Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0B042005.442ON34434418150.0
KAFR0D050605.442ON32634414340.0
Suva_2.5445.442ON34635314040.0
YDR372C (VPS74)5.442ON34534513970.0
Smik_4.6385.442ON34634813920.0
Skud_4.6415.442ON34635413860.0
TDEL0D025905.442ON33034413480.0
CAGL0A02926g5.442ON32834413330.0
SAKL0G02706g5.442ON33234413250.0
Kwal_55.213995.442ON32934413110.0
KLTH0F15884g5.442ON32934413050.0
NCAS0F034305.442ON33234612990.0
TBLA0A064805.442ON33434512971e-180
Kpol_1016.25.442ON32834412961e-180
ZYRO0F10208g5.442ON33234412921e-179
NDAI0B057205.442ON36536512761e-176
KLLA0E02355g5.442ON32434212541e-174
ACL165C5.442ON33134212201e-169
Ecym_45135.442ON33334212161e-168
TPHA0J026105.442ON32934412111e-167
Kpol_1062.245.442ON2762738881e-119
TBLA0A027805.442ON3873048601e-113
NCAS0H020905.442ON3452865582e-68
Skud_5.481.485ON517101790.23
KAFR0C051107.39ON89172760.61
CAGL0K00110gna 1ON832147694.7
ZYRO0E04224gna 2ON124834695.1
KLTH0E09504g2.396ON38521685.3
SAKL0C06556g1.221ON76672685.4
ZYRO0F07172g8.667ON50640685.7
TPHA0L008608.379ON52880686.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0B04200
         (344 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0B04200 Chr2 (799881..800915) [1035 bp, 344 aa] {ON} Anc_5.4...   703   0.0  
KAFR0D05060 Chr4 complement(994966..995946) [981 bp, 326 aa] {ON...   556   0.0  
Suva_2.544 Chr2 complement(971735..972775) [1041 bp, 346 aa] {ON...   545   0.0  
YDR372C Chr4 complement(1221112..1222149) [1038 bp, 345 aa] {ON}...   542   0.0  
Smik_4.638 Chr4 complement(1141194..1142234) [1041 bp, 346 aa] {...   540   0.0  
Skud_4.641 Chr4 complement(1144004..1145044) [1041 bp, 346 aa] {...   538   0.0  
TDEL0D02590 Chr4 (497351..498343) [993 bp, 330 aa] {ON} Anc_5.44...   523   0.0  
CAGL0A02926g Chr1 complement(304789..305775) [987 bp, 328 aa] {O...   518   0.0  
SAKL0G02706g Chr7 complement(222134..223132) [999 bp, 332 aa] {O...   514   0.0  
Kwal_55.21399 s55 (820851..821840) [990 bp, 329 aa] {ON} YDR372C...   509   0.0  
KLTH0F15884g Chr6 (1292767..1293756) [990 bp, 329 aa] {ON} highl...   507   0.0  
NCAS0F03430 Chr6 complement(690870..691868) [999 bp, 332 aa] {ON...   504   0.0  
TBLA0A06480 Chr1 (1593225..1594229) [1005 bp, 334 aa] {ON} Anc_5...   504   e-180
Kpol_1016.2 s1016 (4946..5932) [987 bp, 328 aa] {ON} (4946..5932...   503   e-180
ZYRO0F10208g Chr6 complement(824737..825735) [999 bp, 332 aa] {O...   502   e-179
NDAI0B05720 Chr2 complement(1391179..1392276) [1098 bp, 365 aa] ...   496   e-176
KLLA0E02355g Chr5 complement(217222..218196) [975 bp, 324 aa] {O...   487   e-174
ACL165C Chr3 complement(66499..67494) [996 bp, 331 aa] {ON} Synt...   474   e-169
Ecym_4513 Chr4 complement(1023828..1024829) [1002 bp, 333 aa] {O...   473   e-168
TPHA0J02610 Chr10 complement(579213..580202) [990 bp, 329 aa] {O...   471   e-167
Kpol_1062.24 s1062 (55671..56501) [831 bp, 276 aa] {ON} (55671.....   346   e-119
TBLA0A02780 Chr1 (670848..672011) [1164 bp, 387 aa] {ON} Anc_5.4...   335   e-113
NCAS0H02090 Chr8 complement(405561..406598) [1038 bp, 345 aa] {O...   219   2e-68
Skud_5.48 Chr5 (71966..73519) [1554 bp, 517 aa] {ON} YEL042W (REAL)    35   0.23 
KAFR0C05110 Chr3 (1013807..1016482) [2676 bp, 891 aa] {ON} Anc_7...    34   0.61 
CAGL0K00110g Chr11 complement(3332..5830) [2499 bp, 832 aa] {ON}...    31   4.7  
ZYRO0E04224g Chr5 (317895..321641) [3747 bp, 1248 aa] {ON} conse...    31   5.1  
KLTH0E09504g Chr5 complement(860113..861270) [1158 bp, 385 aa] {...    31   5.3  
SAKL0C06556g Chr3 (611209..613509) [2301 bp, 766 aa] {ON} simila...    31   5.4  
ZYRO0F07172g Chr6 (579706..581226) [1521 bp, 506 aa] {ON} conser...    31   5.7  
TPHA0L00860 Chr12 (169610..171196) [1587 bp, 528 aa] {ON} Anc_8....    31   6.0  

>KNAG0B04200 Chr2 (799881..800915) [1035 bp, 344 aa] {ON} Anc_5.442
           YDR372C
          Length = 344

 Score =  703 bits (1815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/344 (100%), Positives = 344/344 (100%)

Query: 1   MSTLQRRRVNRSDSNEGETVSGGKTAAAPSASNDAEEYEETSGPTRKVAYDPEEAKLRDN 60
           MSTLQRRRVNRSDSNEGETVSGGKTAAAPSASNDAEEYEETSGPTRKVAYDPEEAKLRDN
Sbjct: 1   MSTLQRRRVNRSDSNEGETVSGGKTAAAPSASNDAEEYEETSGPTRKVAYDPEEAKLRDN 60

Query: 61  YTVPKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCIMIELALRKKIRILDDSARKRF 120
           YTVPKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCIMIELALRKKIRILDDSARKRF
Sbjct: 61  YTVPKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCIMIELALRKKIRILDDSARKRF 120

Query: 121 DISERLVEVVDGSKTGEVLLDETLQLMKNDEPLTIANWIDLLSGETWNLMKINYQLKQVR 180
           DISERLVEVVDGSKTGEVLLDETLQLMKNDEPLTIANWIDLLSGETWNLMKINYQLKQVR
Sbjct: 121 DISERLVEVVDGSKTGEVLLDETLQLMKNDEPLTIANWIDLLSGETWNLMKINYQLKQVR 180

Query: 181 ERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSTVVSRNMELSFNSYF 240
           ERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSTVVSRNMELSFNSYF
Sbjct: 181 ERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSTVVSRNMELSFNSYF 240

Query: 241 PESTSFKYIRTVALVCSTYGASVLENVLSSLDYEQRDRAVSRAEELLEKFGQYPFDLEKQ 300
           PESTSFKYIRTVALVCSTYGASVLENVLSSLDYEQRDRAVSRAEELLEKFGQYPFDLEKQ
Sbjct: 241 PESTSFKYIRTVALVCSTYGASVLENVLSSLDYEQRDRAVSRAEELLEKFGQYPFDLEKQ 300

Query: 301 GDSGISCNLNKEAQREVDESPNSALYLEVVAGVIEVFSRMDMLL 344
           GDSGISCNLNKEAQREVDESPNSALYLEVVAGVIEVFSRMDMLL
Sbjct: 301 GDSGISCNLNKEAQREVDESPNSALYLEVVAGVIEVFSRMDMLL 344

>KAFR0D05060 Chr4 complement(994966..995946) [981 bp, 326 aa] {ON}
           Anc_5.442 YDR372C
          Length = 326

 Score =  556 bits (1434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/344 (79%), Positives = 300/344 (87%), Gaps = 18/344 (5%)

Query: 1   MSTLQRRRVNRSDSNEGETVSGGKTAAAPSASNDAEEYEETSGPTRKVAYDPEEAKLRDN 60
           MSTLQRRR NRSDSN                ++D+E   E+    RKVAYDPEEAKLRDN
Sbjct: 1   MSTLQRRRKNRSDSN----------------ADDSENVSESQD--RKVAYDPEEAKLRDN 42

Query: 61  YTVPKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCIMIELALRKKIRILDDSARKRF 120
            ++PKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCI+IELALR KIRILDDSARKRF
Sbjct: 43  VSIPKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCILIELALRNKIRILDDSARKRF 102

