Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0B042205.439ON1261266681e-91
Skud_15.2845.439ON1261266186e-84
Smik_15.2995.439ON1261266161e-83
YOR122C (PFY1)5.439ON1261266161e-83
NDAI0C015805.439ON1261266133e-83
CAGL0I01078g5.439ON1261266124e-83
TDEL0D026205.439ON1261266091e-82
Suva_8.1745.439ON1261266091e-82
KAFR0D050405.439ON1261266003e-81
SAKL0G02640g5.439ON1261265995e-81
NCAS0H020705.439ON1261265925e-80
Kpol_1062.275.439ON1261265752e-77
ACL168C5.439ON1261265701e-76
KLLA0E02289g5.439ON1261265692e-76
Ecym_45105.439ON1261265692e-76
KLTH0F15950g5.439ON1261265613e-75
TPHA0E017405.439ON1261265589e-75
ZYRO0F10142g5.439ON1261265526e-74
TBLA0A065005.439ON1191265362e-71
Kwal_55.214135.439ON58582733e-32
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0B04220
         (126 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0B04220 Chr2 (803026..803038,803229..803596) [381 bp, 126 aa...   261   1e-91
Skud_15.284 Chr15 complement(508731..509098,509302..509314) [381...   242   6e-84
Smik_15.299 Chr15 complement(513420..513787,513992..514004) [381...   241   1e-83
YOR122C Chr15 complement(552298..552665,552875..552887) [381 bp,...   241   1e-83
NDAI0C01580 Chr3 complement(339182..339549,339677..339689) [381 ...   240   3e-83
CAGL0I01078g Chr9 (90566..90578,91000..91367) [381 bp, 126 aa] {...   240   4e-83
TDEL0D02620 Chr4 (501856..501868,501937..502304) [381 bp, 126 aa...   239   1e-82
Suva_8.174 Chr8 complement(310093..310460,310663..310675) [381 b...   239   1e-82
KAFR0D05040 Chr4 complement(992821..993188,993288..993300) [381 ...   235   3e-81
SAKL0G02640g Chr7 complement(217953..218320,218467..218479) [381...   235   5e-81
NCAS0H02070 Chr8 complement(403286..403653,403777..403789) [381 ...   232   5e-80
Kpol_1062.27 s1062 (61009..61021,61207..61574) [381 bp, 126 aa] ...   226   2e-77
ACL168C Chr3 complement(62415..62782,62842..62854) [381 bp, 126 ...   224   1e-76
KLLA0E02289g Chr5 complement(212983..213350,213571..213583) [381...   223   2e-76
Ecym_4510 Chr4 complement(1019247..1019614,1019714..1019726) [38...   223   2e-76
KLTH0F15950g Chr6 (1297129..1297141,1297227..1297594) [381 bp, 1...   220   3e-75
TPHA0E01740 Chr5 (352358..352370,352454..352821) [381 bp, 126 aa...   219   9e-75
ZYRO0F10142g Chr6 complement(820724..821091,821172..821184) [381...   217   6e-74
TBLA0A06500 Chr1 (1596802..1596814,1596982..1597328) [360 bp, 11...   211   2e-71
Kwal_55.21413 s55 (825487..825663) [177 bp, 58 aa] {ON} YOR122C ...   109   3e-32

>KNAG0B04220 Chr2 (803026..803038,803229..803596) [381 bp, 126 aa]
           {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  261 bits (668), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 126/126 (100%), Positives = 126/126 (100%)

Query: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSVWATSGGLTLQPNEISAIVTGFDNQAGLQSNG 60
           MSWQAYTDNLLGTGKVDKAVIYSRAGDSVWATSGGLTLQPNEISAIVTGFDNQAGLQSNG
Sbjct: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSVWATSGGLTLQPNEISAIVTGFDNQAGLQSNG 60

