Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0B040705.473ON37337318430.0
CAGL0I07227g5.473ON36836315620.0
NDAI0C014105.473ON36937315610.0
YOR136W (IDH2)5.473ON36937315580.0
Smik_15.3165.473ON36937315540.0
Suva_8.1885.473ON36937315500.0
Skud_15.3005.473ON36937315360.0
SAKL0G03520g5.473ON36937315360.0
Ecym_23135.473ON37037315360.0
NCAS0H022505.473ON42237315250.0
KLLA0E03125g5.473ON36837315110.0
AFR137C5.473ON36737315040.0
Kpol_440.125.473ON36837314990.0
KAFR0B063705.473ON37837814970.0
KLTH0F15048g5.473ON36837314760.0
TDEL0A033705.473ON37137314740.0
Kwal_55.212735.473ON36837314700.0
TBLA0B022405.473ON37337514630.0
Kpol_543.85.473ON36836214210.0
TPHA0J027705.473ON37637714190.0
ZYRO0D11220g5.473ON36837313620.0
TPHA0E014805.473ON37735912411e-171
Smik_14.2902.278ON3603716987e-89
ADL223W2.278ON3623766928e-88
YNL037C (IDH1)2.278ON3603716902e-87
Skud_14.2932.278ON3613716883e-87
ZYRO0D02838g2.278ON3613746883e-87
Ecym_33162.278ON3623766859e-87
NDAI0B035902.278ON3593716743e-85
KLLA0F04103g2.278ON3613456719e-85
KLTH0G10186g2.278ON3603746701e-84
TBLA0B069102.278ON3653696683e-84
SAKL0E07876g2.278ON3613736622e-83
Kwal_23.50122.278ON3613786604e-83
Kpol_1039.352.278ON3593716561e-82
TPHA0D015602.278ON3603716483e-81
NCAS0B062902.278ON3593646473e-81
KNAG0A052802.278ON3613456387e-80
CAGL0G02673g2.278ON3583456371e-79
KAFR0J014102.278ON3503756309e-79
TDEL0C038402.278ON3613756301e-78
Suva_14.3022.278ON3003135415e-66
NDAI0B035502.287ON3723534055e-45
NCAS0B062502.287ON3733524021e-44
Kpol_1003.392.287ON3703944012e-44
TBLA0B059402.287ON3693943984e-44
CAGL0G02585g2.287ON3723523985e-44
YIL094C (LYS12)2.287ON3713603932e-43
KNAG0A054202.287ON3723603932e-43
Suva_9.1052.287ON3713603907e-43
ADL214C2.287ON3673663871e-42
ZYRO0A01914g2.287ON3683523862e-42
SAKL0E07656g2.287ON3683523862e-42
Smik_9.852.287ON3713603845e-42
Skud_9.792.287ON3713603836e-42
KAFR0J013602.287ON3733513784e-41
TDEL0G021802.287ON3693523774e-41
KLLA0E08339g2.287ON3693923766e-41
TPHA0C034102.287ON3713913741e-40
Ecym_33262.287ON3663663722e-40
KLTH0G10384g2.287ON3673913592e-38
Kwal_27.115282.287ON3673583495e-37
Ecym_12961.402ON3632762283e-20
TDEL0B060001.402ON3623582274e-20
AAL012C1.402ON3723512241e-19
Skud_3.431.402ON3643592204e-19
TBLA0C015001.402ON3653592187e-19
Smik_3.661.402ON3643622161e-18
NDAI0G042301.402ON3633572142e-18
ZYRO0E04796g1.402ON3622682142e-18
YCL018W (LEU2)1.402ON3643552133e-18
KLLA0D04906g1.402ON3623572125e-18
Suva_3.31.402ON3643592081e-17
TPHA0B037301.402ON3653581992e-16
NCAS0C048701.402ON3653571974e-16
Kwal_0.2251.402ON3643561966e-16
Kpol_1048.631.402ON3643071904e-15
KLTH0H12188g1.402ON3643541904e-15
KAFR0I022001.402ON3653581904e-15
SAKL0D08690g1.402ON3642681887e-15
KNAG0I012801.402ON4473541852e-14
CAGL0H03795g1.402ON3653581833e-14
Suva_14.303singletonON53511189e-08
TDEL0C032507.461ON107850741.5
TBLA0F004108.155ON2676179713.1
TPHA0A014408.352ON88397713.2
TDEL0A042205.559ON1334136695.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0B04070
         (373 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {O...   714   0.0  
CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {...   606   0.0  
NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {O...   605   0.0  
YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subun...   604   0.0  
Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136...   603   0.0  
Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W ...   601   0.0  
Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136...   596   0.0  
SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly...   596   0.0  
Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}...   596   0.0  
NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473    592   0.0  
KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly...   586   0.0  
AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON} S...   583   0.0  
Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON} (32084..3...   582   0.0  
KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa] ...   581   0.0  
KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]...   573   0.0  
TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.4...   572   0.0  
Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {...   570   0.0  
TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {O...   568   0.0  
Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON} (21411..22...   551   0.0  
TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2....   551   0.0  
ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly...   529   0.0  
TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {O...   482   e-171
Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037...   273   7e-89
ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic ho...   271   8e-88
YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON} ...   270   2e-87
Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037...   269   3e-87
ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} simila...   269   3e-87
Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar t...   268   9e-87
NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {O...   264   3e-85
KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON} unipro...   263   9e-85
KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly...   262   1e-84
TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON}            261   3e-84
SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {...   259   2e-83
Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C...   258   4e-83
Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa] ...   257   1e-82
TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {O...   254   3e-81
NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa] ...   253   3e-81
KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON}              250   7e-80
CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {...   249   1e-79
KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {...   247   9e-79
TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {O...   247   1e-78
Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C...   213   5e-66
NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.2...   160   5e-45
NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON} Anc_2...   159   1e-44
Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {O...   159   2e-44
TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa] ...   157   4e-44
CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly...   157   5e-44
YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}  ...   155   2e-43
KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON}              155   2e-43
Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON...   154   7e-43
ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON} S...   153   1e-42
ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {...   153   2e-42
SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly...   153   2e-42
Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}...   152   5e-42
Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}...   152   6e-42
KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2....   150   4e-41
TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {O...   149   4e-41
KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly...   149   6e-41
TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {O...   148   1e-40
Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}...   147   2e-40
KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {...   142   2e-38
Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094...   139   5e-37
Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar t...    92   3e-20
TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON} Anc_1...    92   4e-20
AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON} S...    91   1e-19
Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)    89   4e-19
TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {O...    89   7e-19
Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)    88   1e-18
NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa] ...    87   2e-18
ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON} unipro...    87   2e-18
YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}  LEU2Beta-iso...    87   3e-18
KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly...    86   5e-18
Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)       85   1e-17
TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {O...    81   2e-16
NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {O...    80   4e-16
Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W (L...    80   6e-16
Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON} (1820...    78   4e-15
KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} high...    78   4e-15
KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.4...    78   4e-15
SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {...    77   7e-15
KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {O...    76   2e-14
CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}              75   3e-14
Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C ...    50   9e-08
TDEL0C03250 Chr3 complement(573410..576646) [3237 bp, 1078 aa] {...    33   1.5  
TBLA0F00410 Chr6 complement(95724..103754) [8031 bp, 2676 aa] {O...    32   3.1  
TPHA0A01440 Chr1 (281826..284477) [2652 bp, 883 aa] {ON} Anc_8.3...    32   3.2  
TDEL0A04220 Chr1 complement(748109..752113) [4005 bp, 1334 aa] {...    31   5.6  

>KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  714 bits (1843), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/373 (95%), Positives = 355/373 (95%)

Query: 1   MLRNSLLRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVK 60
           MLRNSLLRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVK
Sbjct: 1   MLRNSLLRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVK 60

Query: 61  DIFKAAEVPINWEFCDVTPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNL 120
           DIFKAAEVPINWEFCDVTPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNL
Sbjct: 61  DIFKAAEVPINWEFCDVTPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNL 120

Query: 121 TLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180
           TLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT
Sbjct: 121 TLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180

Query: 181 RDASERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELI 240
           RDASERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELI
Sbjct: 181 RDASERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELI 240

Query: 241 DNTVLNVVSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFEAVH 300
           DNTVLNVVSNPAGYTDAVSVCPNLYGDI                  ANIGNEISIFEAVH
Sbjct: 241 DNTVLNVVSNPAGYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGNEISIFEAVH 300

Query: 301 GSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSA 360
           GSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSA
Sbjct: 301 GSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSA 360

Query: 361 TTSSFTDAVIKNL 373
           TTSSFTDAVIKNL
Sbjct: 361 TTSSFTDAVIKNL 373

>CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2 isocitrate dehydrogenase
          Length = 368

 Score =  606 bits (1562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/363 (81%), Positives = 322/363 (88%), Gaps = 3/363 (0%)

Query: 11  FTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVKDIFKAAEVPI 70
             ARRFLAT+   QPSIGRFTGKPNP+TGKF VSFIEGDGIGPEIS SVK IF+AA+VP+
Sbjct: 9   LNARRFLATA---QPSIGRFTGKPNPSTGKFTVSFIEGDGIGPEISSSVKRIFQAADVPV 65

Query: 71  NWEFCDVTPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNLTLRKTFNLFA 130
            WE CDVTPIFVNGLTTIPDPAV SINKNL+ALKGPLATPIGKGHRSLNLTLRKTFNLFA
Sbjct: 66  EWETCDVTPIFVNGLTTIPDPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTFNLFA 125

Query: 131 NVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITRDASERVIRY 190
           NVRPAKSIEGFKTTY +VDLVLIRENTEGEYSGIEH+V+PGVVQSIKLITRDASERVIRY
Sbjct: 126 NVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHLVSPGVVQSIKLITRDASERVIRY 185

Query: 191 AFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELIDNTVLNVVSN 250
           A+EYA+AIGRPR++VVHKSTIQRLADGLFVNVAKEL+ EYP+I+LETELIDNT LNVVSN
Sbjct: 186 AYEYARAIGRPRLIVVHKSTIQRLADGLFVNVAKELAAEYPDIQLETELIDNTCLNVVSN 245

Query: 251 PAGYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFEAVHGSAPDIAGQN 310
           P+ YTDAVSVCPNLYGDI                  ANIG+++SIFEAVHGSAPDIAGQN
Sbjct: 246 PSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGQN 305

Query: 311 KANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVI 370
           KANPTALLLSSVMMLNHMG+ + A RIE+AVL TIA  S+ RTGDLGGSA+T+SFTDA+I
Sbjct: 306 KANPTALLLSSVMMLNHMGMTEHADRIEKAVLGTIAGGSEYRTGDLGGSASTTSFTDAII 365

Query: 371 KNL 373
           K L
Sbjct: 366 KKL 368

>NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {ON}
           Anc_5.473
          Length = 369

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/373 (80%), Positives = 328/373 (87%), Gaps = 4/373 (1%)

Query: 1   MLRNSLLRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVK 60
           M RN +LRN  T RRFL  SVKNQPSIG+FTGKPNP+TGKF VSFIEGDGIGPEISQSVK
Sbjct: 1   MFRNIILRN--TTRRFL--SVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVK 56

Query: 61  DIFKAAEVPINWEFCDVTPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNL 120
            IF AA+VPI+WE CDV+P+F+NGLTTIP+PAV SINKNL+ALKGPLATPIGKGHRSLNL
Sbjct: 57  QIFDAAKVPIDWEPCDVSPLFINGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNL 116

Query: 121 TLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180
           TLRKTF LFANVRPAKSIEGFKT Y +VDLV+IRENTEGEYSGIEHVV PGVVQSIKLIT
Sbjct: 117 TLRKTFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLIT 176

Query: 181 RDASERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELI 240
           RDASERVIRYA+EYA+AIGRPRV+VVHKSTIQRLADGLFV+VAKELS+EYP+I+LETELI
Sbjct: 177 RDASERVIRYAYEYARAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQEYPDIQLETELI 236

Query: 241 DNTVLNVVSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFEAVH 300
           DNTVLNVVSNP+ Y++AVSVCPNLYGDI                  ANIG+E+SIFEAVH
Sbjct: 237 DNTVLNVVSNPSSYSNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHEVSIFEAVH 296

Query: 301 GSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSA 360
           GSAPDIAGQNKANPTALLLSSVMMLNHMGL + A +IE+AVL+TIAS  + RTGDL G A
Sbjct: 297 GSAPDIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKA 356

Query: 361 TTSSFTDAVIKNL 373
           TTSSFTDAVI  L
Sbjct: 357 TTSSFTDAVIGRL 369

>YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subunit
           of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle;
           phosphorylated
          Length = 369

 Score =  604 bits (1558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/373 (80%), Positives = 327/373 (87%), Gaps = 4/373 (1%)

Query: 1   MLRNSLLRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVK 60
           MLRN+  RN  T+RRFLAT VK QPSIGR+TGKPNP+TGK+ VSFIEGDGIGPEIS+SVK
Sbjct: 1   MLRNTFFRN--TSRRFLAT-VK-QPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVK 56

Query: 61  DIFKAAEVPINWEFCDVTPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNL 120
            IF AA VPI WE CDV+PIFVNGLTTIPDPAV SI KNL+ALKGPLATPIGKGHRSLNL
Sbjct: 57  KIFSAANVPIEWESCDVSPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNL 116

Query: 121 TLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180
           TLRKTF LFANVRPAKSIEGFKTTY +VDLVLIRENTEGEYSGIEH+V PGVVQSIKLIT
Sbjct: 117 TLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLIT 176

Query: 181 RDASERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELI 240
           RDASERVIRYAFEYA+AIGRPRV+VVHKSTIQRLADGLFVNVAKELSKEYP++ LETELI
Sbjct: 177 RDASERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDLTLETELI 236

Query: 241 DNTVLNVVSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFEAVH 300
           DN+VL VV+NP+ YTDAVSVCPNLYGDI                  ANIG++ISIFEAVH
Sbjct: 237 DNSVLKVVTNPSAYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVH 296

Query: 301 GSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSA 360
           GSAPDIAGQ+KANPTALLLSSVMMLNHMGL + A +I+ AVL+TIAS  +NRTGDL G+A
Sbjct: 297 GSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTA 356

Query: 361 TTSSFTDAVIKNL 373
           TTSSFT+AVIK L
Sbjct: 357 TTSSFTEAVIKRL 369

>Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  603 bits (1554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/373 (80%), Positives = 327/373 (87%), Gaps = 4/373 (1%)

Query: 1   MLRNSLLRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVK 60
           MLRN+  RN  T+RRFLAT VK QPSIG++TGKPNP+TGK+ VSFIEGDGIGPEIS+SVK
Sbjct: 1   MLRNTFFRN--TSRRFLAT-VK-QPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISKSVK 56

Query: 61  DIFKAAEVPINWEFCDVTPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNL 120
            IF AA VPI WEFCDV PIFVNGLTTIPDPAV SI KNL+ALKGPLATPIGKGHRSLNL
Sbjct: 57  KIFSAANVPIEWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNL 116

Query: 121 TLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180
           TLRKTF LFANVRPAKS+EGFKTTY +VDLVLIRENTEGEYSGIEH+V PGVVQSIKLIT
Sbjct: 117 TLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLIT 176

Query: 181 RDASERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELI 240
           RDASERVIRYAFEYA+AIGRPRV+VVHKSTIQRLADGLFVNVAKELSKEYP+I LETELI
Sbjct: 177 RDASERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDITLETELI 236

Query: 241 DNTVLNVVSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFEAVH 300
           DN+VL VV+NP+ YT+AVSVCPNLYGDI                  ANIG++ISIFEAVH
Sbjct: 237 DNSVLKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVH 296

Query: 301 GSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSA 360
           GSAPDIAGQ+KANPTALLLSSVMMLNHMGL + A +I+ AVL+TIAS  +NRTGDL G+A
Sbjct: 297 GSAPDIAGQDKANPTALLLSSVMMLNHMGLTNYADQIQNAVLSTIASGPENRTGDLAGAA 356

Query: 361 TTSSFTDAVIKNL 373
           TTSSFT+AVIK L
Sbjct: 357 TTSSFTEAVIKRL 369

>Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/373 (79%), Positives = 328/373 (87%), Gaps = 4/373 (1%)

Query: 1   MLRNSLLRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVK 60
           MLRN+ LRN  T+RRFL+T VK QPSIGR+TGKP+P+TG++ VSFIEGDGIGPEIS+SVK
Sbjct: 1   MLRNTFLRN--TSRRFLST-VK-QPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVK 56

Query: 61  DIFKAAEVPINWEFCDVTPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNL 120
            IF AA+VPINWEFCDV PIFVNGLTTIPDPAV SI KNL+ALKGPLATPIGKGHRSLNL
Sbjct: 57  KIFSAADVPINWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNL 116

Query: 121 TLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180
           TLRKTF LFANVRPAKSIEGFKTTY +VDLVLIRENTEGEYSGIEH+V PGVVQSIKLIT
Sbjct: 117 TLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLIT 176

