D++A    
Sbjct: 1185 PSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILPDVTDDQADTFC 1244

Query: 1153 KGRIEKTLLSDL 1164
            K  I K +LS++
Sbjct: 1245 KS-ITKVMLSEV 1255

 Score = 89.7 bits (221), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 88/162 (54%), Gaps = 2/162 (1%)

Query: 1266 VVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTIT-NHVLEVNSVLGIE 1324
            V+  +P+I R V    ++GKR L+ EG   + +   +  I    IT N V  V    G+E
Sbjct: 1483 VITEVPNIDRCVHPEPENGKRVLVTEGVNFQSMWDQEAFIDVNGITSNDVASVLKTYGVE 1542

Query: 1325 AARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1384
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1543 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1601

Query: 1385 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVV 1426
            E T   L  A    +++ ++  S  I++G+   VGTGSF ++
Sbjct: 1602 ETTCQFLTKAVLDNEREELKSPSAKIVMGKLNGVGTGSFDIL 1643

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 45/99 (45%), Gaps = 3/99 (3%)

Query: 12  KISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGVSSSSQECMTCH 71
           +I  ++FS L A +I   S  +IT   + D        +GG  D  +G    +  C TC 
Sbjct: 10  EIISVDFSVLTAQEIRKLSAKQITNPTVLD--NLGHPISGGLYDLSLGAFLRNL-CATCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDC 110
            +   C GH GHI+L +P ++  +F      L+  C  C
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLYC 105

>Kpol_1019.27 s1019 complement(51067..52161) [1095 bp, 364 aa] {ON}
           complement(51067..52161) [1095 nt, 365 aa]
          Length = 364

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 80/283 (28%), Positives = 118/283 (41%), Gaps = 24/283 (8%)

Query: 11  KKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGVSSSSQECMTC 70
           + I  ++F   +  ++ A S  +I   +  D  + R  K GG  D R+G    + +C TC
Sbjct: 12  RTIKEVQFGLFSPEEVRAISVAKIRFPETMDETQTR-AKIGGLNDPRLGSIDRNVKCQTC 70

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDRRDFLKELRRP 130
              +  C GHFGHI LA PVFH+G+     ++ +C+C  C  +LL + +      E    
Sbjct: 71  QEGMNECPGHFGHIDLAKPVFHIGFISKIKKVCECVCMHCGKLLLDEHN------EQMNQ 124

Query: 131 GIDNLRKMSILKKVIDQCKKQRRCLKCXXXXXXXXXXXXXXXXXSLKIIHDTFRWVGKKM 190
            I           V   CK +   + C                        T R  G K+
Sbjct: 125 AIKIKDPKKRFNAVWTLCKTK---MICETDVPSEDDPTKLVSRGGCGNAQPTIRKDGLKL 181

Query: 191 VPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCELLGINSTVRS 250
           V     W  + N      PE +R        L+  + L +FK + SED   LG N     
Sbjct: 182 V---GSWKKDKNTNDGDEPE-QRV-------LSTEEILNIFKHISSEDYIRLGFNEEF-- 228

Query: 251 GRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIV 293
            RPE  +   LP PP  +RPS++  +S    EDDLT KL +I+
Sbjct: 229 ARPEWMLLTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADIL 270

>NCAS0I01160 Chr9 (209900..210367) [468 bp, 155 aa] {ON} Anc_3.346
          Length = 155

 Score = 34.7 bits (78), Expect = 0.82,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 28/61 (45%), Gaps = 4/61 (6%)

Query: 67  CMTCHGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDRRDFLKE 126
           C  C  NL + +     ++L L   H  +  S+ Q L C  KDCS V  +  DR D LK 
Sbjct: 81  CTKCDANLVTQY----LLELHLVECHNPFVSSSHQPLHCFEKDCSQVFPTQMDRIDHLKN 136