Query: 121 DISERLVEVVDGSKTGEVLLDETLQLMKNDEPLTIANWIDLLSGETWNLMKINYQLKQVR 180
           D+SERLVEV+DGSKTGEVLLDE LQLMKNDEPLTIANWIDLLSGETWNL+KINYQLKQVR
Sbjct: 103 DVSERLVEVIDGSKTGEVLLDEALQLMKNDEPLTIANWIDLLSGETWNLLKINYQLKQVR 162

Query: 181 ERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSTVVSRNMELSFNSYF 240
           ERLAKGLVDKGVLRTEMKNFFLFDMATHPVTD+SCKEAIKRRILS +VSRNMEL++NSYF
Sbjct: 163 ERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSALVSRNMELNYNSYF 222

Query: 241 PESTSFKYIRTVALVCSTYGASVLENVLSSLDYEQRDRAVSRAEELLEKFGQYPFDLEKQ 300
            E+TSFKYIR VALVC +YGA+VLENVLSSLDYE+RDRA+SRAEE+L +F QYPFDL K 
Sbjct: 223 AETTSFKYIRIVALVCCSYGANVLENVLSSLDYEKRDRAISRAEEILAQFAQYPFDLSKN 282

Query: 301 GDSGISCNLNKEAQREVDESPNSALYLEVVAGVIEVFSRMDMLL 344
            + GIS NLNKE + EV+E+P   L LEV+AGVIEVFSRMDMLL
Sbjct: 283 TELGISVNLNKEVENEVNENPQFTLQLEVIAGVIEVFSRMDMLL 326

>Suva_2.544 Chr2 complement(971735..972775) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  545 bits (1404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/353 (73%), Positives = 302/353 (85%), Gaps = 16/353 (4%)

Query: 1   MSTLQRRRVNRSDSNEGETV---------SGGKTAAAPSASNDAEEYEETSGPTRKVAYD 51
           MSTLQRRRVNR+DS +  ++         SG KT+  P   +D       +G  +K+AYD
Sbjct: 1   MSTLQRRRVNRADSGDTSSMQSTSNNHNSSGDKTSNGPVDGDD-------NGINKKIAYD 53

Query: 52  PEEAKLRDNYTVPKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCIMIELALRKKIRI 111
           PEE+KLRDN  +P LTLMEEVLLMGLRDREGYLSFWND+ISYALRGCI+IELALR KIRI
Sbjct: 54  PEESKLRDNIKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRI 113

Query: 112 LDDSARKRFDISERLVEVVDGSKTGEVLLDETLQLMKNDEPLTIANWIDLLSGETWNLMK 171
           LDDSARKRFD+SERLVEV+DGSKTGEVLLDETLQLMKNDEPLTI+NWIDLLSGETWNL+K
Sbjct: 114 LDDSARKRFDLSERLVEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLK 173

Query: 172 INYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSTVVSRN 231
           INYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP+ D+SCKEAIKRR+LS +VSRN
Sbjct: 174 INYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRN 233

Query: 232 MELSFNSYFPESTSFKYIRTVALVCSTYGASVLENVLSSLDYEQRDRAVSRAEELLEKFG 291
           MELS+N YFPE+TSFK IRT+AL+C +YGA+VLENVL++L+YE+RD+A+SRAEE++  F 
Sbjct: 234 MELSYNEYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMSHFS 293

Query: 292 QYPFDLEKQGDSGISCNLNKEAQREVDESPNSALYLEVVAGVIEVFSRMDMLL 344
           QYPFDLEK  D G+S NLNKE + E++ +P   L LEV+AGV EVFSRMDMLL
Sbjct: 294 QYPFDLEKDTDLGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 346

>YDR372C Chr4 complement(1221112..1222149) [1038 bp, 345 aa] {ON}
           VPS74Protein required for Golgi localization of
           glycosyltransferases; binds the cytosolic domains of
           Golgi glycosyltransferases; binding to PtdIns4P required
           for Golgi targeting and function; tetramer formation
           required for function
          Length = 345

 Score =  542 bits (1397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/345 (73%), Positives = 302/345 (87%), Gaps = 1/345 (0%)

Query: 1   MSTLQRRRVNRSDSNEGETV-SGGKTAAAPSASNDAEEYEETSGPTRKVAYDPEEAKLRD 59
           MSTLQRRRVNR+DS +  ++ S          +N A + ++ +G  +K+AYDPEE+KLRD
Sbjct: 1   MSTLQRRRVNRADSGDTSSIHSSANNTKGDKIANIAVDGDDDNGTNKKIAYDPEESKLRD 60

Query: 60  NYTVPKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCIMIELALRKKIRILDDSARKR 119
           N  +P LTLMEEVLLMGLRDREGYLSFWND+ISYALRGCI+IELALR KIRILDDSARKR
Sbjct: 61  NINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARKR 120

Query: 120 FDISERLVEVVDGSKTGEVLLDETLQLMKNDEPLTIANWIDLLSGETWNLMKINYQLKQV 179
           FD+SERL+EV+D SKTGEVLLDETLQLMKNDEPL+I+NWIDLLSGETWNL+KINYQLKQV
Sbjct: 121 FDLSERLIEVIDSSKTGEVLLDETLQLMKNDEPLSISNWIDLLSGETWNLLKINYQLKQV 180

Query: 180 RERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSTVVSRNMELSFNSY 239
           RERLAKGLVDKGVLRTEMKNFFLFDMATHP+ D+SCKEAIKRR+LS +VSRNMELS+N Y
Sbjct: 181 RERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEY 240

Query: 240 FPESTSFKYIRTVALVCSTYGASVLENVLSSLDYEQRDRAVSRAEELLEKFGQYPFDLEK 299
           FPE+TSFK IRT+AL+C +YGA+VLENVL++L+YE+RD+A+SRAEE++ +F QYPFDLEK
Sbjct: 241 FPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQYPFDLEK 300

Query: 300 QGDSGISCNLNKEAQREVDESPNSALYLEVVAGVIEVFSRMDMLL 344
           + + G+S NLNKE + E++ +P   L LEV+AGV EVFSRMDMLL
Sbjct: 301 ETELGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 345

>Smik_4.638 Chr4 complement(1141194..1142234) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  540 bits (1392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/348 (74%), Positives = 304/348 (87%), Gaps = 6/348 (1%)

Query: 1   MSTLQRRRVNRSDSNEGETVSGGKTAAAPSASND----AEEYEETSGPTRKVAYDPEEAK 56
           MSTLQRRRVNR+DS  G+T S   +A   +A  D        ++ +G  +K+AYDPEE+K
Sbjct: 1   MSTLQRRRVNRADS--GDTSSMQPSANNINAKGDKIASVAVDDDDNGTNKKIAYDPEESK 58

Query: 57  LRDNYTVPKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCIMIELALRKKIRILDDSA 116
           LRDN  +P LTLMEEVLLMGLRDREGYLSFWND+ISYALRGCI+IELALR KIRILDDSA
Sbjct: 59  LRDNINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSA 118

Query: 117 RKRFDISERLVEVVDGSKTGEVLLDETLQLMKNDEPLTIANWIDLLSGETWNLMKINYQL 176
           RKRFD+SERL+EV+DGSKTGEVLLDETLQLMKNDEPLTI+NWIDLLSGETWNL+KINYQL
Sbjct: 119 RKRFDLSERLIEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQL 178

Query: 177 KQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSTVVSRNMELSF 236
           KQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP+ D+SCKEAIKRR+LS +VSRNMELS+
Sbjct: 179 KQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSY 238

Query: 237 NSYFPESTSFKYIRTVALVCSTYGASVLENVLSSLDYEQRDRAVSRAEELLEKFGQYPFD 296
           N YFPE+TSFK IRT+AL+C +YGA+VLENVL++L+YE+RD+A+SRAEE++ +F Q+PFD
Sbjct: 239 NEYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQFPFD 298

Query: 297 LEKQGDSGISCNLNKEAQREVDESPNSALYLEVVAGVIEVFSRMDMLL 344
           LEK+ + GIS NLNKE + E++ +P   L LEV+AGV EVFSRMDMLL
Sbjct: 299 LEKETELGISVNLNKEVKEEMESNPGHNLQLEVIAGVFEVFSRMDMLL 346

>Skud_4.641 Chr4 complement(1144004..1145044) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  538 bits (1386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/354 (73%), Positives = 302/354 (85%), Gaps = 18/354 (5%)