Query: 181 RDASERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELI 240
           R+ASERVIRYAFEYA+AIGRPR++VVHKSTIQRLADGLFVNVAKELSKEYP+I  ETELI
Sbjct: 177 REASERVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELI 236

Query: 241 DNTVLNVVSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFEAVH 300
           DN VLNVV+NP+ YT+AVSVCPNLYGDI                  ANIG+++SIFEAVH
Sbjct: 237 DNKVLNVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVH 296

Query: 301 GSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSA 360
           GSAPDIAG++KANPTALLLSSVMMLNHMGL   A +I+ AVL+TIAS  +NRTGDL G+A
Sbjct: 297 GSAPDIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTA 356

Query: 361 TTSSFTDAVIKNL 373
           TTSSFT+AVIK L
Sbjct: 357 TTSSFTEAVIKRL 369

>Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/373 (79%), Positives = 325/373 (87%), Gaps = 4/373 (1%)

Query: 1   MLRNSLLRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVK 60
           MLR++L RN  T+RRFLAT VK QPSIGRFTGKPNP+TG++ VSFIEGDGIGPEIS+SVK
Sbjct: 1   MLRSNLFRN--TSRRFLAT-VK-QPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVK 56

Query: 61  DIFKAAEVPINWEFCDVTPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNL 120
            IF AA VPI WE CDV PIFVNGLTTIPD AV SI  NLIALKGPLATPIGKGHRSLNL
Sbjct: 57  KIFNAANVPIEWESCDVNPIFVNGLTTIPDAAVQSITNNLIALKGPLATPIGKGHRSLNL 116

Query: 121 TLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180
           TLRKTF LFANVRPAKS+EGFKTTY +VDLVLIRENTEGEYSGIEH+V PGVVQSIKLIT
Sbjct: 117 TLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLIT 176

Query: 181 RDASERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELI 240
           RDASERVIRYAFEYA+AIGRPRV+VVHKSTIQRLADGLFVNVAKELSKEYP+I LETELI
Sbjct: 177 RDASERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDIILETELI 236

Query: 241 DNTVLNVVSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFEAVH 300
           DN+VL VV+NP+ YT+AVSVCPNLYGDI                  ANIG++ISIFEAVH
Sbjct: 237 DNSVLKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVH 296

Query: 301 GSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSA 360
           GSAPDIAGQ+KANPTALLLSSVMMLNHMGL + A +I+ AVL+TIAS  +NRTGDL G+A
Sbjct: 297 GSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTA 356

Query: 361 TTSSFTDAVIKNL 373
           TTSSFT+AVIK L
Sbjct: 357 TTSSFTEAVIKRL 369

>SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 369

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/373 (77%), Positives = 324/373 (86%), Gaps = 4/373 (1%)

Query: 1   MLRNSLLRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVK 60
           MLR+ +LR     RRFL++  K QPSIGRFTGKPNP+TGK+ VSFIEGDG+GPEIS+SVK
Sbjct: 1   MLRSQVLRQ--LPRRFLSS--KKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVK 56

Query: 61  DIFKAAEVPINWEFCDVTPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNL 120
           DIF AAEVP+ WE CDVTP+F+NGLTTIP PAV SINKNLIALKGPLATPIGKGHRSLNL
Sbjct: 57  DIFAAAEVPVEWESCDVTPLFINGLTTIPQPAVDSINKNLIALKGPLATPIGKGHRSLNL 116

Query: 121 TLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180
           TLRKTF LFANVRPAKS+EGFKTTY +VDLVLIRENTEGEYSGIEHVV+PGVVQSIKLIT
Sbjct: 117 TLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLIT 176

Query: 181 RDASERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELI 240
           RDASERVIRYAFEYA+A+GRP+V+VVHKSTIQRLADGLFV+VAKELS EYP+I+L+ +L+
Sbjct: 177 RDASERVIRYAFEYARAVGRPKVMVVHKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLL 236

Query: 241 DNTVLNVVSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFEAVH 300
           DNTVLNVVSNP  Y D VSVCPNLYGDI                  ANIG+++SIFEAVH
Sbjct: 237 DNTVLNVVSNPGAYADTVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVH 296

Query: 301 GSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSA 360
           GSAPDIAGQNKANPTALLLSSVMMLNHMGL ++A  IE+AVL+TIAS  +NRT DL GSA
Sbjct: 297 GSAPDIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSA 356

Query: 361 TTSSFTDAVIKNL 373
           +TSSFT+AVIK L
Sbjct: 357 STSSFTEAVIKRL 369

>Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}
           similar to Ashbya gossypii AFR137C
          Length = 370

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/373 (77%), Positives = 321/373 (86%), Gaps = 3/373 (0%)

Query: 1   MLRNSLLRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVK 60
           M + S+ + S   RR+LA++ + QPSIGRFTGKPNP TGK+ VSFIEGDGIGPEISQSVK
Sbjct: 1   MFKQSIFKGS---RRYLASASRKQPSIGRFTGKPNPKTGKYTVSFIEGDGIGPEISQSVK 57

Query: 61  DIFKAAEVPINWEFCDVTPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNL 120
           DIF AA+VP+ WE+CDVTPIF+NGLTTIPDPAV SINKNL+ALKGPLATPIGKGHRSLNL
Sbjct: 58  DIFSAAKVPVEWEYCDVTPIFINGLTTIPDPAVQSINKNLVALKGPLATPIGKGHRSLNL 117

Query: 121 TLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180
           TLRKTF LFANVRPAKSIEGFKTTY +VDLVLIRENTEGEYSGIEHVV+PGVVQSIKLIT
Sbjct: 118 TLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLIT 177

Query: 181 RDASERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELI 240
           RDASERVIRYAFEYA+A+GRP+VVVVHKSTIQRLADGLFVNVA+E+ KEYP+I+L+ ELI
Sbjct: 178 RDASERVIRYAFEYARAVGRPKVVVVHKSTIQRLADGLFVNVAQEVGKEYPDIELQPELI 237

Query: 241 DNTVLNVVSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFEAVH 300
           DNTVLNVVS P  Y+D+V+VCPNLYGDI                  ANIG+ +SIFEAVH
Sbjct: 238 DNTVLNVVSKPEKYSDSVAVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVH 297

Query: 301 GSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSA 360
           GSAPDIAGQN ANPTALLLSSVMMLNHMGL + A +IE AVL T+AS  KNRT DL G+A
Sbjct: 298 GSAPDIAGQNCANPTALLLSSVMMLNHMGLHEHADQIESAVLATVASDKKNRTADLAGTA 357

Query: 361 TTSSFTDAVIKNL 373
           TTSSFT AVI+ L
Sbjct: 358 TTSSFTKAVIERL 370

>NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473
          Length = 422

 Score =  592 bits (1525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/373 (78%), Positives = 322/373 (86%), Gaps = 4/373 (1%)

Query: 1   MLRNSLLRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVK 60
           M R+S+LR   T RR L  SVK+QPSIG++TGKPNP+TGK+ VSFIEGDGIGPEIS SVK
Sbjct: 54  MFRSSILRT--TTRRLL--SVKHQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVK 109

Query: 61  DIFKAAEVPINWEFCDVTPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNL 120
            IF AA+VPI WE CDVTP+F++GLTTIP+PAV SINKNL+ALKGPLATPIGKGHRSLNL
Sbjct: 110 QIFSAAKVPIEWETCDVTPLFIDGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNL 169

Query: 121 TLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180
           TLRKTF LFANVRPA+S++GFKTTY +VDLVLIRENTEGEYSGIEHVV PGVVQSIKLIT
Sbjct: 170 TLRKTFGLFANVRPARSVKGFKTTYPNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLIT 229

Query: 181 RDASERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELI 240
           R+ASERVIRYAFEY +AIGRPR+VVVHKSTIQRL+DGLFVNVAKELSKEYP+I+ ETELI
Sbjct: 230 REASERVIRYAFEYCRAIGRPRLVVVHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELI 289

Query: 241 DNTVLNVVSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFEAVH 300
           DNTVL VVSNP+ YTDAVSVCPNLYGDI                   NIGNEISIFEAVH
Sbjct: 290 DNTVLKVVSNPSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSGNIGNEISIFEAVH 349

Query: 301 GSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSA 360
           GSAPDIAG+N ANPTALLLSSVMMLNHMGL   A +IE AVL+TIAS  ++RTGDL G+A
Sbjct: 350 GSAPDIAGKNMANPTALLLSSVMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTA 409

Query: 361 TTSSFTDAVIKNL 373
           TTS+FTDAVIK L
Sbjct: 410 TTSTFTDAVIKKL 422

>KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  586 bits (1511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/373 (77%), Positives = 320/373 (85%), Gaps = 5/373 (1%)

Query: 1   MLRNSLLRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVK 60
           M R S+++ S    RFLAT  K QPSIGR+TGKPNP TGK+ VSFIEGDG+GPEIS+SVK
Sbjct: 1   MFRQSIVKQSC---RFLAT--KKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVK 55

Query: 61  DIFKAAEVPINWEFCDVTPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNL 120
            IF AA+VPI WE CDV+PIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNL
Sbjct: 56  AIFSAAKVPIEWESCDVSPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNL 115

Query: 121 TLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180
           TLRKTF LFANVRPAKSIEG+KTTY +V+LVLIRENTEGEYSGIEHVVAPGVVQSIKLIT
Sbjct: 116 TLRKTFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 175

Query: 181 RDASERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELI 240
           +DASERVIRYAFEYA+A+ R +V+VVHKSTIQRLADGLFV+VAK+LS EYP+I+L+TEL+
Sbjct: 176 QDASERVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELL 235

Query: 241 DNTVLNVVSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFEAVH 300
           DNTVL  V +P  Y D V VCPNLYGDI                  ANIG+ +SIFEAVH
Sbjct: 236 DNTVLKTVQHPEAYDDVVVVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVH 295

Query: 301 GSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSA 360
           GSAPDIAGQNKANPTALLLSSVMMLNHMGL + A +IE+AVLTTIAS +KNRTGDLGGSA
Sbjct: 296 GSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSA 355

Query: 361 TTSSFTDAVIKNL 373
           +TSSFTDAVI+ L
Sbjct: 356 STSSFTDAVIERL 368

>AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR136W
           (IDH2)
          Length = 367

 Score =  583 bits (1504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/373 (76%), Positives = 323/373 (86%), Gaps = 6/373 (1%)

Query: 1   MLRNSLLRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVK 60
           MLR  L + S   RR+LA SV+ QPSIGR+ GKPN A GK+ VSFIEGDG+GPEISQSVK
Sbjct: 1   MLRQKLFQGS---RRWLA-SVR-QPSIGRYAGKPN-AAGKYTVSFIEGDGVGPEISQSVK 54

Query: 61  DIFKAAEVPINWEFCDVTPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNL 120
           DIF AA VP+ WE+CDVTP+ VNGLTTIP+PAVASINKNL+ALKGPLATPIGKGHRSLNL
Sbjct: 55  DIFSAASVPVEWEYCDVTPLLVNGLTTIPEPAVASINKNLVALKGPLATPIGKGHRSLNL 114

Query: 121 TLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180
           TLRKTF LFANVRPAKSIEG+KTTYSDVDLVLIRENTEGEYSGIEHVV+PGVVQSIKLIT
Sbjct: 115 TLRKTFGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLIT 174

Query: 181 RDASERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELI 240
           R+ASERVIRYAFEYA+ +GRP+VVVVHKSTIQRLADGLFVNVA+EL +EYP+I+L+TEL+
Sbjct: 175 REASERVIRYAFEYARTVGRPKVVVVHKSTIQRLADGLFVNVAQELGREYPDIELQTELL 234

Query: 241 DNTVLNVVSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFEAVH 300
           DNTVLNVV+ P  Y D V+VCPNLYGDI                  ANIG+++SIFEAVH
Sbjct: 235 DNTVLNVVTKPEAYKDVVAVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHQVSIFEAVH 294

Query: 301 GSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSA 360
           GSAPDIAGQN+ANPTALLLSSVMMLNHMGL + A RIE+AVL+TIASS +NRT DL G+A
Sbjct: 295 GSAPDIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTA 354

Query: 361 TTSSFTDAVIKNL 373
           +TSSFT+AVI+ L
Sbjct: 355 STSSFTNAVIERL 367

>Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON}
           (32084..33190) [1107 nt, 369 aa]
          Length = 368

 Score =  582 bits (1499), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/373 (75%), Positives = 321/373 (86%), Gaps = 5/373 (1%)

Query: 1   MLRNSLLRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVK 60
           MLRN++ R SF   R + T    QP+IGRFTGKPNP TGK+ V FIEGDG+GPEIS+SVK
Sbjct: 1   MLRNTIYRGSFA--RMMTTG---QPNIGRFTGKPNPVTGKYTVPFIEGDGVGPEISKSVK 55

Query: 61  DIFKAAEVPINWEFCDVTPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNL 120
           DIF AA+VPI WE CDV PIFVNGLTTIPD AV SINK+L+ALKGPLATPIGKGHRSLNL
Sbjct: 56  DIFAAAKVPIEWEPCDVGPIFVNGLTTIPDAAVQSINKHLVALKGPLATPIGKGHRSLNL 115

Query: 121 TLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180
           TLRKTFNLFANVRPA+S+  +KTTY +VDLVLIRENTEGEYSGIEHV++PGV+QSIKLIT
Sbjct: 116 TLRKTFNLFANVRPARSVPNYKTTYQNVDLVLIRENTEGEYSGIEHVISPGVIQSIKLIT 175

Query: 181 RDASERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELI 240
           +DASERVIRYAFEY +AIGRPR+VVVHKSTIQR+ADGLFVNVAKEL+ EYP+I+L+TELI
Sbjct: 176 KDASERVIRYAFEYTRAIGRPRLVVVHKSTIQRMADGLFVNVAKELASEYPDIELQTELI 235

Query: 241 DNTVLNVVSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFEAVH 300
           DNT+LNVV++P  YTDAVSVCPNLYGDI                  ANIG+++SIFEAVH
Sbjct: 236 DNTILNVVTHPESYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVH 295

Query: 301 GSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSA 360
           GSAPDIAGQNKANPTALLLSSVMMLNHMGL + A++IE A+L+TIAS S+NRTGDL G+A
Sbjct: 296 GSAPDIAGQNKANPTALLLSSVMMLNHMGLNEHATKIENAILSTIASGSENRTGDLAGTA 355

Query: 361 TTSSFTDAVIKNL 373
           TTSSFT+AVI  L
Sbjct: 356 TTSSFTEAVINKL 368

>KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa]
           {ON} Anc_5.473 YOR136W
          Length = 378

 Score =  581 bits (1497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/378 (76%), Positives = 320/378 (84%), Gaps = 5/378 (1%)

Query: 1   MLRNSLL---RNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQ 57
           MLR ++L   R +   +RFL+     QPSIGRFTGKP+ ATGK+ VSFIEGDGIGPEIS+
Sbjct: 1   MLRQAMLGRARYTIPTKRFLSMQAPRQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISR 60

Query: 58  SVKDIFKAAEVPINWEFCDVTPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRS 117
           SVKDIF+AA VPI WE CDV+PI V+GLTTIPD AV SINKNL+ LKGPLATPIGKGHRS
Sbjct: 61  SVKDIFQAASVPITWETCDVSPILVDGLTTIPDEAVKSINKNLVGLKGPLATPIGKGHRS 120

Query: 118 LNLTLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIK 177
           LNLTLRKTFNLFANVRPAKS+ GFKTTY +VDLVLIRENTEGEYSGIEHVV PGVVQSIK
Sbjct: 121 LNLTLRKTFNLFANVRPAKSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIK 180

Query: 178 LITRDASERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKELSKE--YPEIKL 235
           LITRDASERVIRYAFEYAKAIGRP+V+VVHKSTIQRL+DGLFVNVAKEL KE  +  I+L
Sbjct: 181 LITRDASERVIRYAFEYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIEL 240

Query: 236 ETELIDNTVLNVVSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISI 295
           +TELIDNTVLNVV NP+ Y+DAV VCPNLYGDI                  ANIG++ISI
Sbjct: 241 DTELIDNTVLNVVMNPSKYSDAVFVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKISI 300

Query: 296 FEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGD 355
           FEAVHGSAPDIAGQNKANPTALLLSSVMML+HMGL +   +IE AVL TIA+SSKNRTGD
Sbjct: 301 FEAVHGSAPDIAGQNKANPTALLLSSVMMLHHMGLNEYGDKIENAVLKTIAASSKNRTGD 360

Query: 356 LGGSATTSSFTDAVIKNL 373
           LGG+ATT+SFT+AVI NL
Sbjct: 361 LGGTATTTSFTEAVIDNL 378

>KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]
           {ON} highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136W IDH2 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 368