Query: 61  LHVQGQKFMFLRADDRSIYGRHDAEGVICVRTKQTILVAHYPPTVQAGEATKIVEQLADY 120
           LHVQGQKFMFLRADDRSIYGRHDAEGVICVRTKQTILVAHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHVQGQKFMFLRADDRSIYGRHDAEGVICVRTKQTILVAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>Skud_15.284 Chr15 complement(508731..509098,509302..509314) [381
           bp, 126 aa] {ON} YOR122C (REAL)
          Length = 126

 Score =  242 bits (618), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 121/126 (96%)

Query: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSVWATSGGLTLQPNEISAIVTGFDNQAGLQSNG 60
           MSWQAYTDNL+GTGKVDKAVIYSRAGD++WATSGGL+LQPNEIS +V GFDN AGLQSNG
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAIWATSGGLSLQPNEISEVVQGFDNPAGLQSNG 60

Query: 61  LHVQGQKFMFLRADDRSIYGRHDAEGVICVRTKQTILVAHYPPTVQAGEATKIVEQLADY 120
           LH+QGQKFM LRADDRSIYGRHDAEGVICVRTKQT++++HYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVICVRTKQTVIISHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>Smik_15.299 Chr15 complement(513420..513787,513992..514004) [381
           bp, 126 aa] {ON} YOR122C (REAL)
          Length = 126

 Score =  241 bits (616), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 112/126 (88%), Positives = 120/126 (95%)

Query: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSVWATSGGLTLQPNEISAIVTGFDNQAGLQSNG 60
           MSWQAYTDNL+GTGKVDKAVIYSRAGD+VWATSGGL+LQPNEI  IV GFDN AGLQSNG
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG 60

Query: 61  LHVQGQKFMFLRADDRSIYGRHDAEGVICVRTKQTILVAHYPPTVQAGEATKIVEQLADY 120
           LH+QGQKFM LRADDRSIYGRHDAEGV+CVRTKQT+++AHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>YOR122C Chr15 complement(552298..552665,552875..552887) [381 bp,
           126 aa] {ON}  PFY1Profilin, binds actin,
           phosphatidylinositol 4,5-bisphosphate, and polyproline
           regions; involved in cytoskeleton organization; required
           for normal timing of actin polymerization in response to
           thermal stress
          Length = 126

 Score =  241 bits (616), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 112/126 (88%), Positives = 120/126 (95%)

Query: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSVWATSGGLTLQPNEISAIVTGFDNQAGLQSNG 60
           MSWQAYTDNL+GTGKVDKAVIYSRAGD+VWATSGGL+LQPNEI  IV GFDN AGLQSNG
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG 60

Query: 61  LHVQGQKFMFLRADDRSIYGRHDAEGVICVRTKQTILVAHYPPTVQAGEATKIVEQLADY 120
           LH+QGQKFM LRADDRSIYGRHDAEGV+CVRTKQT+++AHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>NDAI0C01580 Chr3 complement(339182..339549,339677..339689) [381 bp,
           126 aa] {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  240 bits (613), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 117/126 (92%)

Query: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSVWATSGGLTLQPNEISAIVTGFDNQAGLQSNG 60
           MSWQAYTDNLL TGKVDKAVIYSRAGDSVWATSGG  LQ NEIS I  GFDN AGLQSNG
Sbjct: 1   MSWQAYTDNLLATGKVDKAVIYSRAGDSVWATSGGFQLQANEISEICQGFDNPAGLQSNG 60

Query: 61  LHVQGQKFMFLRADDRSIYGRHDAEGVICVRTKQTILVAHYPPTVQAGEATKIVEQLADY 120
           LH+QGQKFM LRADDRSIYGRHDAEGV+CVRTKQT+LVAHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLVAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>CAGL0I01078g Chr9 (90566..90578,91000..91367) [381 bp, 126 aa] {ON}
           highly similar to uniprot|P07274 Saccharomyces
           cerevisiae YOR122c PFY1 profilin
          Length = 126

 Score =  240 bits (612), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 112/126 (88%), Positives = 119/126 (94%)