Query: 1   MSTLQRRRVNRSDSNEGETVSGGKTAAAPSASNDAEEY----------EETSGPTRKVAY 50
           MSTLQRRRVNR+DS        G T++  S SN+              ++ SG  +K+AY
Sbjct: 1   MSTLQRRRVNRADS--------GDTSSMQSMSNNDNSKGDKIANIGIDDDDSGANKKIAY 52

Query: 51  DPEEAKLRDNYTVPKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCIMIELALRKKIR 110
           DPEE+KLRDN  +P LTLMEEVLLMGLRDREGYLSFWND+ISYALRGCI+IELALR KIR
Sbjct: 53  DPEESKLRDNIKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIR 112

Query: 111 ILDDSARKRFDISERLVEVVDGSKTGEVLLDETLQLMKNDEPLTIANWIDLLSGETWNLM 170
           ILDDSARKRFD+SERLVEVVDGSKTGEVLLDETLQLMKNDEPLTI+NWIDLLSGETWNL+
Sbjct: 113 ILDDSARKRFDLSERLVEVVDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLL 172

Query: 171 KINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSTVVSR 230
           KINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP+ D+SCKEAIKRR+LS +VSR
Sbjct: 173 KINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSR 232

Query: 231 NMELSFNSYFPESTSFKYIRTVALVCSTYGASVLENVLSSLDYEQRDRAVSRAEELLEKF 290
           NMELS+N YFPE+TSFK IRT+AL+C +YGA+VLENVL++L+YE+RD+A++RAEE++ +F
Sbjct: 233 NMELSYNEYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAINRAEEIMAQF 292

Query: 291 GQYPFDLEKQGDSGISCNLNKEAQREVDESPNSALYLEVVAGVIEVFSRMDMLL 344
            QYPFDLEK+ + G+S NLNKE + E++ +    L LEV+AGV EVFSRMDMLL
Sbjct: 293 SQYPFDLEKETELGVSVNLNKEVKEEIENNTGHDLQLEVIAGVFEVFSRMDMLL 346

>TDEL0D02590 Chr4 (497351..498343) [993 bp, 330 aa] {ON} Anc_5.442
           YDR372C
          Length = 330

 Score =  523 bits (1348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/344 (74%), Positives = 297/344 (86%), Gaps = 14/344 (4%)

Query: 1   MSTLQRRRVNRSDSNEGETVSGGKTAAAPSASNDAEEYEETSGPTRKVAYDPEEAKLRDN 60
           MS LQRRRVNR DS +              +S  A E+ ET+  +++VAYDPEEAK+ +N
Sbjct: 1   MSNLQRRRVNRVDSGD-------------ESSLQASEFNETT-TSKRVAYDPEEAKITEN 46

Query: 61  YTVPKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCIMIELALRKKIRILDDSARKRF 120
              PKLTLMEEVLL+GLRD+EGYLSFWNDNISYALRGCI+IELALR KIRI+DDSARKRF
Sbjct: 47  VKNPKLTLMEEVLLLGLRDKEGYLSFWNDNISYALRGCIIIELALRGKIRIIDDSARKRF 106

Query: 121 DISERLVEVVDGSKTGEVLLDETLQLMKNDEPLTIANWIDLLSGETWNLMKINYQLKQVR 180
           D+SERL+EVVD SKTGEVLLDETLQLMK DEPLTIANWIDLLSGETWNL+KINYQLKQVR
Sbjct: 107 DVSERLIEVVDASKTGEVLLDETLQLMKYDEPLTIANWIDLLSGETWNLLKINYQLKQVR 166

Query: 181 ERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSTVVSRNMELSFNSYF 240
           ERLAKGLVDKGVLRTEMKNFFLFDMATHPVTD+SCKEA+KRR+LS +VSRNMELS+N YF
Sbjct: 167 ERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDTSCKEALKRRVLSVLVSRNMELSYNEYF 226

Query: 241 PESTSFKYIRTVALVCSTYGASVLENVLSSLDYEQRDRAVSRAEELLEKFGQYPFDLEKQ 300
           P++TSFK IRT+AL+C +Y A+VLENVL+SLDYE+RDRA+SRA+E+LE++ QYPFDL+K 
Sbjct: 227 PDTTSFKLIRTIALICGSYRANVLENVLTSLDYEKRDRALSRADEILEQYTQYPFDLDKA 286

Query: 301 GDSGISCNLNKEAQREVDESPNSALYLEVVAGVIEVFSRMDMLL 344
            +SG+S NLNKE + E+ ++ +  L LEVVAGV EVFSRMDMLL
Sbjct: 287 TESGLSINLNKEVKEELSQNKDCPLQLEVVAGVFEVFSRMDMLL 330

>CAGL0A02926g Chr1 complement(304789..305775) [987 bp, 328 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372c
          Length = 328

 Score =  518 bits (1333), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/344 (73%), Positives = 292/344 (84%), Gaps = 16/344 (4%)

Query: 1   MSTLQRRRVNRSDSNEGETVSGGKTAAAPSASNDAEEYEETSGPTRKVAYDPEEAKLRDN 60
           MSTLQRRRVN+S++                ASN  E+ E+    + K+AYDPEE+KL+++
Sbjct: 1   MSTLQRRRVNKSEN----------------ASNGIEDREDDGTSSGKIAYDPEESKLQND 44

Query: 61  YTVPKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCIMIELALRKKIRILDDSARKRF 120
              P LTLMEEVLLMGLRDREGYLSFWND+ISYALRGCI+IELALR KIRILD  AR RF
Sbjct: 45  SKQPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRNKIRILDAPARMRF 104

Query: 121 DISERLVEVVDGSKTGEVLLDETLQLMKNDEPLTIANWIDLLSGETWNLMKINYQLKQVR 180
           DISERL+EV+D SKTGEVLLDETLQLM NDEPL+IANWIDLLSGETWNL+KINYQLKQVR
Sbjct: 105 DISERLIEVIDSSKTGEVLLDETLQLMVNDEPLSIANWIDLLSGETWNLLKINYQLKQVR 164

Query: 181 ERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSTVVSRNMELSFNSYF 240
           ERLAKGLVDKGVLRTEMKNFFLFDMATHPV+DSSCKEAIKRRILS +VSRNME+S+NSYF
Sbjct: 165 ERLAKGLVDKGVLRTEMKNFFLFDMATHPVSDSSCKEAIKRRILSVLVSRNMEISYNSYF 224

Query: 241 PESTSFKYIRTVALVCSTYGASVLENVLSSLDYEQRDRAVSRAEELLEKFGQYPFDLEKQ 300
           PEST+FK IRTV+L+   YGA+VLENV+SSL+Y++RD+A++RAEE+L +F QYPFDL+K+
Sbjct: 225 PESTNFKLIRTVSLIAGAYGANVLENVISSLEYDKRDKAITRAEEILAQFSQYPFDLQKE 284

Query: 301 GDSGISCNLNKEAQREVDESPNSALYLEVVAGVIEVFSRMDMLL 344
              GIS NLNKE Q E++ +P S L LEV+AGV EVFSRMDMLL
Sbjct: 285 SKDGISVNLNKELQEELESNPGSDLKLEVIAGVFEVFSRMDMLL 328

>SAKL0G02706g Chr7 complement(222134..223132) [999 bp, 332 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 332

 Score =  514 bits (1325), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/344 (72%), Positives = 292/344 (84%), Gaps = 12/344 (3%)

Query: 1   MSTLQRRRVNRSDSNEGETVSGGKTAAAPSASNDAEEYEETSGPTRKVAYDPEEAKLRDN 60
           MS LQRRRVNR++S+  E          P  S+D+ +    +   RKVAYDPEEAKL++N
Sbjct: 1   MSGLQRRRVNRTNSDYAEQ---------PITSSDSND---ENAKDRKVAYDPEEAKLKEN 48

Query: 61  YTVPKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCIMIELALRKKIRILDDSARKRF 120
            TVPKLTLMEEVLLMGL+D+EGYLSFWNDNISYALRGCI+IELALR KIR+LDD ARKRF
Sbjct: 49  TTVPKLTLMEEVLLMGLKDKEGYLSFWNDNISYALRGCILIELALRDKIRVLDDPARKRF 108

Query: 121 DISERLVEVVDGSKTGEVLLDETLQLMKNDEPLTIANWIDLLSGETWNLMKINYQLKQVR 180
           D+S+RL+EV+DGSKTGEVLLDE L L+KNDEPL IANWIDLLSGETWNL+KINYQLKQVR
Sbjct: 109 DVSDRLIEVIDGSKTGEVLLDEALNLIKNDEPLPIANWIDLLSGETWNLLKINYQLKQVR 168