 Score =  573 bits (1476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/373 (74%), Positives = 319/373 (85%), Gaps = 5/373 (1%)

Query: 1   MLRNSLLRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVK 60
           M ++S +RNS    RFLAT  K QPSIGR+TGKP+PATGK+ VSFIEGDG+GPEIS++VK
Sbjct: 1   MFKSSFVRNS---ARFLAT--KKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVK 55

Query: 61  DIFKAAEVPINWEFCDVTPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNL 120
           DIF AA+ PI WE CDV+P+F+NGLTTIP PA  SINKNLIALKGPLATPIGKGHRSLNL
Sbjct: 56  DIFAAAKAPIQWESCDVSPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNL 115

Query: 121 TLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180
           TLRKTF LFANVRPAKS++G+KT Y +VDLVLIRENTEGEYSGIEHVV+PGVVQSIKLIT
Sbjct: 116 TLRKTFGLFANVRPAKSVQGYKTAYDNVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLIT 175

Query: 181 RDASERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELI 240
           +DASERVIRYAFEYA+A+ RP+VVVVHKSTIQRLADGLFV+VA++LSKEYP+I+L+TELI
Sbjct: 176 QDASERVIRYAFEYARAVERPKVVVVHKSTIQRLADGLFVSVAEQLSKEYPDIELQTELI 235

Query: 241 DNTVLNVVSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFEAVH 300
           DNTVL+ V +P  Y+D V VCPNLYGDI                  ANIG+++SIFEAVH
Sbjct: 236 DNTVLHTVRDPTKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHKVSIFEAVH 295

Query: 301 GSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSA 360
           GSAPDIAGQNKANPTALLLSSVMMLNHMGL + A +IE+AV TTIA+  ++RTGDLGGSA
Sbjct: 296 GSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFTTIAAGPESRTGDLGGSA 355

Query: 361 TTSSFTDAVIKNL 373
           +TSSF +AVI  L
Sbjct: 356 STSSFAEAVISRL 368

>TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.473
           YOR136W
          Length = 371

 Score =  572 bits (1474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/373 (73%), Positives = 318/373 (85%), Gaps = 2/373 (0%)

Query: 1   MLRNSLLRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVK 60
           MLR+ + R   T  R LA++   QPSIG++TGKP+P TGK+ VSFIEGDG+GPEIS+SVK
Sbjct: 1   MLRSQICRR--TVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVK 58

Query: 61  DIFKAAEVPINWEFCDVTPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNL 120
           DIF AA+VPI WE C VTP+ VNG+TTIP+ A  SIN+NL+ALKGPLATPIGKGHRS+NL
Sbjct: 59  DIFAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLVALKGPLATPIGKGHRSMNL 118

Query: 121 TLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180
           TLRKTF LFANVRPAKS+EGFKTTY DVDLVLIRENTEGEY+GIEHV+ PGVVQSIKLIT
Sbjct: 119 TLRKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLIT 178

Query: 181 RDASERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELI 240
           R+ASERVIRYA+EYA+A+GRP++VVVHKSTIQRLADGLFV VAKEL+ E+P+I+L+TELI
Sbjct: 179 REASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKELAHEFPDIQLQTELI 238

Query: 241 DNTVLNVVSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFEAVH 300
           DNTVLNVVSNP+ Y+D V VCPNLYGDI                   NIG+++SIFEAVH
Sbjct: 239 DNTVLNVVSNPSKYSDVVYVCPNLYGDILSDLNSGLSAGSLGLTPSGNIGHKVSIFEAVH 298

Query: 301 GSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSA 360
           GSAPDIAGQNKANPTALLLSSVMMLNHMGL + AS+IE+AVLTTIA+  ++RTGDL GSA
Sbjct: 299 GSAPDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSA 358

Query: 361 TTSSFTDAVIKNL 373
           +TSSFT+AVI  L
Sbjct: 359 STSSFTEAVISRL 371

>Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {ON}
           YOR136W (IDH2) - NAD+-dependent isocitrate dehydrogenase
           [contig 130] FULL
          Length = 368

 Score =  570 bits (1470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/373 (74%), Positives = 315/373 (84%), Gaps = 5/373 (1%)

Query: 1   MLRNSLLRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVK 60
           M R+   RN+    RF AT  K QPSIGR+TGKP+PATGK+ VSFIEGDG+GPEIS++VK
Sbjct: 1   MFRSQFGRNTL---RFFAT--KKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVK 55

Query: 61  DIFKAAEVPINWEFCDVTPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNL 120
           DIF AA+ PI WE CDVTP+F+NGLTTIP PA  SINKNLIALKGPLATPIGKGHRSLNL
Sbjct: 56  DIFAAAKAPIQWETCDVTPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNL 115

Query: 121 TLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180
           TLRKTF LFANVRPAKSI+GFKT Y +VDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT
Sbjct: 116 TLRKTFGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 175

Query: 181 RDASERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELI 240
           +DASERVIRYAFEYA+A+ RP+V+VVHKSTIQRLADGLFV+VA++L+KEYP+I+L+TELI
Sbjct: 176 QDASERVIRYAFEYARAVERPKVLVVHKSTIQRLADGLFVSVAEKLAKEYPDIELQTELI 235

Query: 241 DNTVLNVVSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFEAVH 300
           DNTVL+ V +P  Y+D V VCPNLYGDI                  ANIG+E+SIFEAVH
Sbjct: 236 DNTVLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVH 295

Query: 301 GSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSA 360
           GSAPDIAGQNKANPTALLLSSVMMLNHMGL + A +IE+AV +TIAS  +NRTGDL GSA
Sbjct: 296 GSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSA 355

Query: 361 TTSSFTDAVIKNL 373
           +TSSF +AVI  L
Sbjct: 356 STSSFAEAVISRL 368

>TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  568 bits (1463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/375 (73%), Positives = 319/375 (85%), Gaps = 4/375 (1%)

Query: 1   MLRNSLLRNSFTARRFLATS--VKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQS 58
           MLR    + S  ARR  +TS  ++    +G++ G PNP+TG+F V FIEGDG+GPEIS+S
Sbjct: 1   MLRTIAAKQS--ARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKS 58

Query: 59  VKDIFKAAEVPINWEFCDVTPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSL 118
           VKDIFKAA+VP++WE+CDV+P+ +NGLTTIP+PAV  INK+ IALKGPLATPIGKGHRSL
Sbjct: 59  VKDIFKAAQVPVDWEYCDVSPLLINGLTTIPEPAVQQINKHKIALKGPLATPIGKGHRSL 118

Query: 119 NLTLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKL 178
           NLTLRKTF LFANVRPA+SI G++TTY +VDLVLIRENTEGEYSGIEHVVAPGVVQSIKL
Sbjct: 119 NLTLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKL 178

Query: 179 ITRDASERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETE 238
           ITRDASERVIRYA+EYA+AIGRPR+VVVHKSTIQ+LADGLFVN+AKEL+ E+P+IKLETE
Sbjct: 179 ITRDASERVIRYAYEYARAIGRPRLVVVHKSTIQKLADGLFVNIAKELAPEFPDIKLETE 238

Query: 239 LIDNTVLNVVSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFEA 298
           LIDNTVLNVV +P  YTDAV+VCPNLYGDI                  ANIGNE+SIFEA
Sbjct: 239 LIDNTVLNVVRDPPSYTDAVTVCPNLYGDILSDLNSGLSAGSLGLTPSANIGNEVSIFEA 298

Query: 299 VHGSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGG 358
           VHGSAPDIAGQNKANPTALLLSS MMLN+MGL   +++IE A+L TIAS S+NRTGDL G
Sbjct: 299 VHGSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAG 358

Query: 359 SATTSSFTDAVIKNL 373
           +ATTSSFT++VIKNL
Sbjct: 359 TATTSSFTESVIKNL 373

>Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON}
           (21411..22517) [1107 nt, 369 aa]
          Length = 368

 Score =  551 bits (1421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/362 (74%), Positives = 307/362 (84%), Gaps = 3/362 (0%)

Query: 12  TARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVKDIFKAAEVPIN 71
           T  RFL+T    QPSIGRFTGKP+PATGKF V FIEGDG+GPEIS+SVK IF AA+VPI 
Sbjct: 10  TVSRFLST---GQPSIGRFTGKPDPATGKFTVPFIEGDGVGPEISESVKKIFSAAKVPIE 66

Query: 72  WEFCDVTPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNLTLRKTFNLFAN 131
           W  CDV PIFVNG TTIP+PAV  INK+LIALKGPLATPIGKGHRSLNLTLRKTFNLFAN
Sbjct: 67  WVPCDVGPIFVNGQTTIPEPAVELINKHLIALKGPLATPIGKGHRSLNLTLRKTFNLFAN 126

Query: 132 VRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITRDASERVIRYA 191
           VRPA+SI  +K+TY +VDLVLIRENTEGEYSGIEHV+ PGV+QSIKLITR+A+ERV+RYA
Sbjct: 127 VRPARSIPNYKSTYENVDLVLIRENTEGEYSGIEHVITPGVIQSIKLITREATERVVRYA 186

Query: 192 FEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELIDNTVLNVVSNP 251
           FEY +AIGRPR++V+HKSTIQR+ADGLFV VA+EL+ EYP+IKLETE+ID ++LNVVS P
Sbjct: 187 FEYTQAIGRPRLLVIHKSTIQRMADGLFVKVAEELASEYPDIKLETEIIDKSILNVVSKP 246

Query: 252 AGYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFEAVHGSAPDIAGQNK 311
             Y+DAVSVCPNLYGDI                  ANIG+++SIFEAVHGSAPDIAGQNK
Sbjct: 247 ELYSDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNK 306

Query: 312 ANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIK 371
           ANPTALLLSSVMML HMGL + A++IE AVLTTIAS S+NRT DL G+A+TSSFT+ VI+
Sbjct: 307 ANPTALLLSSVMMLKHMGLDEHANKIENAVLTTIASGSENRTADLSGTASTSSFTEEVIQ 366

Query: 372 NL 373
            L
Sbjct: 367 RL 368

>TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2.278
           YNL037C
          Length = 376

 Score =  551 bits (1419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/377 (71%), Positives = 314/377 (83%), Gaps = 5/377 (1%)

Query: 1   MLRNS--LLRNSFTARRFLAT--SVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEIS 56
           MLRN+  + + + T  + L +  S+ NQP+IGRFTGK N ++G + V FIEGDG+GPEIS
Sbjct: 1   MLRNTAAIAQKNTTLLKILGSTRSISNQPTIGRFTGKTN-SSGTYTVPFIEGDGVGPEIS 59

Query: 57  QSVKDIFKAAEVPINWEFCDVTPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHR 116
           +SVKDIF AA VPI W+ CDV PIFVNGLTTIP+PAV +I ++L+ALKGPLATP+GKGHR
Sbjct: 60  KSVKDIFSAANVPIQWQPCDVGPIFVNGLTTIPEPAVKAIKESLVALKGPLATPVGKGHR 119

Query: 117 SLNLTLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSI 176
           SLNLTLRKTF+LFANVRPAKS+  +K+TY +VDLVLIRENTEGEYSGIEH+V PGVVQSI
Sbjct: 120 SLNLTLRKTFDLFANVRPAKSVPNYKSTYENVDLVLIRENTEGEYSGIEHIVTPGVVQSI 179

Query: 177 KLITRDASERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLE 236
           KLITR+ASE+VIRYA+EYA A+GRPR++VVHKSTIQRL DGLFV +A EL  EYP IKLE
Sbjct: 180 KLITREASEKVIRYAYEYAIAVGRPRLIVVHKSTIQRLGDGLFVQIANELQSEYPSIKLE 239

Query: 237 TELIDNTVLNVVSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIF 296
           T+++DNTVLNVVSNP  Y DAVSVCPNLYGDI                  ANIG+++SIF
Sbjct: 240 TQILDNTVLNVVSNPTLYKDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIF 299

Query: 297 EAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDL 356
           EAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGL + ASRIE AVL+TIAS  ++RTGDL
Sbjct: 300 EAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLEEHASRIENAVLSTIASGPESRTGDL 359

Query: 357 GGSATTSSFTDAVIKNL 373
           GGSATTSSFT+ VIK L
Sbjct: 360 GGSATTSSFTECVIKKL 376

>ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  529 bits (1362), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/373 (68%), Positives = 309/373 (82%), Gaps = 5/373 (1%)

Query: 1   MLRNSLLRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVK 60
           M ++ + R +  AR F +     QPSIG+FTGKP+P TG + VSFIEGDGIGPEIS+SVK
Sbjct: 1   MFKSQVCRRA-VARMFSS----KQPSIGKFTGKPDPKTGNYKVSFIEGDGIGPEISKSVK 55

Query: 61  DIFKAAEVPINWEFCDVTPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNL 120
           DIF AA+VP+++E   V PI VNG+T+IP+ A  SIN NL+ALKGPLATP+GKGHRS+NL
Sbjct: 56  DIFAAAKVPVDFESVVVKPILVNGVTSIPEEAQKSINTNLVALKGPLATPVGKGHRSMNL 115

Query: 121 TLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180
           TLRKTF LFAN+RPAKS+EGFKT Y +V+LVLIRENTEGEY+GIEH + PGVVQSIKLIT
Sbjct: 116 TLRKTFGLFANLRPAKSVEGFKTIYDNVNLVLIRENTEGEYAGIEHAIVPGVVQSIKLIT 175

Query: 181 RDASERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELI 240
           R+ASERVIR+A+EYA+A  RPR++VVHKSTIQRL+DGLFV+VAKEL  E+P+IKLETELI
Sbjct: 176 REASERVIRFAYEYARAAERPRLIVVHKSTIQRLSDGLFVDVAKELQSEFPDIKLETELI 235

Query: 241 DNTVLNVVSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFEAVH 300
           DN VLN V++P  Y+DAVSVCPNLYGDI                   NIG+++SIFEAVH
Sbjct: 236 DNAVLNTVTDPTKYSDAVSVCPNLYGDILSDMNSGLSAGSLGLTPSGNIGHKVSIFEAVH 295

Query: 301 GSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSA 360
           GSAPDIAG++KANPTALLLSSVMML+HMGL + AS+IE+AVLTTIA+  ++RTGDL GSA
Sbjct: 296 GSAPDIAGKDKANPTALLLSSVMMLHHMGLHEHASQIEKAVLTTIAAGPESRTGDLKGSA 355

Query: 361 TTSSFTDAVIKNL 373
           +TSSFT+AVIK L
Sbjct: 356 STSSFTEAVIKKL 368

>TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {ON}
           Anc_5.473 YOR136W
          Length = 377

 Score =  482 bits (1241), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 236/359 (65%), Positives = 280/359 (77%), Gaps = 2/359 (0%)

Query: 15  RFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVKDIFKAAEVPINWEF 74
           R+  T+  ++ SIG F GKPNP TG + V FIEGDG+GPEIS+SV+ IFKAA+VPI+W  
Sbjct: 20  RYFMTAA-DKISIGNFKGKPNPETGNYTVPFIEGDGVGPEISKSVRTIFKAAKVPIDWVN 78

Query: 75  CDVTPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNLTLRKTFNLFANVRP 134
           CD+ P+ +NG TTIP  AV  IN +LIALKGPLATP+G+GHRS+NLTLRKTF LFANVRP
Sbjct: 79  CDIGPLLINGETTIPQTAVDQINNSLIALKGPLATPVGQGHRSINLTLRKTFGLFANVRP 138

Query: 135 AKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITRDASERVIRYAFEY 194
           AKSI    +TY +VDL++IRENTEGEYSGIEH + PGVVQSIKLITR ASE+VI+YAFEY
Sbjct: 139 AKSIPNLASTYENVDLIVIRENTEGEYSGIEHEIVPGVVQSIKLITRKASEKVIKYAFEY 198

Query: 195 AKAIGRPRVVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELIDNTVLNVVSNPAGY 254
            ++IGR  ++VVHK+TIQR  DGLFV  A+E++ +YP++ L+ ELIDNTVLN + NP  Y
Sbjct: 199 TRSIGRSNLIVVHKATIQRRGDGLFVQTAQEMADKYPDVNLKLELIDNTVLNCIMNPEKY 258

Query: 255 TDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFEAVHGSAPDIAGQNKANP 314
            D+VSVCPNLYGDI                  ANIG E  ++EAVHGSAPDIAGQ+KANP
Sbjct: 259 ADSVSVCPNLYGDILSDLNSGLSTGSLGLTPSANIG-ETVLYEAVHGSAPDIAGQDKANP 317

Query: 315 TALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373
           TALLLSSVMMLNHMGL   A  IE AVLTTI S  + RT DLGGSATT+SFT AVI+NL
Sbjct: 318 TALLLSSVMMLNHMGLQKYADMIETAVLTTITSGKEFRTADLGGSATTTSFTKAVIENL 376

>Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037C
           (REAL)
          Length = 360

 Score =  273 bits (698), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 155/371 (41%), Positives = 228/371 (61%), Gaps = 18/371 (4%)