Query: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSVWATSGGLTLQPNEISAIVTGFDNQAGLQSNG 60
           MSWQAYTDNLL TGKVDKAVIYS+AGD+VWATSGGL+LQ NEIS IV GFDN  GLQSNG
Sbjct: 1   MSWQAYTDNLLATGKVDKAVIYSKAGDAVWATSGGLSLQANEISEIVQGFDNPTGLQSNG 60

Query: 61  LHVQGQKFMFLRADDRSIYGRHDAEGVICVRTKQTILVAHYPPTVQAGEATKIVEQLADY 120
           LH+QGQKFM LRADDRSIYGRHDAEGV+CVRTKQT+L+AHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>TDEL0D02620 Chr4 (501856..501868,501937..502304) [381 bp, 126 aa]
           {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  239 bits (609), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 112/126 (88%), Positives = 118/126 (93%)

Query: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSVWATSGGLTLQPNEISAIVTGFDNQAGLQSNG 60
           MSWQAYTDNLLGTGKVDKAVIYSRAGDS+WA+SGGLTLQ NEI  I  GFD+  GLQSNG
Sbjct: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSIWASSGGLTLQANEIQEIAQGFDSPVGLQSNG 60

Query: 61  LHVQGQKFMFLRADDRSIYGRHDAEGVICVRTKQTILVAHYPPTVQAGEATKIVEQLADY 120
           LH+QGQKFM LRADDRSIYGRHDAEGV+CVRTKQTIL+AHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>Suva_8.174 Chr8 complement(310093..310460,310663..310675) [381 bp,
           126 aa] {ON} YOR122C (REAL)
          Length = 126

 Score =  239 bits (609), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 119/126 (94%)

Query: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSVWATSGGLTLQPNEISAIVTGFDNQAGLQSNG 60
           MSWQAYTDNL+GTGKVDKAVI+SRAGD++WATSGGL+LQPNEI  IV GFDN  GLQSNG
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIFSRAGDAIWATSGGLSLQPNEIGEIVQGFDNPGGLQSNG 60

Query: 61  LHVQGQKFMFLRADDRSIYGRHDAEGVICVRTKQTILVAHYPPTVQAGEATKIVEQLADY 120
           LH+QGQKFM LRADDRSIYGRHDAEGVICVRTKQT+++AHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVICVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>KAFR0D05040 Chr4 complement(992821..993188,993288..993300) [381 bp,
           126 aa] {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  235 bits (600), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 108/126 (85%), Positives = 116/126 (92%)

Query: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSVWATSGGLTLQPNEISAIVTGFDNQAGLQSNG 60
           MSWQAYTDNLL T KVD+AVIYSRAGD+ WATSGG+ LQPNEI+ I  GFDN AGLQSNG
Sbjct: 1   MSWQAYTDNLLATNKVDRAVIYSRAGDAAWATSGGMALQPNEIAEIAQGFDNAAGLQSNG 60

Query: 61  LHVQGQKFMFLRADDRSIYGRHDAEGVICVRTKQTILVAHYPPTVQAGEATKIVEQLADY 120
           LH+QGQKFM LRADDRSIYGRHDAEGV+CVRTKQTI++AHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>SAKL0G02640g Chr7 complement(217953..218320,218467..218479) [381
           bp, 126 aa] {ON} highly similar to uniprot|P07274
           Saccharomyces cerevisiae YOR122C PFY1 Profilin actin-
           and phosphatidylinositol 4 5-bisphosphate-binding
           protein plays a role in cytoskeleton organization
           required for normal timing of actin polymerization in
           response to thermal stress localizes to plasma membrane
           and cytosol
          Length = 126

 Score =  235 bits (599), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 109/126 (86%), Positives = 116/126 (92%)

Query: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSVWATSGGLTLQPNEISAIVTGFDNQAGLQSNG 60
           MSWQAYTDNLLGTGKVDKA+IYSRAGD++WATSGGL LQP EIS I  GFDN  GLQSNG
Sbjct: 1   MSWQAYTDNLLGTGKVDKAIIYSRAGDAIWATSGGLNLQPAEISEIAQGFDNPTGLQSNG 60