Query: 181 ERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSTVVSRNMELSFNSYF 240
           ERLAKGLVDKGVLRTEMKNFFLFDMATHP+TD+SCKEAIKRR+LS +VSRNMEL++N YF
Sbjct: 169 ERLAKGLVDKGVLRTEMKNFFLFDMATHPITDTSCKEAIKRRVLSVLVSRNMELNYNEYF 228

Query: 241 PESTSFKYIRTVALVCSTYGASVLENVLSSLDYEQRDRAVSRAEELLEKFGQYPFDLEKQ 300
            E+ +FK IRT++L+C  YGA+VLENVL+SLDY++RDRA SRA+E+L +F ++PF L+K 
Sbjct: 229 SENITFKIIRTLSLICGAYGANVLENVLASLDYDKRDRAFSRADEILAQFSEFPFALDKA 288

Query: 301 GDSGISCNLNKEAQREVDESPNSALYLEVVAGVIEVFSRMDMLL 344
            +SGIS NLNKE Q E+ ++P   L LEVVAGV EVFSRMD LL
Sbjct: 289 TESGISVNLNKEVQAEIAQNPGKDLQLEVVAGVFEVFSRMDTLL 332

>Kwal_55.21399 s55 (820851..821840) [990 bp, 329 aa] {ON} YDR372C
           (VPS74) -  [contig 130] FULL
          Length = 329

 Score =  509 bits (1311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/344 (71%), Positives = 290/344 (84%), Gaps = 15/344 (4%)

Query: 1   MSTLQRRRVNRSDSNEGETVSGGKTAAAPSASNDAEEYEETSGPTRKVAYDPEEAKLRDN 60
           MS LQRRRVN+S+SN           + P  S +AE      G +++VAYDPEEA L+DN
Sbjct: 1   MSGLQRRRVNKSESNYD---------SEPVISEEAE------GESKRVAYDPEEAMLKDN 45

Query: 61  YTVPKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCIMIELALRKKIRILDDSARKRF 120
            T+PKL LMEEVLLMGL+D+EGYLSFWNDNISYALRGCI+IELALR KI++++DSARKRF
Sbjct: 46  ATIPKLNLMEEVLLMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVVNDSARKRF 105

Query: 121 DISERLVEVVDGSKTGEVLLDETLQLMKNDEPLTIANWIDLLSGETWNLMKINYQLKQVR 180
           D+SERLVEV++ +KTGEVLLDE L LMKNDEPLTIANWIDLLSGETWN MKI+YQLKQVR
Sbjct: 106 DVSERLVEVINATKTGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVR 165

Query: 181 ERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSTVVSRNMELSFNSYF 240
           ERLAKGLVDKGVLRTEMKNFFLFDM THP+TD+SCKEAIKRRILS +VSRNM+L++N YF
Sbjct: 166 ERLAKGLVDKGVLRTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYF 225

Query: 241 PESTSFKYIRTVALVCSTYGASVLENVLSSLDYEQRDRAVSRAEELLEKFGQYPFDLEKQ 300
           P S SFK +RT++L+C  YGA+VLENVL SLDYE+RDRA SRA+E+L +F Q+PF L+KQ
Sbjct: 226 PASVSFKLLRTLSLICGAYGANVLENVLCSLDYEKRDRAFSRADEILAQFSQFPFALDKQ 285

Query: 301 GDSGISCNLNKEAQREVDESPNSALYLEVVAGVIEVFSRMDMLL 344
            ++GIS N+NKE Q E+D + ++ L LEVVAGV EVFSRMD LL
Sbjct: 286 TETGISVNINKEMQEEIDANSDALLRLEVVAGVFEVFSRMDTLL 329

>KLTH0F15884g Chr6 (1292767..1293756) [990 bp, 329 aa] {ON} highly
           similar to uniprot|Q06385 Saccharomyces cerevisiae
           YDR372C VPS74
          Length = 329

 Score =  507 bits (1305), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/344 (71%), Positives = 286/344 (83%), Gaps = 15/344 (4%)

Query: 1   MSTLQRRRVNRSDSNEGETVSGGKTAAAPSASNDAEEYEETSGPTRKVAYDPEEAKLRDN 60
           MS LQRRRVN+S+S                +S D    +ET G  ++VAYDPEEAKLRD+
Sbjct: 1   MSGLQRRRVNKSES---------------ISSQDPVVNDETDGEGKRVAYDPEEAKLRDD 45

Query: 61  YTVPKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCIMIELALRKKIRILDDSARKRF 120
            T PKL LMEEVLLMGL+D+EGYLSFWNDNISYALRGCI+IELALR KI++L+D ARKRF
Sbjct: 46  TTTPKLNLMEEVLLMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVLNDPARKRF 105

Query: 121 DISERLVEVVDGSKTGEVLLDETLQLMKNDEPLTIANWIDLLSGETWNLMKINYQLKQVR 180
           D+SERLVEV++ +KTGEVLLDE L LMKNDEPLTIANWIDLLSGETWN MKI+YQLKQVR
Sbjct: 106 DVSERLVEVINATKTGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVR 165

Query: 181 ERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSTVVSRNMELSFNSYF 240
           ERLAKGLVDKGVLRTEMKNFFLFDM THP+TD+SCKEAIKRRILS +VSRNM+L++N YF
Sbjct: 166 ERLAKGLVDKGVLRTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYF 225

Query: 241 PESTSFKYIRTVALVCSTYGASVLENVLSSLDYEQRDRAVSRAEELLEKFGQYPFDLEKQ 300
           P S  FK IRT++L+C  YGA+VLENVLSSLDYE+RDRA SRA+E+L +F Q+PF L+KQ
Sbjct: 226 PSSVRFKLIRTLSLICGAYGANVLENVLSSLDYEKRDRAFSRADEILAQFSQFPFALDKQ 285

Query: 301 GDSGISCNLNKEAQREVDESPNSALYLEVVAGVIEVFSRMDMLL 344
            ++GIS NLNKE Q EV  + +++L LE VAGV EVFSRMD LL
Sbjct: 286 TETGISVNLNKEVQEEVVSNQDASLQLECVAGVFEVFSRMDTLL 329

>NCAS0F03430 Chr6 complement(690870..691868) [999 bp, 332 aa] {ON}
           Anc_5.442 YDR372C
          Length = 332

 Score =  504 bits (1299), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/346 (71%), Positives = 292/346 (84%), Gaps = 16/346 (4%)

Query: 1   MSTLQRRRVNRSDS-NEGETVSGGKTAAAPSASNDAEEYEETSGPTRKVAYDPEEAKLRD 59
           MSTLQRRRVN+ DS NE  +V+       P+   D++          KVAYDPEEA++R+
Sbjct: 1   MSTLQRRRVNKDDSDNETGSVT-------PNVERDSDN-------DNKVAYDPEEARMRN 46

Query: 60  -NYTVPKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCIMIELALRKKIRILDDSARK 118
               VP LTLMEEVLLMGLRD+EGYLSFWNDNISYALRGCI+IELALR KI+ILDDSARK
Sbjct: 47  VGGQVPVLTLMEEVLLMGLRDKEGYLSFWNDNISYALRGCILIELALRGKIQILDDSARK 106

Query: 119 RFDISERLVEVVDGSKTGEVLLDETLQLMKNDEPLTIANWIDLLSGETWNLMKINYQLKQ 178
           RF++SERLV+V+DG+KTGEVLLDETLQLMKNDEPL+IA+WIDLLSGETWN+MKINYQLKQ
Sbjct: 107 RFELSERLVQVIDGTKTGEVLLDETLQLMKNDEPLSIASWIDLLSGETWNIMKINYQLKQ 166

Query: 179 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSTVVSRNMELSFNS 238
           VRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRR+LS +VSRNMELS+N+
Sbjct: 167 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRVLSILVSRNMELSYNN 226

Query: 239 YFPESTSFKYIRTVALVCSTYGASVLENVLSSLDYEQRDRAVSRAEELLEKFGQYPFDLE 298
           YFPE+T FK IRT+AL+C  YGA+VLEN+L SLD+E  D A++RA+EL+ +F ++PFDLE
Sbjct: 227 YFPETTRFKIIRTIALICGAYGANVLENLLGSLDFEMSDNAIARADELIAQFSKFPFDLE 286

Query: 299 KQGDSGISCNLNKEAQREVDESPNSALYLEVVAGVIEVFSRMDMLL 344
                GIS NLN+E Q+E+ ++P   L LEV+AGVIEVFSRMD LL
Sbjct: 287 TPTALGISVNLNREVQQELADTPGYDLQLEVIAGVIEVFSRMDTLL 332