Query: 7   LRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVKDIFKAA 66
           + N   A+R LAT+ + + ++      P    G+F V+ I GDG+G EI+ SVK IF+A 
Sbjct: 1   MLNRTIAKRTLATAAQAERAL------PKKYGGRFTVTLIPGDGVGKEITDSVKTIFEAE 54

Query: 67  EVPINWEFCDVTPI-FVNGLTTIPDPAVASINKNLIALKGPLATPIGK-GHRSLNLTLRK 124
           ++P++WE  ++       G+      AV S+ +N I LKG   TP  + GH SLN+ LRK
Sbjct: 55  KIPVDWETVNIKQTDHKEGVY----EAVESLKRNKIGLKGLWHTPADQTGHGSLNVALRK 110

Query: 125 TFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITRDAS 184
             +++ANV   KS++G KT   D+DL++IRENTEGE+SG+EH   PGVV+S+K++TR  +
Sbjct: 111 QLDIYANVALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLEHESVPGVVESLKIMTRPKT 170

Query: 185 ERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKEL-SKEYPEIKLETELIDNT 243
           ER+ R+AF++AK   R  V  VHK+ I +L DGLF N+  E+  KEYP+I + + ++DN 
Sbjct: 171 ERIARFAFDFAKKYNRKAVTAVHKANIMKLGDGLFRNIITEIGQKEYPDIDVSSIIVDNA 230

Query: 244 VLNVVSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFE-AVHGS 302
            +  V+ P  +   V V P++YG I                  AN G + ++FE      
Sbjct: 231 SMQAVAKPHQFD--VLVTPSMYGTI-LGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHV 287

Query: 303 APDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATT 362
             DI GQN ANPTA++LSSV+MLNH+GL + A+RI +AV  TIA   K+ T D+GGS++T
Sbjct: 288 GLDIKGQNVANPTAMILSSVLMLNHLGLNEYATRISKAVHETIA-EGKHTTKDIGGSSST 346

Query: 363 SSFTDAVIKNL 373
           + FT+ +I  L
Sbjct: 347 TDFTNEIINKL 357

>ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL037C (IDH1)
          Length = 362

 Score =  271 bits (692), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 161/376 (42%), Positives = 218/376 (57%), Gaps = 20/376 (5%)

Query: 1   MLRNSLLRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVK 60
           M RN+L  +  T R + A         GR    P    G++ V+ I GDGIG E++ SV 
Sbjct: 1   MFRNTL--SHITKRGYAA---------GREQLLPKKYGGRYTVTLIPGDGIGKEVTDSVV 49

Query: 61  DIFKAAEVPINWEFCDVTPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGK-GHRSLN 119
            IF+A  VP++WE  +++ +  N        AV S+ +N + LKG   TP  + GH SLN
Sbjct: 50  QIFEAENVPVDWESVELSALEENHEGV--QKAVESLKRNKVGLKGIWHTPADQTGHGSLN 107

Query: 120 LTLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLI 179
           +  RK  ++FANV   KS  G KT   DVDLV+IRENTEGEYSG+EH   PGVV+S+K++
Sbjct: 108 VAFRKQLDIFANVALFKSFPGVKTKLQDVDLVIIRENTEGEYSGLEHESVPGVVESLKIM 167

Query: 180 TRDASERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKEL-SKEYPEIKLETE 238
           T+  SER+ R+AF++A    R  V  VHK+ I +L DGLF N   E+ +KEYPE+ + + 
Sbjct: 168 TKAKSERIARFAFDFALKNNRKAVCAVHKANIMKLGDGLFRNTVSEIGAKEYPEVNVSSI 227

Query: 239 LIDNTVLNVVSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFE- 297
           ++DN  +  V+ P  +   V V PNLYG I                  AN G E ++FE 
Sbjct: 228 IVDNASMQAVAKPHQFD--VLVTPNLYGSI-LGNIGAALIGGPGLVPGANFGREYAVFEP 284

Query: 298 AVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLG 357
                  DI GQ+ ANPTA++LSS +ML H+GL + A RI RA   TIA   K  T D+G
Sbjct: 285 GCRHVGLDIKGQDVANPTAMILSSTLMLRHLGLNEYADRISRATYETIA-EGKRTTKDIG 343

Query: 358 GSATTSSFTDAVIKNL 373
           G+ATT+ FT+AVI  L
Sbjct: 344 GTATTTEFTNAVIDKL 359

>YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON}
           IDH1Subunit of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  270 bits (690), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 154/371 (41%), Positives = 226/371 (60%), Gaps = 18/371 (4%)

Query: 7   LRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVKDIFKAA 66
           + N   A+R LAT+ + + ++      P    G+F V+ I GDG+G EI+ SV+ IF+A 
Sbjct: 1   MLNRTIAKRTLATAAQAERTL------PKKYGGRFTVTLIPGDGVGKEITDSVRTIFEAE 54

Query: 67  EVPINWEFCDVTPI-FVNGLTTIPDPAVASINKNLIALKGPLATPIGK-GHRSLNLTLRK 124
            +PI+WE  ++       G+      AV S+ +N I LKG   TP  + GH SLN+ LRK
Sbjct: 55  NIPIDWETINIKQTDHKEGVY----EAVESLKRNKIGLKGLWHTPADQTGHGSLNVALRK 110

Query: 125 TFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITRDAS 184
             +++ANV   KS++G KT   D+DL++IRENTEGE+SG+EH   PGVV+S+K++TR  +
Sbjct: 111 QLDIYANVALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLEHESVPGVVESLKVMTRPKT 170

Query: 185 ERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKEL-SKEYPEIKLETELIDNT 243
           ER+ R+AF++AK   R  V  VHK+ I +L DGLF N+  E+  KEYP+I + + ++DN 
Sbjct: 171 ERIARFAFDFAKKYNRKSVTAVHKANIMKLGDGLFRNIITEIGQKEYPDIDVSSIIVDNA 230

Query: 244 VLNVVSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFE-AVHGS 302
            +  V+ P  +   V V P++YG I                  AN G + ++FE      
Sbjct: 231 SMQAVAKPHQFD--VLVTPSMYGTI-LGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHV 287

Query: 303 APDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATT 362
             DI GQN ANPTA++LSS +MLNH+GL + A+RI +AV  TIA   K+ T D+GGS++T
Sbjct: 288 GLDIKGQNVANPTAMILSSTLMLNHLGLNEYATRISKAVHETIA-EGKHTTRDIGGSSST 346

Query: 363 SSFTDAVIKNL 373
           + FT+ +I  L
Sbjct: 347 TDFTNEIINKL 357

>Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037C
           (REAL)
          Length = 361

 Score =  269 bits (688), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 153/371 (41%), Positives = 227/371 (61%), Gaps = 18/371 (4%)

Query: 7   LRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVKDIFKAA 66
           + N   A+R LAT+ + + ++      P    G+F V+ I GDG+G EI+ SV+ IF+A 
Sbjct: 1   MLNRTIAKRTLATAAQAERTL------PKKYGGRFTVTLIPGDGVGKEITDSVRTIFEAE 54

Query: 67  EVPINWEFCDVTPI-FVNGLTTIPDPAVASINKNLIALKGPLATPIGK-GHRSLNLTLRK 124
            +P++WE  ++       G+      AV S+ +N I LKG   TP  + GH SLN+ LRK
Sbjct: 55  RIPVDWETINIKQTDHKEGVY----EAVESLKRNKIGLKGLWHTPADQTGHGSLNVALRK 110

Query: 125 TFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITRDAS 184
             +++ANV   KS++G KT   D+DL++IRENTEGE+SG+EH   PGVV+S+K++T+  +
Sbjct: 111 QLDIYANVALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLEHESVPGVVESLKVMTKPKT 170

Query: 185 ERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKELSK-EYPEIKLETELIDNT 243
           ER+ R+AF++AK   R  V  VHK+ I +L DGLF N+  E+ + EYP+I + + ++DN 
Sbjct: 171 ERIARFAFDFAKKYNRKAVTAVHKANIMKLGDGLFRNIITEIGQTEYPDIDVSSIIVDNA 230

Query: 244 VLNVVSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFE-AVHGS 302
            +  V+ P  +   V V P++YG I                  AN G + ++FE      
Sbjct: 231 SMQAVAKPHQFD--VLVTPSMYGTI-LGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHV 287

Query: 303 APDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATT 362
             DI GQN ANPTA++LSSV+MLNH+GL + A+RI +AV  TIA   K+ T D+GGS++T
Sbjct: 288 GLDIKGQNVANPTAMILSSVLMLNHLGLNENATRISKAVHETIA-EGKHTTRDIGGSSST 346

Query: 363 SSFTDAVIKNL 373
           + FT+ VI  L
Sbjct: 347 TDFTNEVINKL 357

>ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} similar
           to uniprot|P28834 Saccharomyces cerevisiae YNL037C IDH1
           Subunit of mitochondrial NAD( )-dependent isocitrate
           dehydrogenase which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 361

 Score =  269 bits (688), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 159/374 (42%), Positives = 228/374 (60%), Gaps = 22/374 (5%)

Query: 6   LLRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVKDIFKA 65
           + R+S T +R LAT    +  +      P    G++ V+ I GDG+G E++ SV  IFKA
Sbjct: 1   MFRHSLT-KRTLATVATTEKML------PKKYGGRYTVTLIPGDGVGKEVTDSVVSIFKA 53

Query: 66  AEVPINWEFCDVTPIFVNGLTTIPD--PAVASINKNLIALKGPLAT-PIGK-GHRSLNLT 121
             VP++W+  D++     G+    D   AV S+ +N I LKG   T P  + GH SLN+ 
Sbjct: 54  ENVPVDWDRVDIS-----GVDRAEDVKSAVESLKRNRIGLKGIWHTSPADQAGHGSLNVA 108

Query: 122 LRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITR 181
           LRK  +++ANV   KSI G +    DVDLV+IRENTEGE+SG+EH   PGVV+S+K++T+
Sbjct: 109 LRKELDIYANVARFKSIPGVQVKIPDVDLVVIRENTEGEFSGLEHESVPGVVESLKIMTQ 168

Query: 182 DASERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKEL-SKEYPEIKLETELI 240
           D  ER+ R+AF+YAK   R +VV VHK+ I ++ DGLF N+ +E+  KEYPE+++   ++
Sbjct: 169 DNIERIARFAFDYAKKNDRKQVVAVHKANIMKMGDGLFKNLVQEVGEKEYPELQVGNIIV 228

Query: 241 DNTVLNVVSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFE-AV 299
           DN  +  V+NP  +   V V P++YG I                  AN G ++++FE   
Sbjct: 229 DNASMQTVANPHQFD--VLVTPSMYGTI-LGNIGAALIGGPGLVAGANYGRDVALFEPGS 285

Query: 300 HGSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGS 359
                DI GQN ANPTA++LSSV++LNH+GL   A RI +AV   IA   K+ T D+GG+
Sbjct: 286 RHVGLDIKGQNVANPTAMILSSVLLLNHLGLNTSADRISKAVHAVIA-EGKSVTRDIGGT 344

Query: 360 ATTSSFTDAVIKNL 373
           A+T+ FT+AVI  L
Sbjct: 345 ASTTEFTEAVINKL 358

>Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar to
           Ashbya gossypii ADL223W
          Length = 362

 Score =  268 bits (685), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 157/376 (41%), Positives = 222/376 (59%), Gaps = 20/376 (5%)

Query: 1   MLRNSLLRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVK 60
           MLRN+ ++   + RRF   S       G+    P    G++ V+ I GDG+G E++ SV 
Sbjct: 1   MLRNTFVQ--ISKRRFALAS-------GQLL--PKKYGGRYTVTLIPGDGVGKEVTDSVV 49

Query: 61  DIFKAAEVPINWEFCDVTPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGK-GHRSLN 119
           +IF+A  VPI+WE  +++ +  N        AV S+ +N + LKG  +TP  + GH SLN
Sbjct: 50  NIFEAENVPIDWESVELSGLEEN--MEGVQKAVESLKRNKVGLKGIWSTPADQTGHGSLN 107

Query: 120 LTLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLI 179
           +  RK  ++FANV   KS  G KT   DVDLV+IRENTEGEYSG+EH   PGVV+S+K++
Sbjct: 108 VAFRKQLDIFANVALFKSFPGVKTKLKDVDLVIIRENTEGEYSGLEHESVPGVVESLKIM 167

Query: 180 TRDASERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKEL-SKEYPEIKLETE 238
           T+  SER+ R+AF++A    R  V  VHK+ I +L DGLF N   E+ +KEYPE+++++ 
Sbjct: 168 TKAKSERIARFAFDFALKNNRRSVCAVHKANIMKLGDGLFRNTVNEIGAKEYPELEVKSI 227

Query: 239 LIDNTVLNVVSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFE- 297
           ++DN  +  V+ P  +   V V PNLYG I                  AN G E ++FE 
Sbjct: 228 IVDNASMQAVAKPHQFD--VLVTPNLYGSI-LGNVGAALIGSPGLVPGANFGREYAVFEP 284

Query: 298 AVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLG 357
                  DI GQ+ ANPTA++LSS +ML H+GL D A RI +A    IA   K+ T D+G
Sbjct: 285 GSRHVGLDIKGQDVANPTAMILSSTLMLRHLGLNDYADRISKATYEVIA-EGKHTTKDIG 343

Query: 358 GSATTSSFTDAVIKNL 373
           G A+T+ FT A++  L
Sbjct: 344 GHASTTQFTKAIVDKL 359

>NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {ON}
           Anc_2.278
          Length = 359

 Score =  264 bits (674), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 157/371 (42%), Positives = 220/371 (59%), Gaps = 18/371 (4%)

Query: 6   LLRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVKDIFKA 65
           + ++S T R  +        ++ + T  P    G+F V+ + GDG+G EI+ SV  IFK+
Sbjct: 1   MFKHSVTKRSLV--------TLAKETIIPKKYGGRFTVTLLPGDGVGKEITDSVVSIFKS 52

Query: 66  AEVPINWEFCDVTPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGK-GHRSLNLTLRK 124
             VPI+WE  D++ +     T     AV S+ +N I LKG   TP  + GH SLN+  RK
Sbjct: 53  ENVPIDWETVDISGL---DHTEGVKAAVDSLKRNKIGLKGIWHTPADQVGHGSLNVAFRK 109

Query: 125 TFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITRDAS 184
             +++ANV   KSIEG KT   +VDLV+IRENTEGEYSG+EH   PGVV+S+K+IT+  S
Sbjct: 110 QLDIYANVAIFKSIEGVKTKIPNVDLVVIRENTEGEYSGLEHESVPGVVESLKIITKSKS 169

Query: 185 ERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVN-VAKELSKEYPEIKLETELIDNT 243
           ER+ R+AF++AK   R  V  VHK+ I +L+DGLF N V+K   +EYPEI+  + ++DN 
Sbjct: 170 ERIARFAFDFAKRNNRKSVTAVHKANIMKLSDGLFRNTVSKIGEEEYPEIQTSSIIVDNA 229

Query: 244 VLNVVSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFE-AVHGS 302
            +  V+ P  +   V V P++YG I                   N G + ++FE      
Sbjct: 230 SMQAVAKPHQFD--VMVTPSMYGTI-VGNIGAALIGGPGLVPGVNYGRDYAVFEPGSRHV 286

Query: 303 APDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATT 362
             DI GQN ANPTA+LLS+ ++L+H+GL   A+RI+ AV   IA   K  T D+GGSA+T
Sbjct: 287 GLDIKGQNVANPTAMLLSATLLLDHLGLEKSANRIKSAVYDVIA-EGKATTQDIGGSAST 345

Query: 363 SSFTDAVIKNL 373
           + FT AVI  L
Sbjct: 346 TEFTQAVINKL 356

>KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON}
           uniprot|O94229 Kluyveromyces lactis KLLA0F04103g IDH1
           Isocitrate dehydrogenase subunit 1
          Length = 361

 Score =  263 bits (671), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 151/345 (43%), Positives = 208/345 (60%), Gaps = 14/345 (4%)

Query: 34  PNPATGKFDVSFIEGDGIGPEISQSVKDIFKAAEVPINWEFCDVTPIFVNGLTTIPD--P 91
           P    G++ V+ I GDG+G E++ SV  IF+   +PI+WE  D++     GL    +   
Sbjct: 23  PKKYGGRYTVTLIPGDGVGKEVTDSVVKIFENENIPIDWETIDIS-----GLENTENVQR 77

Query: 92  AVASINKNLIALKGPLATPIGK-GHRSLNLTLRKTFNLFANVRPAKSIEGFKTTYSDVDL 150
           AV S+ +N + LKG   TP  + GH SLN+ LRK  ++FANV   KSI G KT  +++D+
Sbjct: 78  AVESLKRNKVGLKGIWHTPADQTGHGSLNVALRKQLDIFANVALFKSIPGVKTRLNNIDM 137