Query: 61  LHVQGQKFMFLRADDRSIYGRHDAEGVICVRTKQTILVAHYPPTVQAGEATKIVEQLADY 120
           LH+Q QKFM +RADDRSIYGRHDAEGV+CVRTKQTIL+AHYPP VQAGEATKIVEQLADY
Sbjct: 61  LHIQSQKFMLIRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPGVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>NCAS0H02070 Chr8 complement(403286..403653,403777..403789) [381 bp,
           126 aa] {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  232 bits (592), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 108/126 (85%), Positives = 117/126 (92%)

Query: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSVWATSGGLTLQPNEISAIVTGFDNQAGLQSNG 60
           MSWQA TDNLL TGKVD+AV+YSRAGDSVWATSGGL LQPNEI+ I  GFDN AGLQSNG
Sbjct: 1   MSWQACTDNLLATGKVDRAVLYSRAGDSVWATSGGLQLQPNEIAEIARGFDNPAGLQSNG 60

Query: 61  LHVQGQKFMFLRADDRSIYGRHDAEGVICVRTKQTILVAHYPPTVQAGEATKIVEQLADY 120
           LHVQGQKFM LRADD+SIYGRHDAEG++CVRT QTIL+AHYPP+VQAGEATKIVEQLADY
Sbjct: 61  LHVQGQKFMLLRADDKSIYGRHDAEGIVCVRTLQTILIAHYPPSVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISV+Y
Sbjct: 121 LISVKY 126

>Kpol_1062.27 s1062 (61009..61021,61207..61574) [381 bp, 126 aa]
           {ON} (61009..61021,61207..61574) [381 nt, 127 aa]
          Length = 126

 Score =  226 bits (575), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 114/126 (90%)

Query: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSVWATSGGLTLQPNEISAIVTGFDNQAGLQSNG 60
           MSWQAYTDNLL TGK+DKAV+YSRAGD+VWA+SGGL L   EIS I  GFD+ + LQSNG
Sbjct: 1   MSWQAYTDNLLATGKIDKAVLYSRAGDAVWASSGGLALAATEISGIAQGFDDPSHLQSNG 60

Query: 61  LHVQGQKFMFLRADDRSIYGRHDAEGVICVRTKQTILVAHYPPTVQAGEATKIVEQLADY 120
           LH+QGQKFM LRADDRSIYGRHDAEGV+CVRTKQTILVAHYP TVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMMLRADDRSIYGRHDAEGVVCVRTKQTILVAHYPATVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>ACL168C Chr3 complement(62415..62782,62842..62854) [381 bp, 126 aa]
           {ON} Syntenic homolog of Saccharomyces cerevisiae
           YOR122C (PFY1); 1-intron
          Length = 126

 Score =  224 bits (570), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 103/126 (81%), Positives = 114/126 (90%)

Query: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSVWATSGGLTLQPNEISAIVTGFDNQAGLQSNG 60
           MSWQAYTDNLL TGKVDKA IYSRAGD++WA+SGGL L+P+EI  I  GFDN AGLQ+NG
Sbjct: 1   MSWQAYTDNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGFDNAAGLQANG 60

Query: 61  LHVQGQKFMFLRADDRSIYGRHDAEGVICVRTKQTILVAHYPPTVQAGEATKIVEQLADY 120
           LH+QGQKFM LRAD+RSIYGRH+AEGV+ VRTKQTIL+AHYP  VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADERSIYGRHEAEGVVAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>KLLA0E02289g Chr5 complement(212983..213350,213571..213583) [381
           bp, 126 aa] {ON} highly similar to uniprot|P07274
           Saccharomyces cerevisiae YOR122C PFY1 Profilin actin-
           and phosphatidylinositol 4 5-bisphosphate-binding
           protein plays a role in cytoskeleton organization
           required for normal timing of actin polymerization in
           response to thermal stress localizes to plasma membrane
           and cytosol
          Length = 126

 Score =  223 bits (569), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 103/126 (81%), Positives = 114/126 (90%)