>TBLA0A06480 Chr1 (1593225..1594229) [1005 bp, 334 aa] {ON}
           Anc_5.442 YDR372C
          Length = 334

 Score =  504 bits (1297), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 244/345 (70%), Positives = 290/345 (84%), Gaps = 12/345 (3%)

Query: 1   MSTLQRRRVN-RSDSNEGETVSGGKTAAAPSASNDAEEYEETSGPTRKVAYDPEEAKLRD 59
           MSTLQRRR   RSDS            ++ + SND E        +R+VAYDPEE K+R+
Sbjct: 1   MSTLQRRRKQARSDS----------VGSSGTDSNDNEPTNR-QAESRRVAYDPEEDKIRN 49

Query: 60  NYTVPKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCIMIELALRKKIRILDDSARKR 119
           N +VP+LTLMEEV+L+GLRD+EGYLSFWNDNISYALRGCI+IELALR KIRILDD ARKR
Sbjct: 50  NMSVPQLTLMEEVVLLGLRDKEGYLSFWNDNISYALRGCIIIELALRGKIRILDDPARKR 109

Query: 120 FDISERLVEVVDGSKTGEVLLDETLQLMKNDEPLTIANWIDLLSGETWNLMKINYQLKQV 179
           F++SERLVEVVD SKTGEVLLDE LQ+M+NDEPL I+NW+DLLSGETWN+ KINYQLKQV
Sbjct: 110 FELSERLVEVVDSSKTGEVLLDEALQIMRNDEPLAISNWVDLLSGETWNVFKINYQLKQV 169

Query: 180 RERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSTVVSRNMELSFNSY 239
           RER++KGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILS +V+R  E ++N Y
Sbjct: 170 RERISKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSILVNRTAEFTYNDY 229

Query: 240 FPESTSFKYIRTVALVCSTYGASVLENVLSSLDYEQRDRAVSRAEELLEKFGQYPFDLEK 299
           FPE+TSFKYIRT++L+CS YGA+VLENVL+SL+Y++RD  ++RAEELLE+F QYPFDLEK
Sbjct: 230 FPETTSFKYIRTISLICSAYGANVLENVLNSLEYQKRDNGLNRAEELLEQFSQYPFDLEK 289

Query: 300 QGDSGISCNLNKEAQREVDESPNSALYLEVVAGVIEVFSRMDMLL 344
           Q + G S NLN   + E++  P +AL+LEVVAGV EVFS+MD+LL
Sbjct: 290 QTEFGTSINLNALVKEEIEADPKNALFLEVVAGVFEVFSKMDLLL 334

>Kpol_1016.2 s1016 (4946..5932) [987 bp, 328 aa] {ON} (4946..5932)
           [987 nt, 329 aa]
          Length = 328

 Score =  503 bits (1296), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 242/344 (70%), Positives = 289/344 (84%), Gaps = 16/344 (4%)

Query: 1   MSTLQRRRVNRSDSNEGETVSGGKTAAAPSASNDAEEYEETSGPTRKVAYDPEEAKLRDN 60
           MS+LQRRR+NR +S+  E+            SND EE  +++    K+AYDPEEAKL+D+
Sbjct: 1   MSSLQRRRLNRINSDTAES------------SNDDEERSKST----KIAYDPEEAKLKDD 44

Query: 61  YTVPKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCIMIELALRKKIRILDDSARKRF 120
            TVP LTLMEEV+L+GL D++GYLSFWNDNISY LRGCI+IELALR KIRILDD ARKRF
Sbjct: 45  VTVPTLTLMEEVVLLGLGDKDGYLSFWNDNISYTLRGCIIIELALRNKIRILDDPARKRF 104

Query: 121 DISERLVEVVDGSKTGEVLLDETLQLMKNDEPLTIANWIDLLSGETWNLMKINYQLKQVR 180
           D+SERLVEVVDGSKTGEVLLDE LQLMKNDEPL+IANWIDLLSGETWN  KINYQLKQVR
Sbjct: 105 DLSERLVEVVDGSKTGEVLLDEALQLMKNDEPLSIANWIDLLSGETWNFFKINYQLKQVR 164

Query: 181 ERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSTVVSRNMELSFNSYF 240
           ER++KGLVDKGVLRTEMKNFFLFDMATHPVTD+SCKEAIKRRILS +VSR MEL++N YF
Sbjct: 165 ERISKGLVDKGVLRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSALVSRTMELNYNEYF 224

Query: 241 PESTSFKYIRTVALVCSTYGASVLENVLSSLDYEQRDRAVSRAEELLEKFGQYPFDLEKQ 300
           PE+T +K IRT+AL+CS+Y A+VLENVLSSL+YE+RD A++R+E +L +F QYPF L+K 
Sbjct: 225 PETTQYKVIRTIALICSSYAANVLENVLSSLEYEKRDNAIARSESILSEFAQYPFKLDKA 284

Query: 301 GDSGISCNLNKEAQREVDESPNSALYLEVVAGVIEVFSRMDMLL 344
            D  +S NL+K  + E+ ++P SAL LE VAGV +VFS+MDM+L
Sbjct: 285 SDIKVSINLSKLVEDEIAQNPGSALQLEAVAGVFDVFSKMDMIL 328

>ZYRO0F10208g Chr6 complement(824737..825735) [999 bp, 332 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 332

 Score =  502 bits (1292), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 248/344 (72%), Positives = 284/344 (82%), Gaps = 12/344 (3%)

Query: 1   MSTLQRRRVNRSDSNEGETVSGGKTAAAPSASNDAEEYEETSGPTRKVAYDPEEAKLRDN 60
           MS LQRRRVNR DS      SG      P+   +A+E       ++KVAYDPEE KL DN
Sbjct: 1   MSGLQRRRVNRVDS------SGSNNE--PTRGLEAQE----DSSSKKVAYDPEEVKLTDN 48

Query: 61  YTVPKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCIMIELALRKKIRILDDSARKRF 120
             VPKLTLMEEVLL+GLRD+EGYLSFWNDNISYALRGCI+IELALR KIR++DDSARKRF
Sbjct: 49  VEVPKLTLMEEVLLLGLRDKEGYLSFWNDNISYALRGCIVIELALRGKIRVVDDSARKRF 108

Query: 121 DISERLVEVVDGSKTGEVLLDETLQLMKNDEPLTIANWIDLLSGETWNLMKINYQLKQVR 180
           D+SERL+EV D SKTGEVLLDE LQLMK DEPL+I NWIDLLSGETWN +KINYQLKQVR
Sbjct: 109 DVSERLIEVTDSSKTGEVLLDEALQLMKCDEPLSITNWIDLLSGETWNPLKINYQLKQVR 168

Query: 181 ERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSTVVSRNMELSFNSYF 240
           ERLAKGLVDKGVLRTEMKNFFLFDMATHPVTD+SCKEAIKRRILS +V RN+EL++N YF
Sbjct: 169 ERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSVLVPRNLELNYNDYF 228

Query: 241 PESTSFKYIRTVALVCSTYGASVLENVLSSLDYEQRDRAVSRAEELLEKFGQYPFDLEKQ 300
            E  SFK IRT+AL+C  Y A+VLENVL+SL YE+RD A+ RA+E+L++F +YPFDL+ Q
Sbjct: 229 SERVSFKLIRTIALICGAYRANVLENVLTSLGYEKRDNAIGRADEILKQFSEYPFDLDTQ 288

Query: 301 GDSGISCNLNKEAQREVDESPNSALYLEVVAGVIEVFSRMDMLL 344
            +SGIS NLNKE  +E+ + P S L LEV+AGV EVFSRMDMLL
Sbjct: 289 TESGISINLNKEVGQELQQHPESTLQLEVLAGVFEVFSRMDMLL 332

>NDAI0B05720 Chr2 complement(1391179..1392276) [1098 bp, 365 aa]
           {ON} Anc_5.442 YDR372C
          Length = 365

 Score =  496 bits (1276), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 249/365 (68%), Positives = 292/365 (80%), Gaps = 21/365 (5%)

Query: 1   MSTLQRRRVNRSDSNEG----ETVSGGKTAAAPSASNDAEEYEETSGPTRKVAYDPEEAK 56
           MSTLQRRR  +  SN+G    ++ +   +    S +++       +  + K+AYDPEEAK
Sbjct: 1   MSTLQRRRRPQDGSNKGMVDVDSDNNDSSRILGSNNSNNNVSNSNTFGSSKIAYDPEEAK 60