Query: 151 VLIRENTEGEYSGIEHVVAPGVVQSIKLITRDASERVIRYAFEYAKAIGRPRVVVVHKST 210
           V+IRENTEGEYSG+EH   PGVV+S+K++TR  SER+ R+AF++A    R  V  VHK+ 
Sbjct: 138 VIIRENTEGEYSGLEHESVPGVVESLKIMTRAKSERIARFAFDFALKNNRKSVCAVHKAN 197

Query: 211 IQRLADGLFVNVAKEL-SKEYPEIKLETELIDNTVLNVVSNPAGYTDAVSVCPNLYGDIX 269
           I +L DGLF N   E+ + EYPE+ ++  ++DN  +  V+ P  +   V V PNLYG I 
Sbjct: 198 IMKLGDGLFRNTVNEIGANEYPELDVKNIIVDNASMQAVAKPHQFD--VLVTPNLYGSI- 254

Query: 270 XXXXXXXXXXXXXXXXXANIGNEISIFE-AVHGSAPDIAGQNKANPTALLLSSVMMLNHM 328
                            AN G E ++FE        DI GQN ANPTA++LSS +ML H+
Sbjct: 255 LGNIGSALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGQNVANPTAMILSSTLMLRHL 314

Query: 329 GLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373
           GL   A RI +A    I S  K+ T D+GGSA+TS FT+AVI+ L
Sbjct: 315 GLNAYADRISKATYDVI-SEGKSTTRDIGGSASTSEFTNAVIEKL 358

>KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|P28834 Saccharomyces cerevisiae
           YNL037C IDH1 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  262 bits (670), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 157/374 (41%), Positives = 222/374 (59%), Gaps = 23/374 (6%)

Query: 6   LLRNSF-TARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVKDIFK 64
           +LRN F  ++R LAT  +           P    G++ V+ I GDG+G E++ SV  IF+
Sbjct: 1   MLRNGFGISKRSLATVAEQL--------LPKKYGGRYTVTLIPGDGVGKEVTDSVVSIFE 52

Query: 65  AAEVPINWEFCDVTPIFVNGLTTIP--DPAVASINKNLIALKGPLATPIGK-GHRSLNLT 121
           +  VPI+WE  +++     GL        AV S+ +N + LKG   TP  + GH SLN+ 
Sbjct: 53  SENVPIDWETVEIS-----GLDNEEGVQKAVDSLKRNKVGLKGIWHTPSDQTGHGSLNVA 107

Query: 122 LRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITR 181
           LRK  ++FANV   K++ G  + +S+VDLV+IRENTEGEYSG+EH   PGVV+S+K++T+
Sbjct: 108 LRKQLDIFANVALFKTVPGVPSRHSNVDLVVIRENTEGEYSGLEHESVPGVVESLKIMTK 167

Query: 182 DASERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKEL-SKEYPEIKLETELI 240
             S+R+ R+AF++A    R  V  VHK+ I +L DGLF N   E+ +KEYPEI+++  ++
Sbjct: 168 AKSDRIGRFAFDFALKNNRKSVCAVHKANIMKLGDGLFRNCINEIGAKEYPEIEVKNIIV 227

Query: 241 DNTVLNVVSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFE-AV 299
           DN  +  V+ P  +   V V PNLYG I                  AN G E ++FE   
Sbjct: 228 DNASMQAVAKPHQFD--VLVTPNLYGSI-LGNIGAALIGGPGLVPGANFGREFAVFEPGS 284

Query: 300 HGSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGS 359
                DI GQN ANPTA++LSS +ML H+GL   A RI +A    IA  +KN T D+GGS
Sbjct: 285 RHVGLDIKGQNVANPTAMILSSALMLRHLGLNSYADRISKATYDVIA-EAKNTTKDIGGS 343

Query: 360 ATTSSFTDAVIKNL 373
           A+T+ FT A+I+ L
Sbjct: 344 ASTTDFTQAIIEKL 357

>TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON} 
          Length = 365

 Score =  261 bits (668), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 159/369 (43%), Positives = 223/369 (60%), Gaps = 21/369 (5%)

Query: 13  ARRFLATSVKNQPSIGRFTGKPNPA----TGKFDVSFIEGDGIGPEISQSVKDIFKAAEV 68
           A+R LAT     P+ G F G  NP      G++ V+ I GDG+G E++ SV  IF A  +
Sbjct: 7   AKRGLATV----PATG-FRGFLNPLPKEYGGRYTVTLIPGDGVGKEVTDSVVSIFNAENL 61

Query: 69  PINWEFCDVTPI-FVNGLTTIPDPAVASINKNLIALKGPLATPIGKG-HRSLNLTLRKTF 126
           PI+WE  D++ +    G+    + AV S+ +N I LKG   T  G+  H SLN+ LRK  
Sbjct: 62  PIDWERVDISGLDHEEGV----EAAVNSLKRNKIGLKGIWHTSAGQSDHGSLNVALRKQL 117

Query: 127 NLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITRDASER 186
           +++ANV   K++ G KT   DVDLV+IRENTEGEYSG+EH   PGVV+S+K+IT++ SER
Sbjct: 118 DIYANVAHFKTLPGVKTRIPDVDLVIIRENTEGEYSGLEHESVPGVVESLKIITKEKSER 177

Query: 187 VIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKELSK-EYPEIKLETELIDNTVL 245
           + R+AF++AK   R  V  VHK+ I +L DGLF N    + + EYP+IK+ + ++DN  +
Sbjct: 178 IARFAFDFAKRFDRKLVTAVHKANIMKLGDGLFRNSVTSIGETEYPDIKVSSIIVDNASM 237

Query: 246 NVVSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFE-AVHGSAP 304
             V+ P  +   V V P++YG I                  AN G E ++FE        
Sbjct: 238 QSVAKPHQFD--VLVTPSMYGTI-LGNIGAALIGGPGLVPGANYGTECAVFEPGSRHVGL 294

Query: 305 DIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSS 364
           DI GQN ANPTA++LSS ++L H+GL ++A +IE AV  TIA   K  T D+GGSA+T+ 
Sbjct: 295 DIKGQNVANPTAMILSSTLLLKHLGLNNEAKKIEDAVYKTIA-EGKVTTRDIGGSASTTE 353

Query: 365 FTDAVIKNL 373
           FT+ +IK L
Sbjct: 354 FTNEIIKKL 362

>SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037C IDH1 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 361

 Score =  259 bits (662), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 156/373 (41%), Positives = 218/373 (58%), Gaps = 20/373 (5%)

Query: 6   LLRNSFT-ARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVKDIFK 64
           + RN+F  ++R LAT    Q         P    G++ V+ I GDG+G E++ SV  IF+
Sbjct: 1   MFRNTFAVSKRSLATVATEQLL-------PKKYGGRYTVTLIPGDGVGKEVTDSVVSIFE 53

Query: 65  AAEVPINWEFCDVTPI-FVNGLTTIPDPAVASINKNLIALKGPLATPIGK-GHRSLNLTL 122
           A  VPI+WE  ++T +    G+      AV S+ +N I LKG   TP  + GH SLN+  
Sbjct: 54  AENVPIDWETINITGVDSEEGV----QKAVESLKRNKIGLKGIWHTPADQTGHGSLNVAF 109

Query: 123 RKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITRD 182
           RK  ++FANV   K++ G KT  S++DLV+IRENTEGEYSG+EH   PGVV+S+K+IT+ 
Sbjct: 110 RKQLDIFANVALFKNVPGVKTKLSNIDLVVIRENTEGEYSGLEHESVPGVVESLKIITKA 169

Query: 183 ASERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKEL-SKEYPEIKLETELID 241
            SER+ R+AF++A    R  V  VHK+ I +L DGLF N   E+ + EYPEI ++  ++D
Sbjct: 170 KSERIARFAFDFALKNNRKSVCAVHKANIMKLGDGLFRNTVNEVGASEYPEIDVKNIIVD 229

Query: 242 NTVLNVVSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFE-AVH 300
           N  +  V+ P  +   V V PNLYG I                  AN G E ++FE    
Sbjct: 230 NASMQAVAKPHQFD--VLVTPNLYGSI-LGNIGAALIGGPGLVPGANFGREYAVFEPGSR 286

Query: 301 GSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSA 360
               DI G++ ANPTA++LSS +ML H+GL   A RI +A    IA   K+ T D+GGS+
Sbjct: 287 HVGLDIKGKDLANPTAMILSSTLMLRHLGLNGYADRISKATYDVIA-EGKHTTKDIGGSS 345

Query: 361 TTSSFTDAVIKNL 373
           +T+ FT +VI  L
Sbjct: 346 STTEFTKSVIDKL 358

>Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C
           (IDH1) - alpha-4-beta-4 subunit of mitochondrial
           isocitrate dehydrogenase 1 [contig 7] FULL
          Length = 361

 Score =  258 bits (660), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 157/378 (41%), Positives = 220/378 (58%), Gaps = 25/378 (6%)

Query: 1   MLRNSLLRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVK 60
           MLR+ L      ++R LAT    Q         P    G++ V+ I GDG+G E++ SV 
Sbjct: 1   MLRSGL----GVSKRSLATMAAEQL-------LPKKYGGRYTVTLIPGDGVGKEVTDSVV 49

Query: 61  DIFKAAEVPINWEFCDVTPIFVNGLTTIP--DPAVASINKNLIALKGPLATPIGK-GHRS 117
            IF++  +PI+WE  +++     GL        AV S+ +N + LKG   TP  + GH S
Sbjct: 50  SIFESENIPIDWETVEIS-----GLDNQEGVQKAVESLKRNKVGLKGIWHTPSDQTGHGS 104

Query: 118 LNLTLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIK 177
           LN+ LRK  ++FANV   KS+ G  + +S+VD+V+IRENTEGEYSG+EH   PGVV+S+K
Sbjct: 105 LNVALRKQLDIFANVALFKSVPGVPSRHSNVDMVVIRENTEGEYSGLEHESVPGVVESLK 164

Query: 178 LITRDASERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKEL-SKEYPEIKLE 236
           ++T+  SER+ R+AF++A    R  V  VHK+ I +L DGLF N   E+ +KEYPEI ++
Sbjct: 165 IMTKAKSERIGRFAFDFAVKNNRKSVCAVHKANIMKLGDGLFRNCINEVGAKEYPEIDVK 224

Query: 237 TELIDNTVLNVVSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIF 296
             ++DN  +  V+ P  +   V V PNLYG I                  AN G E ++F
Sbjct: 225 NIIVDNASMQAVAKPHQFD--VLVTPNLYGSI-LGNIGAALIGGPGLVPGANFGREYAVF 281

Query: 297 E-AVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGD 355
           E        DI GQN ANPTA++LSS +ML H+GL   A RI +A    IA  +K  T D
Sbjct: 282 EPGSRHVGLDIKGQNVANPTAMILSSSLMLRHLGLNAYADRISKATYDVIA-EAKTTTQD 340

Query: 356 LGGSATTSSFTDAVIKNL 373
           +GGSA+T+ FT+A+I  L
Sbjct: 341 IGGSASTTEFTEAIISKL 358

>Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa]
           {ON} complement(108102..109181) [1080 nt, 360 aa]
          Length = 359

 Score =  257 bits (656), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 152/371 (40%), Positives = 218/371 (58%), Gaps = 18/371 (4%)

Query: 6   LLRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVKDIFKA 65
           + RN  + R F  TS+ ++ +I      P    G++ V+ + GDG+G EI+ SV  IF+A
Sbjct: 1   MFRNLISKRAF--TSIASRENI-----IPKKYGGRYTVTLLPGDGVGREITDSVVSIFEA 53

Query: 66  AEVPINWEFCDVTPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGK-GHRSLNLTLRK 124
             +PI+WE  +++ +    + T    AV S+ +N I LKG   T     GH S N+ LRK
Sbjct: 54  ENLPIDWERVELSGLEQEDVHT----AVESLKRNKIGLKGIWHTSADHDGHTSWNVALRK 109

Query: 125 TFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITRDAS 184
             +++ANV   KS +G  T   DVDLV+IRENTEGEYSG+EH   PGVV+S+K++T   +
Sbjct: 110 ELDIYANVAIFKSFKGVDTRIPDVDLVIIRENTEGEYSGLEHESVPGVVESLKIMTAQKT 169

Query: 185 ERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKEL-SKEYPEIKLETELIDNT 243
           ER+ R+AF+YA    R  V  VHK+ I +L DGLF N+  E+ +KEYPE+ + + ++DN 
Sbjct: 170 ERIARFAFDYAMKYNRKSVTAVHKANIMKLGDGLFRNLVTEIGAKEYPEVGVSSIIVDNA 229

Query: 244 VLNVVSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFE-AVHGS 302
            +  V+ P  +   V V P++YG I                  AN G + ++FE      
Sbjct: 230 SMQAVAKPHQFD--VMVAPSMYGTI-LGNIGAALIGGPGLVPGANYGRDYAVFEPGSRHV 286

Query: 303 APDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATT 362
             DI  QN ANPTA++LS+ +MLNH+G  + A+RI +AV   IA   K  T D+GGSATT
Sbjct: 287 GLDIENQNIANPTAMILSATLMLNHLGFRNDAARISKAVHEVIA-EGKTTTRDIGGSATT 345

Query: 363 SSFTDAVIKNL 373
           + FT+AVI  L
Sbjct: 346 TEFTNAVIAKL 356

>TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {ON}
           Anc_2.278 YNL037C
          Length = 360

 Score =  254 bits (648), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 156/371 (42%), Positives = 217/371 (58%), Gaps = 17/371 (4%)

Query: 6   LLRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVKDIFKA 65
           +LR    ++R +A+  KN   +      P    G++ V+ I GDGIG E++ SV  IF +
Sbjct: 1   MLR-QVVSKRSIASFTKNHNIV------PKKYGGRYTVTLIPGDGIGKEVTDSVVKIFAS 53

Query: 66  AEVPINWEFCDVTPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGK-GHRSLNLTLRK 124
             +PI+WE  DV P   N        AV S+ +N I LKG   T   + G+ SLN+ LRK
Sbjct: 54  QGLPIDWERIDV-PGMSN--ENEVKKAVESLKRNKIGLKGIWHTSADQTGYGSLNVALRK 110

Query: 125 TFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITRDAS 184
             ++FANV   KS++G KT   DVDLV+IRENTEGEYSG+EH   PGVV+S+K+IT+  +
Sbjct: 111 QLDIFANVAIFKSLKGVKTKIPDVDLVVIRENTEGEYSGLEHESVPGVVESLKIITKPKT 170

Query: 185 ERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKEL-SKEYPEIKLETELIDNT 243
           ER+ R+AF++A    R  V  VHK+ I +L+DGLF N   E+  KEYP+IK+ T ++DN 
Sbjct: 171 ERIARFAFDFALENNRSTVTAVHKANIMKLSDGLFKNTVAEVGEKEYPDIKVNTIIVDNA 230

Query: 244 VLNVVSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFE-AVHGS 302
            +  V+ P  +   V V P++YG I                  AN G E ++FE      
Sbjct: 231 SMQAVAKPHQFD--VMVTPSMYGTI-LGNIGAALIGGPGLIPGANYGREHAVFEPGSRHV 287

Query: 303 APDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATT 362
             DI  QN ANPTA++LS+ +MLN +GL +++ RI  AV   I    K  T D+GG+A+T
Sbjct: 288 GLDIENQNIANPTAMILSATLMLNQLGLREESKRISNAVYAVI-EEGKTTTKDIGGNAST 346

Query: 363 SSFTDAVIKNL 373
           + FTDAVI  L
Sbjct: 347 TEFTDAVIDKL 357

>NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa]
           {ON} Anc_2.278
          Length = 359

 Score =  253 bits (647), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 149/364 (40%), Positives = 214/364 (58%), Gaps = 17/364 (4%)

Query: 13  ARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVKDIFKAAEVPINW 72
           A+R LAT +  +  +      P    G+  V+ + GDG+G EI+ SV  IF+A  VPI+W
Sbjct: 7   AKRTLATFIPKETIL------PKKYGGRMTVTLLPGDGVGKEITDSVVSIFQAENVPIDW 60

Query: 73  EFCDVTPI-FVNGLTTIPDPAVASINKNLIALKGPLATPIGK-GHRSLNLTLRKTFNLFA 130
           E  D++ +   +G+    + AV S+ +N I LKG   T   + GH SLN+  RK  +++A
Sbjct: 61  ETVDISQLDHEDGV----NAAVESLKRNKIGLKGIWHTSADQVGHGSLNVAFRKQLDIYA 116

Query: 131 NVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITRDASERVIRY 190
           NV   KSI G KT   +VDLV+IRENTEGEYSG+EH   PGVV+S+K++T+  SER+ ++
Sbjct: 117 NVAFCKSIPGVKTKIPNVDLVIIRENTEGEYSGLEHESVPGVVESLKIVTKVNSERIAKF 176