Query: 127 L 127
            
Sbjct: 137 F 137

>KLLA0D13068g Chr4 complement(1117229..1119862) [2634 bp, 877 aa]
           {ON} weakly similar to uniprot|P32454 Saccharomyces
           cerevisiae YKL157W APE2 Zinc-dependent metallopeptidase
           yscII and to YHR047C uniprot|P37898 Saccharomyces
           cerevisiae YHR047C AAP1' Arginine/alanine aminopeptidase
          Length = 877

 Score = 35.0 bits (79), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 32/56 (57%), Gaps = 1/56 (1%)

Query: 339 GASSGGGKVKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAV 394
           G SSG GK+ P++ +  + K +QG+F  +++ + +DF   +   P P   +D + V
Sbjct: 233 GTSSGCGKL-PVKVYTAKGKAQQGKFALDVAKRVIDFFSESFEIPYPLPKLDLLCV 287

>NCAS0F03170 Chr6 complement(644614..646701) [2088 bp, 695 aa] {ON}
           Anc_5.405 YDR350C
          Length = 695

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 41/89 (46%), Gaps = 6/89 (6%)

Query: 56  RRMGVSSSSQECMTCHGNLASCHGHFGHIKLALPVF--HVGYFKSTIQILQCICKDCSAV 113
           RRM + S S   +  +  L  C    G +KL   VF   + Y + T      I ++   +
Sbjct: 281 RRMTIQSRSIAFLKFNNALMHCISRIGDLKLFSLVFKFQLAYLEQT----NVIHENPKIL 336

Query: 114 LLSDKDRRDFLKELRRPGIDNLRKMSILK 142
            L +K   DFL+ LR+ G+ N    +ILK
Sbjct: 337 NLLNKPLHDFLRILRKKGLHNELFQTILK 365

>TPHA0H01440 Chr8 complement(322547..325174) [2628 bp, 875 aa] {ON}
           Anc_5.359
          Length = 875

 Score = 34.7 bits (78), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 51/136 (37%), Gaps = 22/136 (16%)

Query: 267 CIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIKAGLAKGISINNMMEHWDYLQLTVAMY 326
           C +    + + P  + + +    T   +TS L+   L         + H+DY++      
Sbjct: 160 CDKSLTVLSNMPEESVETIKNLSTTTFYTSPLMSTYLVAW-----AIGHYDYIE------ 208

Query: 327 INSDSVNPAMLP--------GASSGGGKVKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGR 378
              DS    + P          SSG     PIR F  + K  QGRF  N++ + VD    
Sbjct: 209 ---DSTEKKIYPTLDGYDIRDGSSGTKGSLPIRLFTAKGKSHQGRFAMNVTRRVVDLFSE 265

Query: 379 TVISPDPNLSIDEVAV 394
               P P   +D V V
Sbjct: 266 LFEIPYPLPKLDIVCV 281

>TDEL0A04130 Chr1 complement(735166..736587) [1422 bp, 473 aa] {ON}
           Anc_5.550 YML017W
          Length = 473

 Score = 32.7 bits (73), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 53/116 (45%), Gaps = 15/116 (12%)

Query: 360 KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP-QLVAKVLTFPEKVTRY---NKRK 415
           K+ R +G L     D +GR  I+P    +    A P    +K+L   EKV +    + R 
Sbjct: 173 KEYRLKGELLKDSKDDAGRPYIAPRHKSNPFGSAKPVDTQSKILDIEEKVGKLHIEDTRI 232

Query: 416 LQQLIIN--GPTVHPGANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDG 469
           L++L     GP + PG   LLKK  E +         +  K L Y DVV++  EDG
Sbjct: 233 LRRLSGGDPGPVLQPGKVTLLKKTPEEQ---------EKKKPLSYLDVVKKSAEDG 279

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 148,224,609
Number of extensions: 6525699
Number of successful extensions: 17662
Number of sequences better than 10.0: 71
Number of HSP's gapped: 17673
Number of HSP's successfully gapped: 171
Length of query: 1455
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1333
Effective length of database: 39,492,147
Effective search space: 52643031951
Effective search space used: 52643031951
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 72 (32.3 bits)