Query: 57  L-----------------RDNYTVPKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCI 99
           L                  +N   P LTLMEEVLLMGLRD+EGYLSFWNDNISYALRGCI
Sbjct: 61  LLNNNNINNNNSGSNSRGGNNAVTPTLTLMEEVLLMGLRDKEGYLSFWNDNISYALRGCI 120

Query: 100 MIELALRKKIRILDDSARKRFDISERLVEVVDGSKTGEVLLDETLQLMKNDEPLTIANWI 159
           +IELALR KIRILDDSARKRFD+SERL+EV DGSKTGEVLLDETLQLMKNDEPLTIANWI
Sbjct: 121 LIELALRGKIRILDDSARKRFDLSERLIEVKDGSKTGEVLLDETLQLMKNDEPLTIANWI 180

Query: 160 DLLSGETWNLMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAI 219
           DLLSGETWN+MKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAI
Sbjct: 181 DLLSGETWNIMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAI 240

Query: 220 KRRILSTVVSRNMELSFNSYFPESTSFKYIRTVALVCSTYGASVLENVLSSLDYEQRDRA 279
           KRR+LS +VSRNME ++N YFP++T FK IRT+AL+C  YGA+VLENVLSSLDYE+ D A
Sbjct: 241 KRRVLSVLVSRNMEFNYNEYFPQNTFFKIIRTIALICGAYGANVLENVLSSLDYEKSDNA 300

Query: 280 VSRAEELLEKFGQYPFDLEKQGDSGISCNLNKEAQREVDESPNSALYLEVVAGVIEVFSR 339
           ++RA+EL+ +F ++PFDLEK  ++ +S NLN+  Q+E+DE+P   L LEV+AGVIEVFSR
Sbjct: 301 IARADELIAQFSKFPFDLEKTTNTNVSVNLNRLVQQELDENPGYDLQLEVIAGVIEVFSR 360

Query: 340 MDMLL 344
           MD LL
Sbjct: 361 MDTLL 365

>KLLA0E02355g Chr5 complement(217222..218196) [975 bp, 324 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 324

 Score =  487 bits (1254), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 231/342 (67%), Positives = 279/342 (81%), Gaps = 19/342 (5%)

Query: 3   TLQRRRVNRSDSNEGETVSGGKTAAAPSASNDAEEYEETSGPTRKVAYDPEEAKLRDNYT 62
           +LQRRRVN+ D+ E          + P   N+ +          K+ YD +EAKLRDN +
Sbjct: 2   SLQRRRVNKGDTTE----------SIPQIDNEHDH---------KIVYDEQEAKLRDNTS 42

Query: 63  VPKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCIMIELALRKKIRILDDSARKRFDI 122
           VPKLTLMEEVLLMGL+D++GYLSFWNDNISYALRGCI+IELALR KIR +DD ARKR+D+
Sbjct: 43  VPKLTLMEEVLLMGLKDKQGYLSFWNDNISYALRGCILIELALRGKIRCVDDPARKRYDV 102

Query: 123 SERLVEVVDGSKTGEVLLDETLQLMKNDEPLTIANWIDLLSGETWNLMKINYQLKQVRER 182
           SERL+EV+DGSKTGEVLLDE+L LMKND P +I  WIDLLSGETWNL+KINYQLKQVRER
Sbjct: 103 SERLIEVIDGSKTGEVLLDESLSLMKNDPPTSIVGWIDLLSGETWNLLKINYQLKQVRER 162

Query: 183 LAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSTVVSRNMELSFNSYFPE 242
           LAKGLVDKGVLRTEMKNFFLFDMATHP+TD++CKE+IKRRILS +VSRN EL++N+YFP+
Sbjct: 163 LAKGLVDKGVLRTEMKNFFLFDMATHPITDTTCKESIKRRILSILVSRNAELTYNTYFPQ 222

Query: 243 STSFKYIRTVALVCSTYGASVLENVLSSLDYEQRDRAVSRAEELLEKFGQYPFDLEKQGD 302
             SFKYIRT++L+C  YGA+VLENVL++LDYE RD   +RA+E+L +F ++PF L+KQ  
Sbjct: 223 DVSFKYIRTLSLICGAYGANVLENVLATLDYEVRDTGFARADEILAQFSEFPFPLDKQTS 282

Query: 303 SGISCNLNKEAQREVDESPNSALYLEVVAGVIEVFSRMDMLL 344
           +G+S NLNKE  +E++  P S L LEVVAGV EVFSRMD LL
Sbjct: 283 TGVSVNLNKEISQELNNHPGSDLQLEVVAGVFEVFSRMDTLL 324

>ACL165C Chr3 complement(66499..67494) [996 bp, 331 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR372C
          Length = 331

 Score =  474 bits (1220), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 233/342 (68%), Positives = 280/342 (81%), Gaps = 12/342 (3%)

Query: 3   TLQRRRVNRSDSNEGETVSGGKTAAAPSASNDAEEYEETSGPTRKVAYDPEEAKLRDNYT 62
           +LQRRRVN++  NE  TV G       ++ N ++E E   G T KVAYDPEE KLR+N  
Sbjct: 2   SLQRRRVNKTAGNE--TVGG-------ASLNRSDEEE---GMTHKVAYDPEEQKLRENTR 49

Query: 63  VPKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCIMIELALRKKIRILDDSARKRFDI 122
            P LTLMEEVLLMGL+D+EGYLSF N+NISYALRGCI+IELALR +I+++DD+ R+RFD 
Sbjct: 50  EPTLTLMEEVLLMGLKDKEGYLSFLNENISYALRGCILIELALRGRIQVVDDAMRRRFDP 109

Query: 123 SERLVEVVDGSKTGEVLLDETLQLMKNDEPLTIANWIDLLSGETWNLMKINYQLKQVRER 182
           SERL+EVVDGSKTGE LLDE L LMK  EPLTI NW+DLLSGETWN +KINYQL+QVRER
Sbjct: 110 SERLIEVVDGSKTGEALLDEALTLMKGSEPLTIVNWMDLLSGETWNFLKINYQLRQVRER 169

Query: 183 LAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSTVVSRNMELSFNSYFPE 242
           LAKGLVDKGVLRTEMKNFFLFDM THPV D+SCKE+IKRRILS +V RN+EL +   FPE
Sbjct: 170 LAKGLVDKGVLRTEMKNFFLFDMPTHPVADTSCKESIKRRILSVLVPRNVELQYTELFPE 229

Query: 243 STSFKYIRTVALVCSTYGASVLENVLSSLDYEQRDRAVSRAEELLEKFGQYPFDLEKQGD 302
           + +FKY+RT+AL+CS +GA+VLE VLS+LDYE+RDR  SRAEELL +F QYPF L+K  +
Sbjct: 230 TVAFKYLRTIALICSAHGANVLEKVLSTLDYEKRDRGFSRAEELLVQFSQYPFALDKDIE 289

Query: 303 SGISCNLNKEAQREVDESPNSALYLEVVAGVIEVFSRMDMLL 344
           +GIS NLN+  Q E+D +P +AL LEVVAGV++V+SRMD LL
Sbjct: 290 TGISVNLNRLVQEELDRNPGTALNLEVVAGVLKVYSRMDDLL 331

>Ecym_4513 Chr4 complement(1023828..1024829) [1002 bp, 333 aa] {ON}
           similar to Ashbya gossypii ACL165C
          Length = 333

 Score =  473 bits (1216), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 228/342 (66%), Positives = 278/342 (81%), Gaps = 10/342 (2%)

Query: 3   TLQRRRVNRSDSNEGETVSGGKTAAAPSASNDAEEYEETSGPTRKVAYDPEEAKLRDNYT 62
           +LQRRRVN+++         G T+   +     E+  E    + KVAYDPE+ KLR+N  
Sbjct: 2   SLQRRRVNKAEV--------GGTSVELTQRKHGED--EDDKGSHKVAYDPEDQKLRENTK 51

Query: 63  VPKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCIMIELALRKKIRILDDSARKRFDI 122
            P LTLMEEVLLMGL+D+EGYLSFWND+ISY+LRGCI+IELALR KIR+++D+ARKRFD+
Sbjct: 52  EPTLTLMEEVLLMGLKDKEGYLSFWNDSISYSLRGCILIELALRGKIRVVEDAARKRFDL 111

Query: 123 SERLVEVVDGSKTGEVLLDETLQLMKNDEPLTIANWIDLLSGETWNLMKINYQLKQVRER 182
           SERLVEV++ SKTGE LLDETL LMK++EPL+I NWIDLLSGETWNL+KI+YQLKQVRER
Sbjct: 112 SERLVEVIETSKTGEALLDETLSLMKSNEPLSIVNWIDLLSGETWNLLKISYQLKQVRER 171