Query: 191 AFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELIDNTVLNVVSN 250
           AF++A    R  V  VHK+ I +L+DGLF N    + + YP+IK ++ ++DN  +  V+ 
Sbjct: 177 AFDFAMRHDRKMVTAVHKANIMKLSDGLFRNTVARVGEAYPQIKNDSIIVDNASMQAVAK 236

Query: 251 PAGYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFE-AVHGSAPDIAGQ 309
           P  +   V V P++YG I                   N G E ++FE        DI GQ
Sbjct: 237 PHQFD--VMVTPSMYGTI-LGNIGAALIGGPGLVPGVNYGREYAVFEPGSRHVGLDIKGQ 293

Query: 310 NKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAV 369
           N ANPTA++LSS ++L H+GL D ASRI +AV   I   +   T D+GG+A+T+ FT AV
Sbjct: 294 NVANPTAMILSSTLLLQHLGLNDTASRISKAVYDVIKEGNAT-TKDIGGNASTTEFTKAV 352

Query: 370 IKNL 373
           I  L
Sbjct: 353 IDKL 356

>KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score =  250 bits (638), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 146/345 (42%), Positives = 199/345 (57%), Gaps = 13/345 (3%)

Query: 34  PNPATGKFDVSFIEGDGIGPEISQSVKDIFKAAEVPINWEFCDVTPI-FVNGLTTIPDPA 92
           PN   G++ V+ + GDG+G E + SV  +F A  +PI+WE  +++ +    G+      A
Sbjct: 20  PNKYGGRYTVTLLPGDGVGKECTDSVVSVFNAENIPIDWEIVNISGLDHKEGVAA----A 75

Query: 93  VASINKNLIALKGPLATPIG--KGHRSLNLTLRKTFNLFANVRPAKSIEGFKTTYSDVDL 150
           V S+ +N I LKG   T      GH SLN+  RK  +++ANV   KS++G KT   DVDL
Sbjct: 76  VQSLRRNKIGLKGLWHTSNADQSGHGSLNVAFRKQLDIYANVAVFKSLKGVKTMIPDVDL 135

Query: 151 VLIRENTEGEYSGIEHVVAPGVVQSIKLITRDASERVIRYAFEYAKAIGRPRVVVVHKST 210
           V+IRENTEGE+SG+EH    GVV+S+K+ T   +ER+ R+AF YA+  GR  V  VHK+ 
Sbjct: 136 VVIRENTEGEFSGLEHESVEGVVESLKVTTLPKTERIARFAFNYAQKNGRKAVCAVHKAN 195

Query: 211 IQRLADGLFVNVAKEL-SKEYPEIKLETELIDNTVLNVVSNPAGYTDAVSVCPNLYGDIX 269
           I +L DGLF N    +  KEYP+I+  + ++DN  +  V+ P  +   V V P++YG I 
Sbjct: 196 IMKLGDGLFRNTVTSIGEKEYPDIETSSIIVDNASMQAVAKPHQFD--VLVTPSMYGTI- 252

Query: 270 XXXXXXXXXXXXXXXXXANIGNEISIFE-AVHGSAPDIAGQNKANPTALLLSSVMMLNHM 328
                            AN G E ++FE        DI GQN ANPTA+LLSS +MLNH+
Sbjct: 253 IGNIGAALIGGPGLVAGANFGREYAVFEPGSRHVGLDIKGQNIANPTAMLLSSALMLNHL 312

Query: 329 GLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373
           GL     RI  AV   IA     RT D+GG ATT+ FT AVI+ L
Sbjct: 313 GLTKSGKRISDAVREVIAEGDV-RTKDIGGDATTTEFTQAVIEKL 356

>CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037c IDH1 or uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2
          Length = 358

 Score =  249 bits (637), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 144/345 (41%), Positives = 204/345 (59%), Gaps = 14/345 (4%)

Query: 34  PNPATGKFDVSFIEGDGIGPEISQSVKDIFKAAEVPINWEFCDVTPIFVNGLTTIPD--P 91
           P    G++ V+ I GDG+G EI+ SV  IF+A  +P++WE  D++         I D   
Sbjct: 20  PKKYGGRYTVTLIPGDGVGKEITDSVVSIFEAENIPVDWERVDIST-----SDNIQDVSQ 74

Query: 92  AVASINKNLIALKGPLATPIG-KGHRSLNLTLRKTFNLFANVRPAKSIEGFKTTYSDVDL 150
           AV S+ +N I LKG   T      H S N+ LRK  ++FA+V   KS+ G KT   +VDL
Sbjct: 75  AVESLKRNKIGLKGIWHTSADIADHGSFNVALRKQLDMFAHVAFFKSVPGVKTKIPNVDL 134

Query: 151 VLIRENTEGEYSGIEHVVAPGVVQSIKLITRDASERVIRYAFEYAKAIGRPRVVVVHKST 210
           V+IRENTEGEYSG+EH   PGVV+S+K+IT+  SER+ R+AF++AK   R  V  VHK+ 
Sbjct: 135 VVIRENTEGEYSGLEHESVPGVVESLKIITKAKSERIARFAFDFAKKYNRKSVCAVHKAN 194

Query: 211 IQRLADGLFVNVAKEL-SKEYPEIKLETELIDNTVLNVVSNPAGYTDAVSVCPNLYGDIX 269
           I ++ DGLF N   E+ + EYP+I+  + ++DN  +  V+ P  +   V V P++YG I 
Sbjct: 195 IMKMGDGLFRNTVTEIGANEYPDIQTSSIIVDNASMQAVAKPHQFD--VMVTPSMYGTI- 251

Query: 270 XXXXXXXXXXXXXXXXXANIGNEISIFE-AVHGSAPDIAGQNKANPTALLLSSVMMLNHM 328
                            A+ G E ++FE        DI G+N ANPTA++LSS +ML H+
Sbjct: 252 IGNIGAALIGGPGLVAGAHYGREHAVFEPGSQHVGLDIKGKNVANPTAMILSSTLMLQHL 311

Query: 329 GLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373
           GL + A RI +A    I S  +  T D+GGSA+T+ FT+A+IK L
Sbjct: 312 GLTESAKRIAKATHDVI-SLGQVTTKDIGGSASTTEFTEAIIKRL 355

>KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {ON}
           Anc_2.278 YNL037C
          Length = 350

 Score =  247 bits (630), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 152/375 (40%), Positives = 214/375 (57%), Gaps = 31/375 (8%)

Query: 1   MLRNSLLRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVK 60
           MLRN+LLR S +                  T  P    G+F ++ I G+GIG E++ SV+
Sbjct: 1   MLRNTLLRRSIS------------------TISPKKYGGRFQITLIPGNGIGKEVTDSVR 42

Query: 61  DIFKAAEVPINWEFCDVTPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNL 120
            IF+A  +PI+WE  ++     +G+ T    AV SI +N IALKG  ++    G  SLN+
Sbjct: 43  SIFQAENLPIDWEIVNIES-HRDGIKT----AVDSIKRNKIALKGIWSSDPIDG--SLNV 95

Query: 121 TLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180
            LRK  ++FANV   KS +   T   +VDLV+IRENTEGE+SG+EH    GVV+S+K++T
Sbjct: 96  ALRKQLDIFANVAIFKSFDNVNTRIPNVDLVVIRENTEGEFSGLEHESVDGVVESLKIVT 155

Query: 181 RDASERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKEL-SKEYPEIKLETEL 239
           +  +ER+ R+AF++AK   R  V  VHK+ I +L DGLF N+   + + EYPEIK  + +
Sbjct: 156 KPKTERIARFAFDFAKKHNRNHVTAVHKANIMKLGDGLFKNIVAHIGNNEYPEIKNSSII 215

Query: 240 IDNTVLNVVSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFE-A 298
           +DN  +  V+ P  +   V V P++YG I                  AN G + ++FE  
Sbjct: 216 VDNASMQAVAKPHQFD--VLVSPSMYGTI-LGNIGAALIGGPGLVPGANFGRDYAVFEPG 272

Query: 299 VHGSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGG 358
                 DI GQN ANPTA++LS+  ML H+GL   A RI  AV   IA  +   T D+GG
Sbjct: 273 SRHVGLDIKGQNVANPTAMILSATWMLRHLGLTSPAERITNAVKHVIAQGT-TVTKDIGG 331

Query: 359 SATTSSFTDAVIKNL 373
           +A+T+ FTDAVI  L
Sbjct: 332 TASTTEFTDAVINEL 346

>TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {ON}
           Anc_2.278 YNL037C
          Length = 361

 Score =  247 bits (630), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 150/375 (40%), Positives = 219/375 (58%), Gaps = 24/375 (6%)

Query: 6   LLRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVKDIFKA 65
           +LR++   R F + +   +         P    G+F V+ I GDG+G E++ SV  IF+A
Sbjct: 1   MLRSAVGKRMFASVAAAEKVL-------PKKYGGRFVVTLIPGDGVGKEVTDSVVSIFEA 53

Query: 66  AEVPINWEFCDVTPI-FVNGLTTIPDPAVASINKNLIALKG----PLATPIGKGHRSLNL 120
             +PI+W+  D++ +    G+      AV S+ +N I LKG      A   GKG  SLN+
Sbjct: 54  ENLPIDWDRVDISGLDHEEGVQA----AVDSLKRNKIGLKGIWHTSAADQAGKG--SLNV 107

Query: 121 TLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180
            LRK  +++ANV   KS+ G KT   +VDLV+IRENTEGEYSG+EH   PGVV+S+K++T
Sbjct: 108 ALRKELDIYANVALFKSVPGVKTKIPNVDLVVIRENTEGEYSGLEHESVPGVVESLKIMT 167

Query: 181 RDASERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKEL-SKEYPEIKLETEL 239
            D +ER+ R+AF++AK   R  V  VHK+ I +L DGLF NV   +  +EYP++K+ + +
Sbjct: 168 EDKTERIARFAFDFAKKYNRHAVTAVHKANIMKLGDGLFRNVVTRVGEQEYPDVKVGSII 227

Query: 240 IDNTVLNVVSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFE-A 298
           +DN  +  V+ P  +   V V P++YG I                  AN G E ++FE  
Sbjct: 228 VDNASMQTVAKPHQFD--VLVTPSMYGTI-LGNIGAALIGGPGLVAGANYGREYAVFEPG 284

Query: 299 VHGSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGG 358
                 DI  +N ANPTA++LS+ +ML+H+GL   A++I  AV   IA   K+ T D+GG
Sbjct: 285 SRHVGLDIKDKNIANPTAMILSASLMLDHLGLSTSATKISNAVHQVIA-EGKSTTPDIGG 343

Query: 359 SATTSSFTDAVIKNL 373
           SA+T+ FT AVI+ L
Sbjct: 344 SASTTEFTQAVIEKL 358

>Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C
           (REAL)
          Length = 300

 Score =  213 bits (541), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 124/313 (39%), Positives = 183/313 (58%), Gaps = 17/313 (5%)

Query: 7   LRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVKDIFKAA 66
           + N   A+R LAT+ + +  +      P    G+F V+ I GDG+G E++ SVK IF+A 
Sbjct: 1   MLNRTIAKRSLATAAQVEHIL------PKKYGGRFTVTLIPGDGVGKEVTDSVKTIFEAE 54

Query: 67  EVPINWEFCDVTPI-FVNGLTTIPDPAVASINKNLIALKGPLATPIGK-GHRSLNLTLRK 124
            +PI+WE  ++       G+    + AV S+ +N I LKG   TP  + GH SLN+ LRK
Sbjct: 55  NIPIDWETINIKQTDHKEGV----NEAVESLRRNKIGLKGLWHTPADQTGHGSLNVALRK 110

Query: 125 TFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITRDAS 184
             +++ANV   KS++G KT   D+DL++IRENTEGE+SG+EH   PGVV+S+K++T+  +
Sbjct: 111 QLDIYANVALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLEHESVPGVVESLKIMTKPKT 170

Query: 185 ERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKEL-SKEYPEIKLETELIDNT 243
           ER+ R+AF++AK   R  V  VHK+ I +L DGLF N+  E+  KEYP+I + + ++DN 
Sbjct: 171 ERIARFAFDFAKKYNRKAVTAVHKANIMKLGDGLFRNIITEIGQKEYPDIDVSSIIVDNA 230

Query: 244 VLNVVSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFE-AVHGS 302
            +  V+ P  +   V V P++YG I                  AN G + ++FE      
Sbjct: 231 SMQAVAKPHQFD--VLVTPSMYGTI-LGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHV 287

Query: 303 APDIAGQNKANPT 315
             DI GQN ANPT
Sbjct: 288 GLDIKGQNVANPT 300

>NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.287
           YIL094C
          Length = 372

 Score =  160 bits (405), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 119/353 (33%), Positives = 181/353 (51%), Gaps = 28/353 (7%)

Query: 43  VSFIEGDGIGPEISQSVKDIFKA--AEVPINWEFCDVTPIFVNGLTT---IPDPAVASI- 96
           +  I GDGIG E+  + K + +   ++  +N++F D+   F   L T   +PD  +  + 
Sbjct: 26  IGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQVLK 85

Query: 97  NKNLIALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIR 154
           N+   AL G + +P  K  G+ S  + LRK   L+ANVRP KS+EG  TT   VD+V++R
Sbjct: 86  NQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLYANVRPVKSVEG--TTDKPVDMVIVR 143

Query: 155 ENTEG------EYSGIEHVVAPGVVQSIKLITRDASERVIRYAFEYA----KAIGRPRVV 204
           ENT        E + I+      V ++ K I+  A+ R+   A + A    K  G+  + 
Sbjct: 144 ENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKATLT 203

Query: 205 VVHKSTIQRLADGLFVNVAKELSK----EYPEIKLETELIDNTVLNVVSNPAGYTDAVSV 260
           V HKS +   +DGLF  + K++ +    +Y +I    +++D+ V  +   P  +   V V
Sbjct: 204 VTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCFD--VVV 261

Query: 261 CPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFEAVHGSAPDIAGQNKANPTALLLS 320
            PNLYGDI                  AN+G EI I E  HGSAPDIAG+  +NP A + S
Sbjct: 262 APNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRS 320

Query: 321 SVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373
           + +ML  +G  + A  I RAV   +   +K +T DLGG +TT   T+ V+  L
Sbjct: 321 TALMLEFLGHNEAAQDIHRAVEANL-KENKVKTPDLGGKSTTQEVTEDVLARL 372

>NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON}
           Anc_2.287
          Length = 373

 Score =  159 bits (402), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 123/352 (34%), Positives = 178/352 (50%), Gaps = 27/352 (7%)

Query: 43  VSFIEGDGIGPEISQSVKDIFKA--AEVPINWEFCDVTPIFVNGLTT---IPDPAVASIN 97
           +  I GDGIG E+  + K + +   ++  + ++F D+   F   L T   +PD  V  + 
Sbjct: 28  IGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFIDLQAGFQTFLDTGKALPDETVQVLK 87

Query: 98  KNLI-ALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIR 154
                AL G + +P  K  G+ S  + LRK   LFANVRP KS+ G K     VD+V++R
Sbjct: 88  SQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVSGTKD--RPVDMVIVR 145

Query: 155 ENTEGEYSGIEHVV---APG--VVQSIKLITRDASERVIRYAFEYA----KAIGRPRVVV 205
           ENTE  Y  IE      A G  V ++ K I+  A+ R+   A + A    K  G+  + V
Sbjct: 146 ENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQRLKVNGKATLTV 205

Query: 206 VHKSTIQRLADGLFVNVAKELSK----EYPEIKLETELIDNTVLNVVSNPAGYTDAVSVC 261
            HKS +   +DGLF  + K++ +    +Y  I    +++D+ V  +   P  +   V V 
Sbjct: 206 THKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFREPQCFD--VIVA 263

Query: 262 PNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFEAVHGSAPDIAGQNKANPTALLLSS 321
           PNLYGDI                  AN+G EI I E  HGSAPDIAG+  ANP A + S+
Sbjct: 264 PNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRST 322

Query: 322 VMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373
            +ML  +G  D A  I RAV   +   +K +T DLGG++TT   T+ V+  L
Sbjct: 323 ALMLEFLGHNDAAQDIHRAVEANM-RENKIKTPDLGGNSTTQQVTEDVLARL 373

>Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {ON}
           complement(96083..97195) [1113 nt, 371 aa]
          Length = 370

 Score =  159 bits (401), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 122/394 (30%), Positives = 194/394 (49%), Gaps = 45/394 (11%)

Query: 1   MLRNSLLRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVK 60
           MLRN + R    ARR +    ++  +IG                 I GDGIG E+  + K
Sbjct: 1   MLRNGVYR--ACARRTVVNGARSNLTIG----------------LIPGDGIGKEVIPAGK 42