Query: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSVWATSGGLTLQPNEISAIVTGFDNQAGLQSNG 60
           MSWQAYTDNLL TGK+DK+VIYSRAGD+VWA+SGGL LQP EIS I  GFDN +GLQSNG
Sbjct: 1   MSWQAYTDNLLATGKIDKSVIYSRAGDAVWASSGGLQLQPAEISEIARGFDNPSGLQSNG 60

Query: 61  LHVQGQKFMFLRADDRSIYGRHDAEGVICVRTKQTILVAHYPPTVQAGEATKIVEQLADY 120
           LHVQGQKFM ++ADDRSIYGRH+AEG++ VRTKQTIL+ HYPP VQAGEATKIVEQL DY
Sbjct: 61  LHVQGQKFMLIKADDRSIYGRHEAEGIVIVRTKQTILIGHYPPGVQAGEATKIVEQLGDY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>Ecym_4510 Chr4 complement(1019247..1019614,1019714..1019726) [381
           bp, 126 aa] {ON} similar to Ashbya gossypii ACL168C
           1-intron
          Length = 126

 Score =  223 bits (569), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 102/126 (80%), Positives = 114/126 (90%)

Query: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSVWATSGGLTLQPNEISAIVTGFDNQAGLQSNG 60
           MSWQAYTDNL+ TGKVDKA+IYSRAGD++WA+SGG++L+ NEIS I  GFDN  GLQSNG
Sbjct: 1   MSWQAYTDNLIATGKVDKAIIYSRAGDTIWASSGGMSLEANEISEISQGFDNAGGLQSNG 60

Query: 61  LHVQGQKFMFLRADDRSIYGRHDAEGVICVRTKQTILVAHYPPTVQAGEATKIVEQLADY 120
           LH+Q QKFM LRADDRSIYGRH+AEG+I VRTKQTIL+AHYP  VQAGEATKIVEQLADY
Sbjct: 61  LHIQSQKFMLLRADDRSIYGRHEAEGIIAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>KLTH0F15950g Chr6 (1297129..1297141,1297227..1297594) [381 bp, 126
           aa] {ON} highly similar to uniprot|P07274 Saccharomyces
           cerevisiae YOR122C PFY1 Profilin actin- and
           phosphatidylinositol 4 5-bisphosphate-binding protein
           plays a role in cytoskeleton organization required for
           normal timing of actin polymerization in response to
           thermal stress localizes to plasma membrane and cytosol
          Length = 126

 Score =  220 bits (561), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 104/126 (82%), Positives = 111/126 (88%)

Query: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSVWATSGGLTLQPNEISAIVTGFDNQAGLQSNG 60
           MSWQAYTDNLLGTGK+DKA IYSRAGDS+WA SGGL+L  NEI  I  GF+N +GLQS G
Sbjct: 1   MSWQAYTDNLLGTGKIDKAAIYSRAGDSLWAASGGLSLPTNEIGEIAQGFENPSGLQSTG 60

Query: 61  LHVQGQKFMFLRADDRSIYGRHDAEGVICVRTKQTILVAHYPPTVQAGEATKIVEQLADY 120
           LH+QGQKFM +RADDRSIYGRHDAEGVICVRTKQTILV HYP  VQAGEATKIVEQLADY
Sbjct: 61  LHLQGQKFMLIRADDRSIYGRHDAEGVICVRTKQTILVTHYPAGVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISV Y
Sbjct: 121 LISVSY 126

>TPHA0E01740 Chr5 (352358..352370,352454..352821) [381 bp, 126 aa]
           {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  219 bits (558), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 111/126 (88%)

Query: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSVWATSGGLTLQPNEISAIVTGFDNQAGLQSNG 60
           MSWQAYTDNLL TGKVDKA +YSRAGD+ WA SGGL+L   E + I  GFD+ +GLQ+ G
Sbjct: 1   MSWQAYTDNLLATGKVDKAALYSRAGDAAWAASGGLSLTAQEATEIAKGFDDPSGLQTTG 60