Query: 183 LAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSTVVSRNMELSFNSYFPE 242
           LAKGLVDKGVLRTEMKNFFLFDMATHPV DSSCKE+IKRR+LS +V RN+ L +  YFPE
Sbjct: 172 LAKGLVDKGVLRTEMKNFFLFDMATHPVADSSCKESIKRRMLSVLVPRNVSLDYTEYFPE 231

Query: 243 STSFKYIRTVALVCSTYGASVLENVLSSLDYEQRDRAVSRAEELLEKFGQYPFDLEKQGD 302
           S +FKY+RT+AL+C  YGA+VLENVLSSLDYE+R+R  SRAEE+L +F QYPF L+K  +
Sbjct: 232 SVAFKYLRTIALICGAYGANVLENVLSSLDYEKRERGFSRAEEILTQFSQYPFALDKDVE 291

Query: 303 SGISCNLNKEAQREVDESPNSALYLEVVAGVIEVFSRMDMLL 344
           +GIS NL  + + E+ ++P + L LEVVAGV EVFSRMD  L
Sbjct: 292 TGISVNLYNQVKEEIGKNPGTGLQLEVVAGVFEVFSRMDNFL 333

>TPHA0J02610 Chr10 complement(579213..580202) [990 bp, 329 aa] {ON}
           Anc_5.442 YDR372C
          Length = 329

 Score =  471 bits (1211), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 225/344 (65%), Positives = 279/344 (81%), Gaps = 15/344 (4%)

Query: 1   MSTLQRRRVNRSDSNEGETVSGGKTAAAPSASNDAEEYEETSGPTRKVAYDPEEAKLRDN 60
           MS +QRRR+NR  SNE E+              D  + +++     KVA+DPEEAK++D+
Sbjct: 1   MSGVQRRRINRI-SNEDES--------------DHSDNDQSRSNVSKVAFDPEEAKIKDD 45

Query: 61  YTVPKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCIMIELALRKKIRILDDSARKRF 120
            +VPKLTLMEEV+L+GL D EGYLSFWNDNISY LRGCI+IELALR KIRI+DDSARK F
Sbjct: 46  VSVPKLTLMEEVVLLGLGDSEGYLSFWNDNISYVLRGCILIELALRGKIRIIDDSARKSF 105

Query: 121 DISERLVEVVDGSKTGEVLLDETLQLMKNDEPLTIANWIDLLSGETWNLMKINYQLKQVR 180
           D+SERL+EV+D SKTGEVLLDETLQLMKNDEP +I +WIDLLSGETWN  K+NYQLKQVR
Sbjct: 106 DLSERLIEVIDASKTGEVLLDETLQLMKNDEPQSIVSWIDLLSGETWNFFKVNYQLKQVR 165

Query: 181 ERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSTVVSRNMELSFNSYF 240
           ERL+KGLVDKGVLRTEMKNFFLFDMATHPV DSSCKE++KRRI+ST+V R + L +N YF
Sbjct: 166 ERLSKGLVDKGVLRTEMKNFFLFDMATHPVADSSCKESLKRRIMSTLVDRTLSLQYNEYF 225

Query: 241 PESTSFKYIRTVALVCSTYGASVLENVLSSLDYEQRDRAVSRAEELLEKFGQYPFDLEKQ 300
           PEST+FK IRTV+L+ + Y A+VLENVL++L+YE+RD+A+SRAE LL  FG YPF L  +
Sbjct: 226 PESTTFKVIRTVSLIITAYSANVLENVLNTLEYEKRDKALSRAENLLNNFGNYPFKLVNE 285

Query: 301 GDSGISCNLNKEAQREVDESPNSALYLEVVAGVIEVFSRMDMLL 344
            D+ IS NLN+  + E+  +P +AL LEV+AGV +VF++MD+++
Sbjct: 286 PDNRISINLNQLVEDEIKANPKTALQLEVLAGVFDVFAKMDVII 329

>Kpol_1062.24 s1062 (55671..56501) [831 bp, 276 aa] {ON}
           (55671..56501) [831 nt, 277 aa]
          Length = 276

 Score =  346 bits (888), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 158/273 (57%), Positives = 211/273 (77%)

Query: 69  MEEVLLMGLRDREGYLSFWNDNISYALRGCIMIELALRKKIRILDDSARKRFDISERLVE 128
           MEEV+L+G+RD+EGYLSFWN+N+S+ LRGCI+IELA R  I+++DD +RKRFD+S+RL+E
Sbjct: 1   MEEVVLLGMRDKEGYLSFWNENLSFVLRGCILIELAFRGNIQVIDDPSRKRFDLSDRLIE 60

Query: 129 VVDGSKTGEVLLDETLQLMKNDEPLTIANWIDLLSGETWNLMKINYQLKQVRERLAKGLV 188
           VV+  KTGE LLDETLQ+MK++E  +I+ WIDLLSGETWN+ KIN QLKQVRER++KGLV
Sbjct: 61  VVNPKKTGEFLLDETLQMMKSEESQSISTWIDLLSGETWNIFKINLQLKQVRERISKGLV 120

Query: 189 DKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSTVVSRNMELSFNSYFPESTSFKY 248
           DKG+LRTEMKNFFLFDMATHPV D  CKE IK+RILS ++ +   +  + YFPE+   + 
Sbjct: 121 DKGILRTEMKNFFLFDMATHPVEDLKCKEMIKKRILSVLLPQTAVILADEYFPETVQLRC 180

Query: 249 IRTVALVCSTYGASVLENVLSSLDYEQRDRAVSRAEELLEKFGQYPFDLEKQGDSGISCN 308
           +RT+AL+ S Y  SVLENV S LDY+++D    R  E+L++   YPF+ + +  + I+ N
Sbjct: 181 LRTIALILSAYAGSVLENVASDLDYQKKDDLFVRTSEILDQSSVYPFEFDNKSSTNIATN 240

Query: 309 LNKEAQREVDESPNSALYLEVVAGVIEVFSRMD 341
           LN+  + E+ +  N  L LE +AGV EVF +MD
Sbjct: 241 LNQLVENELSKDKNLNLKLETIAGVFEVFLKMD 273

>TBLA0A02780 Chr1 (670848..672011) [1164 bp, 387 aa] {ON} Anc_5.442
           YDR372C
          Length = 387

 Score =  335 bits (860), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 153/304 (50%), Positives = 218/304 (71%), Gaps = 1/304 (0%)

Query: 42  SGPTRKVAYDPEEAKLRDNYTVPKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCIMI 101
           +G      +DPEE+   +   +P L LMEE++L+GL+D++GYLSFWNDNISY LRGCI+I
Sbjct: 84  NGKHHLTKFDPEESISNNEIILPPLNLMEEIVLLGLKDKQGYLSFWNDNISYVLRGCILI 143

Query: 102 ELALRKKIRILDDSARKRFDISERLVEVV-DGSKTGEVLLDETLQLMKNDEPLTIANWID 160
           ELALRKKI+++DD  R  +D+S R++EVV   +KTG  LLDE L +M  + P +I NWID
Sbjct: 144 ELALRKKIKVIDDPVRNMYDVSARIIEVVMPITKTGNHLLDEALNMMAKERPESIMNWID 203

Query: 161 LLSGETWNLMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIK 220
           LLSGETWN+ K N QLK VRER++KGLVDKG+L+    NF  FDM+THP+ D   KE++K
Sbjct: 204 LLSGETWNVFKNNLQLKNVRERVSKGLVDKGILKNNTSNFLFFDMSTHPLVDIGSKESVK 263

Query: 221 RRILSTVVSRNMELSFNSYFPESTSFKYIRTVALVCSTYGASVLENVLSSLDYEQRDRAV 280
           +RI S +V ++  L +N+YFPE+ +FK IR++ L+C  YGA VL++ L +++Y+  D A 
Sbjct: 264 QRIFSILVPKHSYLLYNNYFPENVTFKIIRSLCLICCAYGADVLDDTLLTMNYDDSDNAF 323

Query: 281 SRAEELLEKFGQYPFDLEKQGDSGISCNLNKEAQREVDESPNSALYLEVVAGVIEVFSRM 340
            +AE+L E    +P +L+++  SG+  ++ K+ Q E+ +    +LYLEVVAGV++V  RM
Sbjct: 324 KKAEKLFETISDFPINLDQREGSGVPVDIIKDLQSELLQHSGESLYLEVVAGVLQVILRM 383

Query: 341 DMLL 344
           D LL
Sbjct: 384 DSLL 387

>NCAS0H02090 Chr8 complement(405561..406598) [1038 bp, 345 aa] {ON}
           Anc_5.442 YDR372C
          Length = 345