Query: 61  DIFK--AAEVPINWEFCDVTP---IFVNGLTTIPDPAVASINKNLI-ALKGPLATPIGK- 113
            + +    +  I+++F D+      F++    +PD  V+ + +    AL G + +P  K 
Sbjct: 43  KVLETIGDKYSIDFKFIDLHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKV 102

Query: 114 -GHRSLNLTLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEY-----SGIEHV 167
            G+ S  + LRK   L+AN+RP KS+ G  T    VD+V++RENTE  Y     + I+  
Sbjct: 103 EGYSSPIVALRKQLGLYANIRPVKSVSG--TNDRPVDMVIVRENTEDLYIKEERTYIDEA 160

Query: 168 VAPGVVQSIKLITRDASERVIRYAFEYA----KAIGRPRVVVVHKSTIQRLADGLFVNVA 223
               V ++ K I+  A+ ++ + A + A    K  G+  + V HKS +   +DGLF  V 
Sbjct: 161 TGTKVAEATKRISEVATRKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVC 220

Query: 224 KELSKE----YPEIKLETELIDNTVLNVVSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXX 279
           +++ ++    Y  +    +++D+ V  +   P  +   V V PNLYGDI           
Sbjct: 221 RDVYEKNKDLYGNVSYNEQIVDSMVYRIFREPECFD--VVVAPNLYGDILSDGAAALVGS 278

Query: 280 XXXXXXXANIGNEISIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIER 339
                  AN+G +I I E  HGSAPDI+GQ  +NP A + S+ +ML  +G  + A  I+ 
Sbjct: 279 LGVVPS-ANVGPDIIIGEPCHGSAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQN 337

Query: 340 AVLTTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373
           AV   I  S K +T DLGG ++T+  TD ++  L
Sbjct: 338 AVDENI-RSGKIKTPDLGGDSSTTEVTDDILSKL 370

>TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa]
           {ON} Anc_2.287 YIL094C
          Length = 369

 Score =  157 bits (398), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 129/394 (32%), Positives = 189/394 (47%), Gaps = 46/394 (11%)

Query: 1   MLRNSLLRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVK 60
           MLR S+ + S +AR   A+S+K                    +  I GDGIG E+  + K
Sbjct: 1   MLRTSVRQFSVSARN--ASSLKT-----------------LTIGLIPGDGIGKEVIPAGK 41

Query: 61  DIFKA--AEVPINWEFCDVTP---IFVNGLTTIPDPAVASI-NKNLIALKGPLATPIGK- 113
            + +    +  + +EF D+      F++    +P   V  + NK   AL G + +P  K 
Sbjct: 42  QVLQNLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKV 101

Query: 114 -GHRSLNLTLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVV---- 168
            G+ S  + LRK   LFANVRP K++EG  T    +DLV++RENTE  Y  IE       
Sbjct: 102 EGYSSPIVQLRKELGLFANVRPVKTVEG--TDAKPIDLVIVRENTEDLYIKIEKTYTDPK 159

Query: 169 -APGVVQSIKLITRDASERVIRYAFEYA----KAIGRPRVVVVHKSTIQRLADGLFVNVA 223
               + ++ K IT  A++R+ + A + A    K  G   + V HKS +   +DGLF  V 
Sbjct: 160 DGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVC 219

Query: 224 KELSKE----YPEIKLETELIDNTVLNVVSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXX 279
           KE+ +     Y  +    +++D+ V  +   P  +   V V PNLYGDI           
Sbjct: 220 KEVYESNKSLYSGVAYNEQIVDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAALVGS 277

Query: 280 XXXXXXXANIGNEISIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIER 339
                  AN+G  I I E  HGSAPDIAG+  ANP A + S+  ML ++G  + A  I +
Sbjct: 278 LGLVPS-ANVGPNIVIGEPCHGSAPDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYK 336

Query: 340 AVLTTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373
           AV   I   +K +T DLGG +TT    D ++  L
Sbjct: 337 AVDANI-RDNKIKTADLGGDSTTQQVIDDILGKL 369

>CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094c LYS12 homo-isocitrate dehydrogenase
          Length = 372

 Score =  157 bits (398), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 118/352 (33%), Positives = 181/352 (51%), Gaps = 27/352 (7%)

Query: 43  VSFIEGDGIGPEISQSVKDIFK--AAEVPINWEFCDVTP---IFVNGLTTIPDPAVASIN 97
           +  I GDGIG E+  + K I +    +  ++++F D+      F N    +PD  V  + 
Sbjct: 27  IGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKFIDLHAGWETFQNTGKALPDETVEVLR 86

Query: 98  KNLI-ALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIR 154
           ++   AL G + +P  K  G+ S  + LRK   LFANVRP K++EG  T    VD+V++R
Sbjct: 87  RDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLFANVRPVKAVEG--TNDRPVDMVIVR 144

Query: 155 ENTEGEYSGIEHVV---APG--VVQSIKLITRDASERVIRYAFEYA----KAIGRPRVVV 205
           ENTE  Y  IE      A G  V ++ K I+  A+ R+   A + A    ++ G   + V
Sbjct: 145 ENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIALQRLQSRGHATLTV 204

Query: 206 VHKSTIQRLADGLFVNVAKELSK----EYPEIKLETELIDNTVLNVVSNPAGYTDAVSVC 261
            HKS +   +DGLF  + K++ +    +Y +I+   +++D+ V  +   P  +   V V 
Sbjct: 205 THKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMFREPECFD--VVVA 262

Query: 262 PNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFEAVHGSAPDIAGQNKANPTALLLSS 321
           PNLYGDI                  AN+G EI I E  HGSAPDIAG+  ANP A + S+
Sbjct: 263 PNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGRGIANPIATIRST 321

Query: 322 VMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373
            +ML  +G  + A  I +AV + I   ++ +T DLGG +TT    D ++  +
Sbjct: 322 ALMLEFLGYPEAAQPIYKAVDSNI-RENQIKTPDLGGKSTTQQVVDDILSKI 372

>YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}
           LYS12Homo-isocitrate dehydrogenase, an NAD-linked
           mitochondrial enzyme required for the fourth step in the
           biosynthesis of lysine, in which homo-isocitrate is
           oxidatively decarboxylated to alpha-ketoadipate
          Length = 371

 Score =  155 bits (393), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 122/360 (33%), Positives = 179/360 (49%), Gaps = 27/360 (7%)

Query: 35  NPATGKFDVSFIEGDGIGPEISQSVKDIFKA--AEVPINWEFCDVTPIFVNGLTT---IP 89
           N A     +  I GDGIG E+  + K + +   ++  +++ F D+   F     T   +P
Sbjct: 18  NAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDLYAGFQTFQETGKALP 77

Query: 90  DPAVASINKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSIEGFKTTYS 146
           D  V  + +    AL G + +P  K  G+ S  + LR+   LFANVRP KS+EG K    
Sbjct: 78  DETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGEKG--K 135

Query: 147 DVDLVLIRENTEGEYSGIEHVV---APG--VVQSIKLITRDASERVIRYAFEYA----KA 197
            +D+V++RENTE  Y  IE      A G  V  + K I+  A+ R+   A + A    + 
Sbjct: 136 PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIALDIALKRLQT 195

Query: 198 IGRPRVVVVHKSTIQRLADGLFVNVAKELSK----EYPEIKLETELIDNTVLNVVSNPAG 253
            G+  + V HKS +   +DGLF  + KE+ +    +Y +IK   +++D+ V  +   P  
Sbjct: 196 RGQATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQC 255

Query: 254 YTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFEAVHGSAPDIAGQNKAN 313
           +   V V PNLYGDI                  AN+G EI I E  HGSAPDIAG+  AN
Sbjct: 256 FD--VIVAPNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGIAN 312

Query: 314 PTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373
           P A + S+ +ML  +G  + A  I +AV   +   S  +T DLGG A+T    D V+  L
Sbjct: 313 PIATIRSTALMLEFLGHNEAAQDIYKAVDANLREGSI-KTPDLGGKASTQQVVDDVLSRL 371

>KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score =  155 bits (393), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 119/360 (33%), Positives = 181/360 (50%), Gaps = 27/360 (7%)

Query: 35  NPATGKFDVSFIEGDGIGPEISQSVKDIFKA--AEVPINWEFCDVTPIFVNGLTT---IP 89
           N A     +  I GDGIG E+  + K + ++   +  +N++F D+   F     T   +P
Sbjct: 19  NAARKSLTIGLIPGDGIGKEVIPAGKQVLQSLNPKHGLNFDFIDLQAGFQTFQDTGKALP 78

Query: 90  DPAVASINKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSIEGFKTTYS 146
           D  V  + +    AL G + +P  K  G+ S  + LRK   L+AN+RP KS+EG  +   
Sbjct: 79  DETVQILKEKCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLYANIRPVKSVEG--SNER 136

Query: 147 DVDLVLIRENTEGEYSGIEHVV---APG--VVQSIKLITRDASERVIRYAFEYA----KA 197
            VD++++RENTE  Y  IE      A G  V ++ K I+  A++R+   A + A    + 
Sbjct: 137 PVDMIIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATQRIATIALDIALQRLQN 196

Query: 198 IGRPRVVVVHKSTIQRLADGLFVNVAKELSK----EYPEIKLETELIDNTVLNVVSNPAG 253
            G+  + V HKS +   +DGLF  V +E+ +    +Y  I    +++D+ V  +   P  
Sbjct: 197 NGKATLTVTHKSNVLSQSDGLFREVCREMYEANKDKYAGITYNEQIVDSMVYRMFREPEC 256

Query: 254 YTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFEAVHGSAPDIAGQNKAN 313
           +   V V PNLYGDI                  AN+G EI I E  HGSAPDIAG+  AN
Sbjct: 257 FD--VIVAPNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGIAN 313

Query: 314 PTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373
           P A + S+ +ML  +G  + A  I +AV   +      +T DLGG+ATT +  D ++  L
Sbjct: 314 PIATIRSTALMLEFLGHNEAAQDIHKAVDANL-RDGLVKTADLGGNATTQNVVDDILARL 372

>Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  154 bits (390), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 120/360 (33%), Positives = 178/360 (49%), Gaps = 27/360 (7%)

Query: 35  NPATGKFDVSFIEGDGIGPEISQSVKDIFKA--AEVPINWEFCDVTPIFVNGLTT---IP 89
           N A     +  I GDGIG E+  + K I +   ++  +++ F D+   F     T   +P
Sbjct: 18  NAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFIDLYAGFQTFQETGKALP 77

Query: 90  DPAVASINKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSIEGFKTTYS 146
           D  +  +      AL G + +P  K  G+ S  + LR+   L+ANVRP KS+EG K    
Sbjct: 78  DETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLYANVRPVKSVEGTKD--K 135

Query: 147 DVDLVLIRENTEGEYSGIEHVV---APG--VVQSIKLITRDASERVIRYAFEYA----KA 197
            +D+V++RENTE  Y  IE      A G  V  +IK I+  A+ R+ + A + A    + 
Sbjct: 136 PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQT 195

Query: 198 IGRPRVVVVHKSTIQRLADGLFVNVAKELSK----EYPEIKLETELIDNTVLNVVSNPAG 253
            G   + V HKS +   +DGLF  + K++ +    +Y +IK   +++D+ V  +   P  
Sbjct: 196 RGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFREPQC 255

Query: 254 YTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFEAVHGSAPDIAGQNKAN 313
           +   V V PNLYGDI                  AN+G +I I E  HGSAPDIAG+  AN
Sbjct: 256 FD--VIVAPNLYGDILSDGAAALVGSLGVVPS-ANVGPDIVIGEPCHGSAPDIAGKGIAN 312

Query: 314 PTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373
           P A + S+ +ML  +G  D A  I +AV   +   +   T DLGG A+T    D V+  L
Sbjct: 313 PIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAIT-TPDLGGKASTQQVVDDVLSRL 371

>ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL094C
           (LYS12)
          Length = 367

 Score =  153 bits (387), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 119/366 (32%), Positives = 180/366 (49%), Gaps = 35/366 (9%)

Query: 33  KPNPATGK-FDVSFIEGDGIGPEI----SQSVKDIFKAAEVPINWEFCDV-TPIFVNGLT 86
           K   AT K   +  I GDGIG E+     + ++ I K  ++  ++E  D     F+    
Sbjct: 12  KATYATSKTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGN 71

Query: 87  TIPDPAVASINKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSIEGFKT 143
            +P   V ++ +    AL G + +P  K  G+ S  + LR+   L+AN+RP KS+ G   
Sbjct: 72  ALPGATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSG--- 128

Query: 144 TYSDVDLVLIRENTEGEY-----SGIEHVVAPGVVQSIKLITRDASERV----IRYAFEY 194
           T   VDLV++RENTE  Y     + ++      V ++IK I+  A+ER+    +R A + 
Sbjct: 129 TGQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQR 188

Query: 195 AKAIGRPRVVVVHKSTIQRLADGLFVNVAKEL----SKEYPEIKLETELIDNTVLNVVSN 250
            +  GR  + V HKS +    DGLF  V +E+     K Y  I+   +++D+ V  +   
Sbjct: 189 QRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKE 248

Query: 251 PAGYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFEAVHGSAPDIAGQN 310
           P  +   V V PNLYGD+                   N+GN I I E  HGSAPDIAG+ 
Sbjct: 249 PHCFD--VVVAPNLYGDLLSDGAAALVGSLGLVPS-VNVGNNIIIGEPCHGSAPDIAGRG 305

Query: 311 KANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNR---TGDLGGSATTSSFTD 367
            ANP A + S  +ML  +GL + AS I++AV   +    K+R   + DLGG  TT    D
Sbjct: 306 IANPIATIRSVSLMLQFLGLEEAASDIDQAVTGNL----KDRQVVSPDLGGKNTTQEVLD 361

Query: 368 AVIKNL 373
            ++  +
Sbjct: 362 DILARI 367

>ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  153 bits (386), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 112/352 (31%), Positives = 177/352 (50%), Gaps = 27/352 (7%)

Query: 43  VSFIEGDGIGPEISQSVKDIFKA--AEVPINWEFCDVTP---IFVNGLTTIPDPAVASIN 97
           +  I GDGIG E+  + K + +A  ++  + ++F D+      F      +PD  V  + 
Sbjct: 23  IGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTVKVLK 82

Query: 98  KNLI-ALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIR 154
           +    AL G + +P  K  G+ S  + LRK   L+ANVRP KS+E  K    +VD++++R
Sbjct: 83  EQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVE--KGNDRNVDMIIVR 140

Query: 155 ENTEGEY-----SGIEHVVAPGVVQSIKLITRDASERVIRYAFEYA----KAIGRPRVVV 205
           ENTE  Y     + ++      V ++IK I+  A+ ++   A + +    K+ G   + V
Sbjct: 141 ENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATLTV 200

Query: 206 VHKSTIQRLADGLFVNVAKELSKE----YPEIKLETELIDNTVLNVVSNPAGYTDAVSVC 261
            HKS +   +DGLF  + K++ ++    Y E+K   +++D+ V  +   P  +   V V 
Sbjct: 201 THKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFD--VVVA 258

Query: 262 PNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFEAVHGSAPDIAGQNKANPTALLLSS 321
           PNLYGDI                  AN+G EI I E  HGSAPDIAG+  +NP A + S+
Sbjct: 259 PNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRST 317

Query: 322 VMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373
            +ML  +G  + A  I +AV   +     N T DLGG ATT    D ++  +
Sbjct: 318 ALMLEFLGHPEPAQDIYKAVDANLIKGDVN-TPDLGGKATTQQVVDDILSKI 368

>SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  153 bits (386), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 114/352 (32%), Positives = 180/352 (51%), Gaps = 27/352 (7%)

Query: 43  VSFIEGDGIGPEISQSVKDIFK--AAEVPINWEFCDVTP---IFVNGLTTIPDPAVASIN 97
           +  I GDGIG E+  + K + +  +++  + + F D+      F++    +PD  +  + 
Sbjct: 23  IGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDLQAGWQTFLDTGKALPDETIEILK 82

Query: 98  KNLI-ALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIR 154
            +   AL G + +P  K  G+ S  + LRK   L+ANVRP KS++G  T    VD++++R
Sbjct: 83  SDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVQG--TNDRPVDMIIVR 140

Query: 155 ENTEGEY-----SGIEHVVAPGVVQSIKLITRDASERVIRYAFEYA----KAIGRPRVVV 205
           ENTE  Y     + I+      V ++IK I+  A+  + + A E +    KA G+  + V
Sbjct: 141 ENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAKIALEISLQRLKANGKATLTV 200

Query: 206 VHKSTIQRLADGLFVNVAK---ELSKE-YPEIKLETELIDNTVLNVVSNPAGYTDAVSVC 261
            HKS +   +DGLF  V K   E +KE Y  I    +++D+ V  +   P  +   V V 
Sbjct: 201 THKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVDSMVYRLFREPECFD--VIVA 258