Query: 61  LHVQGQKFMFLRADDRSIYGRHDAEGVICVRTKQTILVAHYPPTVQAGEATKIVEQLADY 120
           LH+QGQKFM LRADDRSIYGRHDAEGV+CVRTKQTI++AHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>ZYRO0F10142g Chr6 complement(820724..821091,821172..821184) [381
           bp, 126 aa] {ON} highly similar to uniprot|P07274
           Saccharomyces cerevisiae YOR122C PFY1 Profilin actin-
           and phosphatidylinositol 4 5-bisphosphate-binding
           protein plays a role in cytoskeleton organization
           required for normal timing of actin polymerization in
           response to thermal stress localizes to plasma membrane
           and cytosol
          Length = 126

 Score =  217 bits (552), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 109/126 (86%)

Query: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSVWATSGGLTLQPNEISAIVTGFDNQAGLQSNG 60
           MSWQAYT+NLLGTGK+DKA IYSRAGDS+WA+SGGLT  P EI  I  GFD  +GLQS G
Sbjct: 1   MSWQAYTENLLGTGKIDKAAIYSRAGDSLWASSGGLTFAPQEIGKIAAGFDEPSGLQSTG 60

Query: 61  LHVQGQKFMFLRADDRSIYGRHDAEGVICVRTKQTILVAHYPPTVQAGEATKIVEQLADY 120
           L VQGQKFM LRADDRSIY RHDAEG+ CVRTKQTI++AHYPP+VQAGEATKIVEQLADY
Sbjct: 61  LFVQGQKFMLLRADDRSIYARHDAEGMCCVRTKQTIILAHYPPSVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI  QY
Sbjct: 121 LIGAQY 126

>TBLA0A06500 Chr1 (1596802..1596814,1596982..1597328) [360 bp, 119
           aa] {ON} Anc_5.439 YOR122C
          Length = 119

 Score =  211 bits (536), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 102/126 (80%), Positives = 109/126 (86%), Gaps = 7/126 (5%)

Query: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSVWATSGGLTLQPNEISAIVTGFDNQAGLQSNG 60
           MSWQA       TGKVDKAVIYSRAGDSVWA+SGGL L  NEI+ I  GFDN +GLQSNG
Sbjct: 1   MSWQA-------TGKVDKAVIYSRAGDSVWASSGGLQLGANEIAEIARGFDNPSGLQSNG 53

Query: 61  LHVQGQKFMFLRADDRSIYGRHDAEGVICVRTKQTILVAHYPPTVQAGEATKIVEQLADY 120
           LHVQ QKFM LRADDRSIYGRHDAEG++CVRTKQTI++AHYPPTVQAGEATKIVEQLADY
Sbjct: 54  LHVQSQKFMLLRADDRSIYGRHDAEGIVCVRTKQTIVIAHYPPTVQAGEATKIVEQLADY 113

Query: 121 LISVQY 126
           LI VQY
Sbjct: 114 LIGVQY 119

>Kwal_55.21413 s55 (825487..825663) [177 bp, 58 aa] {ON} YOR122C
           (PFY1) - profilin (actin-binding protein) [contig 130]
           FULL
          Length = 58

 Score =  109 bits (273), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 51/58 (87%), Positives = 53/58 (91%)

Query: 69  MFLRADDRSIYGRHDAEGVICVRTKQTILVAHYPPTVQAGEATKIVEQLADYLISVQY 126
           M +RADDRSIYGRHDAEGV+CVRTKQTILV HYP  VQAGEATKIVEQLADYLISV Y
Sbjct: 1   MLIRADDRSIYGRHDAEGVVCVRTKQTILVTHYPAGVQAGEATKIVEQLADYLISVSY 58

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.133    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 12,563,975
Number of extensions: 429786
Number of successful extensions: 707
Number of sequences better than 10.0: 22
Number of HSP's gapped: 707
Number of HSP's successfully gapped: 22
Length of query: 126
Length of database: 53,481,399
Length adjustment: 95
Effective length of query: 31
Effective length of database: 42,588,129
Effective search space: 1320231999
Effective search space used: 1320231999
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)