 Score =  219 bits (558), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 111/286 (38%), Positives = 180/286 (62%), Gaps = 13/286 (4%)

Query: 64  PKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCIMIELALRKKIRILDDSARKR-FDI 122
           P+LTLM+E+ L+ L+D+EGY+S W+  +SY LR C++IELALR KI+ + +  +K+    
Sbjct: 63  PELTLMDELFLLALKDKEGYVSDWDGKLSYVLRCCVIIELALRGKIQAVAEGKKKKDLAP 122

Query: 123 SERLVEVVDGSKTGEVLLDETLQLMKNDEP-LTIANWIDLLSGETWNLMKINYQLKQVRE 181
            E  +EV+DGS TG+ LLD+TL LMK ++   ++++WI LLSGE+ N +K +YQL  VR+
Sbjct: 123 HECKIEVIDGSITGDPLLDQTLGLMKKEKKNYSVSHWIKLLSGESMNFLKASYQLLHVRK 182

Query: 182 RLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSTVVSRNMELSFNSYFP 241
           R+ + LV+ G+L  + K      + THP+ D  CK AI+ R+   + +  ++L    YFP
Sbjct: 183 RIERILVETGILSKQTKKLAAIGLDTHPIKDIKCKNAIRSRMQYILTANKVDLPSTKYFP 242

Query: 242 ESTSFKYIRTVALVCSTYGASVLENVLSSLDYEQRDRAV---SRAEELLEKFGQYPFDLE 298
           ++ S++ +RT+ L C+ YGA +L+       ++  +  V    RA  LL  F ++PF+L 
Sbjct: 243 DTVSYRVLRTIVLACAAYGADILDKGF----FQTENETVIGKGRARVLLSLFSKFPFEL- 297

Query: 299 KQGDSGISCNLNKEAQREVDESPNSALYLEVVAGVIEVFSRMDMLL 344
              +  +  +LN++  +E+ E P  A  LEVVAG I+V + +D +L
Sbjct: 298 ---NQAVQPDLNEKVSKELHEHPEEASQLEVVAGAIDVINTIDTVL 340

>Skud_5.48 Chr5 (71966..73519) [1554 bp, 517 aa] {ON} YEL042W (REAL)
          Length = 517

 Score = 35.0 bits (79), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 40/101 (39%), Gaps = 18/101 (17%)

Query: 84  LSFWNDNISYALRGCIMIELALRKKIRILDDSARKR--------------FDISERLVEV 129
           L F  DN+    RGC  + +     +RI+ D+  K+              F I+E  V +
Sbjct: 150 LDFAVDNVPLKARGCTPVAVRATAGLRIIGDAKSKKILTAVTNHLEKDYPFPIAEGSVSI 209

Query: 130 VDGSKTGEVLLDETLQLMKN----DEPLTIANWIDLLSGET 166
           +DG + G      T  L+KN       L  A   DL  G T
Sbjct: 210 MDGDEEGVFAWITTNYLLKNIGTEGAKLPTAAVFDLGGGST 250

>KAFR0C05110 Chr3 (1013807..1016482) [2676 bp, 891 aa] {ON} Anc_7.39
           YOR353C
          Length = 891

 Score = 33.9 bits (76), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 42/72 (58%), Gaps = 8/72 (11%)

Query: 110 RILDDS-ARKRFDISERLVEVVDGSKTGEVLLDETLQLMKNDEPLTIANWIDLLSG-ETW 167
           ++L DS A K  D+++   + +D SK    +LDE LQL+ N++PL +  ++  +   +TW
Sbjct: 725 QVLTDSLASKIRDLTDTCCQAMDLSK----ILDERLQLLLNNDPLIVEKYLSTVEKLKTW 780

Query: 168 NLMKINYQLKQV 179
              KIN  LK +
Sbjct: 781 E--KINAFLKSI 790

>CAGL0K00110g Chr11 complement(3332..5830) [2499 bp, 832 aa] {ON}
           some similarities with uniprot|Q08294 Saccharomyces
           cerevisiae YOL155c
          Length = 832

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 64/147 (43%), Gaps = 20/147 (13%)

Query: 133 SKTGEVLLDETLQLM----KNDEPLTIANWIDLLSGETWNLMKINYQLKQ--VRERLAKG 186
           + T E+   ET+       +ND P+ I N    +    + L K+N    +  +  R+  G
Sbjct: 345 TTTNELGFSETVSFYSTYNENDIPV-IGNTTIYVPPAIYTLTKVNENTTETDIISRVT-G 402

Query: 187 LVDKGVLRTEMKNFFLFDMATHPVTDS-SCKEAIKRRILSTVVSRNMELSFNSYFPESTS 245
           +   G+  T      + +M T  VT + +  E   R   +T++SRN   SF++Y P S+S
Sbjct: 403 MGYNGLPFTYYTTITVGEMETGVVTKTITITENKSRSTKTTLMSRNYTFSFSNYSPISSS 462

Query: 246 FKYIRTVALVCSTYGASVLENVLSSLD 272
                       TY  S ++N+ +  D
Sbjct: 463 -----------GTYSVSTVDNITTLTD 478

>ZYRO0E04224g Chr5 (317895..321641) [3747 bp, 1248 aa] {ON}
           conserved hypothetical protein
          Length = 1248

 Score = 31.2 bits (69), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 21/34 (61%)

Query: 88  NDNISYALRGCIMIELALRKKIRILDDSARKRFD 121
           NDNI +    C +I   + ++IR+LDD++   F+
Sbjct: 311 NDNIPFRALSCAVIFFTMNEQIRLLDDTSGSTFE 344

>KLTH0E09504g Chr5 complement(860113..861270) [1158 bp, 385 aa] {ON}
           similar to uniprot|P40208 Saccharomyces cerevisiae
           YMR135C GID8 Protein of unknown function involved in
           proteasome-dependent catabolite inactivation of
           fructose-1 6-bisphosphatase contains LisH and CTLH
           domains like Vid30p
          Length = 385

 Score = 30.8 bits (68), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 16/21 (76%)

Query: 247 KYIRTVALVCSTYGASVLENV 267
           + +  + L+CST+GA VLENV
Sbjct: 111 RILEAIELICSTFGAQVLENV 131

>SAKL0C06556g Chr3 (611209..613509) [2301 bp, 766 aa] {ON} similar
           to uniprot|P47014 Saccharomyces cerevisiae YJL132W
           Hypothetical ORF
          Length = 766

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 34/72 (47%)

Query: 201 FLFDMATHPVTDSSCKEAIKRRILSTVVSRNMELSFNSYFPESTSFKYIRTVALVCSTYG 260
           FL  + TH VTD+S    ++      ++S   +L F+  F ++ +F  +    LV     
Sbjct: 103 FLVGVFTHQVTDASWHSLVRHHETHGMISVLSQLEFDGDFEQAHTFADVMGDFLVLGDVL 162

Query: 261 ASVLENVLSSLD 272
            +VL+N L   D
Sbjct: 163 VTVLDNWLYYTD 174

>ZYRO0F07172g Chr6 (579706..581226) [1521 bp, 506 aa] {ON} conserved
           hypothetical protein
          Length = 506

 Score = 30.8 bits (68), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 25/40 (62%)

Query: 91  ISYALRGCIMIELALRKKIRILDDSARKRFDISERLVEVV 130
           IS+AL+  I  E+ + K++  ++D  RK F +  R V+++
Sbjct: 245 ISFALKNLITEEIEVNKEVSQVNDGQRKEFLVPRRFVDLL 284

>TPHA0L00860 Chr12 (169610..171196) [1587 bp, 528 aa] {ON} Anc_8.379
           YDR179W-A
          Length = 528

 Score = 30.8 bits (68), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 5/80 (6%)

Query: 170 MKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSTVVS 229
           MK+N+ L Q+ +++A    +K +    +  F LFD+  H  T      A   R+ S +V 
Sbjct: 349 MKLNFDLNQINKKMATNRKEKSIFEYYLPTFILFDIF-HLNTKYPFIYAF-IRVASHIVR 406

Query: 230 RNMELSFNSYFPESTSFKYI 249
               + F +Y   + +F YI
Sbjct: 407 ---SIPFLNYLLNALTFTYI 423

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,985,456
Number of extensions: 1477637
Number of successful extensions: 5443
Number of sequences better than 10.0: 43
Number of HSP's gapped: 5601
Number of HSP's successfully gapped: 43
Length of query: 344
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 234
Effective length of database: 40,868,139
Effective search space: 9563144526
Effective search space used: 9563144526
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)