Query: 262 PNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFEAVHGSAPDIAGQNKANPTALLLSS 321
           PNLYGDI                  AN+G++  + E  HGSAPDIAG+  +NP A + S+
Sbjct: 259 PNLYGDILSDGAAALVGSLGVVPS-ANVGHDFIVGEPCHGSAPDIAGKGISNPIATIRST 317

Query: 322 VMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373
            +ML  MG  + A  I +AV T I   ++ +T DLGG +TT    D ++  +
Sbjct: 318 ALMLEFMGYTEAAQDIHKAVDTNI-RENQIKTPDLGGKSTTQQVVDDILSKM 368

>Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  152 bits (384), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 120/360 (33%), Positives = 178/360 (49%), Gaps = 27/360 (7%)

Query: 35  NPATGKFDVSFIEGDGIGPEISQSVKDIFKA--AEVPINWEFCDVTPIFVNGLTT---IP 89
           N A     +  I GDGIG E+  + K + +   ++  +++ F D+   F     T   +P
Sbjct: 18  NAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDLYAGFQTFQETGKALP 77

Query: 90  DPAVASINKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSIEGFKTTYS 146
           D  V  + +    AL G + +P  K  G+ S  + LR+   LFANVRP KS+EG K    
Sbjct: 78  DETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGGKD--K 135

Query: 147 DVDLVLIRENTEGEYSGIEHVV---APG--VVQSIKLITRDASERVIRYAFEYA----KA 197
            +D+V++RENTE  Y  IE      A G  V  + K I+  A+ R+   A + A    + 
Sbjct: 136 PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIAMDIALKRLQT 195

Query: 198 IGRPRVVVVHKSTIQRLADGLFVNVAKELSK----EYPEIKLETELIDNTVLNVVSNPAG 253
            G   + V HKS +   +DGLF  + KE+ +    +Y +IK   +++D+ V  +   P  
Sbjct: 196 RGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQC 255

Query: 254 YTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFEAVHGSAPDIAGQNKAN 313
           +   V V PNLYGDI                  AN+G EI I E  HGSAPDIAG+  AN
Sbjct: 256 FD--VIVAPNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGIAN 312

Query: 314 PTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373
           P A + S+ +ML  +G  + A  I +AV   +   +  +T DLGG A+T    + V+  L
Sbjct: 313 PIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAI-KTPDLGGKASTQQVVEDVLSRL 371

>Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  152 bits (383), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 121/360 (33%), Positives = 175/360 (48%), Gaps = 27/360 (7%)

Query: 35  NPATGKFDVSFIEGDGIGPEISQSVKDIFKA--AEVPINWEFCDVTPIFVNGLTT---IP 89
           N A     +  I GDGIG E+  + K + +   ++  +++ F D+   F     T   +P
Sbjct: 18  NAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDLYAGFQTFQETGKALP 77

Query: 90  DPAVASINKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSIEGFKTTYS 146
           D  V  + K    AL G + +P  K  G+ S  + LR+   LFANVRP KS+EG +    
Sbjct: 78  DETVNVLKKQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGSRN--K 135

Query: 147 DVDLVLIRENTEGEYSGIEHVV---APG--VVQSIKLITRDASERVIRYAFEYA----KA 197
            +D+V++RENTE  Y  IE      A G  V  + K I+  A+ R+   A + A    + 
Sbjct: 136 PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIALDIALKRLQT 195

Query: 198 IGRPRVVVVHKSTIQRLADGLFVNVAKELSK----EYPEIKLETELIDNTVLNVVSNPAG 253
            G   + V HKS +    DGLF  + KE+ +    +Y +IK   +++D+ V  +   P  
Sbjct: 196 RGEATLTVTHKSNVLSQTDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQC 255

Query: 254 YTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFEAVHGSAPDIAGQNKAN 313
           +   V V PNLYGDI                  AN+G EI I E  HGSAPDIAG+  AN
Sbjct: 256 FD--VIVAPNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGIAN 312

Query: 314 PTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373
           P A + S+ +ML  +G    A  I +AV   +   +   T DLGG A+T    D V+  L
Sbjct: 313 PIATIRSTALMLEFLGHNGAAQDIYKAVDANLREGAIT-TPDLGGKASTQQVVDDVLSRL 371

>KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2.287
           YIL094C
          Length = 373

 Score =  150 bits (378), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 113/351 (32%), Positives = 179/351 (50%), Gaps = 25/351 (7%)

Query: 43  VSFIEGDGIGPEISQSVKDIFK--AAEVPINWEFCDVTPIFVNGLTT---IPDPAVASIN 97
           +  I GDGIG E+  + K + +  ++   +N+ F D+   F   L T   +PD  V  + 
Sbjct: 26  IGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFIDLEAGFQTFLDTGKALPDETVKVLK 85

Query: 98  KNLIA-LKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIR 154
           +     L G + +P  +   + S  + LRK   L+AN+RP KS+ G  +    VD+V++R
Sbjct: 86  EQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLYANIRPVKSVAGAHSG-KPVDMVIVR 144

Query: 155 ENTEGEYSGIEHVVAPG----VVQSIKLITRDASERVIRYAFEYA----KAIGRPRVVVV 206
           ENTE  Y  IE          V ++ K IT  A+ ++ + A + A    K  G+  + V 
Sbjct: 145 ENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQRLKTNGKATLTVT 204

Query: 207 HKSTIQRLADGLFVNVAKELSK----EYPEIKLETELIDNTVLNVVSNPAGYTDAVSVCP 262
           HKS +   +DGLF  + K++ +    +Y  I    ++ID+ V  +   P  Y D + V P
Sbjct: 205 HKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFREPE-YFDVI-VAP 262

Query: 263 NLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFEAVHGSAPDIAGQNKANPTALLLSSV 322
           NLYGDI                  AN+G +I + E  HGSAPDIAG+  ANP A + S+ 
Sbjct: 263 NLYGDILSDGAAALVGSLGVVPS-ANVGPDIVMGEPCHGSAPDIAGKGIANPIATIRSTA 321

Query: 323 MMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373
           +ML  +G  + A  I +AV + +   +K +T DLGG+++T +  D V++ L
Sbjct: 322 LMLEFLGHKEAAQDIHKAVESNM-RENKIKTPDLGGNSSTQNVVDDVLEKL 371

>TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {ON}
           Anc_2.287 YIL094C
          Length = 369

 Score =  149 bits (377), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 116/352 (32%), Positives = 177/352 (50%), Gaps = 27/352 (7%)

Query: 43  VSFIEGDGIGPEISQSVKDIFK--AAEVPINWEFCDVTP---IFVNGLTTIPDPAVASI- 96
           +  I GDGIG E+  + K + +  + +  +N++F D+      F      +P+  V  + 
Sbjct: 24  IGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFIDLQAGWGTFQETGKALPEQTVQVLK 83

Query: 97  NKNLIALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIR 154
           N+   AL G + +P  K  G+ S  + LRK   L+ANVRP KS+EG K     VD+V++R
Sbjct: 84  NQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLYANVRPVKSVEGTKD--RPVDMVIVR 141

Query: 155 ENTEGEYSGIEHVV---APG--VVQSIKLITRDASERVIRYAFEYA----KAIGRPRVVV 205
           ENTE  Y  +E      A G  V ++ K I+  A+ R+   A + A    K  G   + V
Sbjct: 142 ENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIATIALDIALQRLKTNGHATLTV 201

Query: 206 VHKSTIQRLADGLFVNVAKELSK----EYPEIKLETELIDNTVLNVVSNPAGYTDAVSVC 261
            HKS +   +DGLF  + K++ +    +Y ++    +++D+ V  +   P  +   V V 
Sbjct: 202 THKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIVDSMVYRMFREPECFD--VVVA 259

Query: 262 PNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFEAVHGSAPDIAGQNKANPTALLLSS 321
           PNLYGDI                  AN+G EI I E  HGSAPDIAG+  +NP A + S+
Sbjct: 260 PNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRST 318

Query: 322 VMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373
            +ML  +G    A  I RAV   +    K +T DLGG++TT    + ++  L
Sbjct: 319 GLMLEFLGHNKPAQDIYRAVDANL-REDKVKTPDLGGNSTTQQVVEDILSKL 369

>KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 369

 Score =  149 bits (376), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 126/392 (32%), Positives = 186/392 (47%), Gaps = 48/392 (12%)

Query: 6   LLRNSFT--ARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVKDIF 63
           ++R  F   +RR  A++ KN                   +  I GDGIG E+  + K I 
Sbjct: 1   MMRTRFIQLSRRAYASNAKN-----------------LTIGLIPGDGIGKEVIPAGKKIL 43

Query: 64  KA--AEVPINWEFCDVTP---IFVNGLTTIPDPAVASINKNLI--ALKGPLATPIGK--G 114
           ++   +  ++++F D+      F N    +PD  +  I KN    AL G + +P  K  G
Sbjct: 44  ESLNPKYGLSFKFIDLQAGWETFQNTGKALPDETI-DILKNQCEGALFGAVQSPTTKVEG 102

Query: 115 HRSLNLTLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEY-----SGIEHVVA 169
           + S  + LRK   LFANVRP KS++G K     VDLV++RENTE  Y     S I+    
Sbjct: 103 YSSPIVALRKNLGLFANVRPVKSVDGTKD--RKVDLVIVRENTEDLYIKLEKSYIDEATG 160

Query: 170 PGVVQSIKLITRDASERVIRYAFEYAKAI----GRPRVVVVHKSTIQRLADGLFVNVAKE 225
             V  + K IT  A++ +   A + A+      G   + V HKS +   +DGLF  V +E
Sbjct: 161 TRVADATKRITEIATKNIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRE 220

Query: 226 LSK----EYPEIKLETELIDNTVLNVVSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXXXX 281
             +    +Y  ++   +++D+ V  +   P  +   V V PNLYGDI             
Sbjct: 221 TYEANKDKYGGVQYNEQIVDSMVYRMFREPECFD--VVVAPNLYGDILSDGAAALVGSLG 278

Query: 282 XXXXXANIGNEISIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAV 341
                AN+G  I I E  HGSAPDIAG+  +NP A + S+ +ML  +G  + A  I +AV
Sbjct: 279 VVPS-ANVGPNIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAV 337

Query: 342 LTTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373
              I    K  T DLGG++TT    + V+  L
Sbjct: 338 DANI-REGKYLTPDLGGNSTTQQVLEDVLSKL 368

>TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {ON}
           Anc_2.287 YIL094C
          Length = 371

 Score =  148 bits (374), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 125/391 (31%), Positives = 189/391 (48%), Gaps = 43/391 (10%)

Query: 6   LLRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVKDIFK- 64
           +LR S   R+F       Q +IG  + K N       +  I GDGIG E+  S + + + 
Sbjct: 1   MLRRSVYNRQF-------QRTIGNISKKSN-----LTIGLIPGDGIGKEVIPSGRQVLET 48

Query: 65  -AAEVPINWEFCDVT---PIFVNGLTTIPDPAVASINKNLI-ALKGPLATPIGK--GHRS 117
              +  + + F D+      F++    +P   V ++ +N   AL G + +P  K  G+ S
Sbjct: 49  IGPKHGLTFNFIDLQAGWQTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSS 108

Query: 118 LNLTLRKTFNLFANVRPAKSIE--GFKTTYSDVDLVLIRENTEGEYSGIEHV-----VAP 170
             + LRK   L+AN+RP KS++  G K     VD+V++RENTE  Y  +E          
Sbjct: 109 PIVALRKELGLYANIRPVKSVDTPGNKK----VDMVIVRENTEDLYIKLEKTYIDEKTGT 164

Query: 171 GVVQSIKLITRDASERVIRYAFEYA----KAIGRPRVVVVHKSTIQRLADGLFVNVAKEL 226
            V  + K I+  A+ R+ + A + A    K  G  ++ V HKS +   +DGLF  V KE+
Sbjct: 165 RVADATKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEV 224

Query: 227 SKE----YPEIKLETELIDNTVLNVVSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXXXXX 282
            +     Y +I+   ++ID+ V  +   P  +   V V PNLYGDI              
Sbjct: 225 FESNKTLYSDIQYNEQIIDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAALVGSLGV 282

Query: 283 XXXXANIGNEISIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVL 342
               AN+G  I I E  HGSAPDIAG+  +NP A + S+ +ML  +G    A  I+ AV 
Sbjct: 283 VPS-ANVGPGIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVD 341

Query: 343 TTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373
           + +    K +T DLGG  +TS   + VI+ L
Sbjct: 342 SNL-REDKIKTPDLGGKNSTSDVVNDVIRRL 371

>Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii ADL214C
          Length = 366

 Score =  147 bits (372), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 111/366 (30%), Positives = 179/366 (48%), Gaps = 26/366 (7%)

Query: 28  GRFTGKPNPATGKFDVSFIEGDGIGPEISQSVKDIFK--AAEVPINWEFCDVTP---IFV 82
           G+ + +    +  F +  I GDGIG E+    + + +    +  +++++ D+      F+
Sbjct: 7   GQLSTRTYVTSKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFL 66

Query: 83  NGLTTIPDPAVASINKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSIE 139
           +    +PD  V  +  N   AL G + +P  K  G+ S  + LRK   L+AN+RP KS++
Sbjct: 67  DTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVD 126

Query: 140 GFKTTYSDVDLVLIRENTEGEY-----SGIEHVVAPGVVQSIKLITRDASERVIRYAFEY 194
           G  T    VDLV+ RENTE  Y     + I+      V ++IK I+  A+  +   A E 
Sbjct: 127 G--TGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEI 184

Query: 195 A----KAIGRPRVVVVHKSTIQRLADGLFVNVAKEL---SKEYPEIKLETELIDNTVLNV 247
           A    K  G   + V HKS +   +DGLF  + K +   +K++  ++   +++D+ V  +
Sbjct: 185 ALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRL 244

Query: 248 VSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFEAVHGSAPDIA 307
              P  +   V V PNLYGDI                   N+G  I I E  HGSAPDI 
Sbjct: 245 FKEPQCFD--VIVAPNLYGDILSDGAAALVGSLGVVPS-VNVGPNIVIGEPCHGSAPDIV 301

Query: 308 GQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTD 367
           GQ  ANP A + S+ ++L  +GL + A  IE+ V   I   +K +T DLGG++T     +
Sbjct: 302 GQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENI-RENKIKTPDLGGNSTGEQVAN 360

Query: 368 AVIKNL 373
            ++  +
Sbjct: 361 DILSRI 366

>KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 367

 Score =  142 bits (359), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 117/391 (29%), Positives = 188/391 (48%), Gaps = 47/391 (12%)

Query: 6   LLRNSFT--ARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVKDIF 63
           +LR SFT  ARR  A++ K+                   +  I GDGIG E+  + + + 
Sbjct: 1   MLRASFTQLARRSYASASKS-----------------LTIGLIPGDGIGKEVIPAGRQVL 43

Query: 64  K--AAEVPINWEFCDVT---PIFVNGLTTIPDPAVASI-NKNLIALKGPLATPIGK--GH 115
           +  +++  + ++F D+      F      +PD  +  + N+   AL G + +P  K  G+
Sbjct: 44  ENLSSKHGLKFDFIDLQAGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGY 103

Query: 116 RSLNLTLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEY-----SGIEHVVAP 170
            S  + LRK   L+ANVRP KS+         VD++++RENTE  Y     + I+     
Sbjct: 104 SSPIVALRKKLGLYANVRPVKSV---LPQERPVDMIIVRENTEDLYIKTEKTYIDEKTGT 160

Query: 171 GVVQSIKLITRDASERVIRYAFEYA----KAIGRPRVVVVHKSTIQRLADGLFVNVAKEL 226
            V ++IK I+  A++ +   A E A    K  G   + V HKS +   +DGLF  V +++
Sbjct: 161 RVAEAIKRISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQV 220

Query: 227 SK----EYPEIKLETELIDNTVLNVVSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXXXXX 282
            +    ++  IK   +++D+ V  +   P  +   V V PNLYGDI              
Sbjct: 221 YESNKDKFGSIKYNEQIVDSMVYRMFREPECFD--VIVAPNLYGDILSDGAAALVGSLGV 278

Query: 283 XXXXANIGNEISIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVL 342
               AN+G +  + E  HGSAPDIAG+  +NP A + S+ +ML  MG  + A  I +AV 
Sbjct: 279 VPS-ANVGFDFVVGEPCHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVD 337

Query: 343 TTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373
             +  +S  +T DLGG +TT    + V+  +
Sbjct: 338 ANLRDNSI-KTPDLGGKSTTQQVVEDVLSRM 367

>Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094C
           (LYS12) - Homo-isocitrate dehydrogenase [contig 27] FULL
          Length = 367

 Score =  139 bits (349), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 108/358 (30%), Positives = 175/358 (48%), Gaps = 28/358 (7%)

Query: 37  ATGKFDVSFIEGDGIGPEISQSVKDIFK--AAEVPINWEFCDVTP---IFVNGLTTIPDP 91
           AT    +  I GDGIG E+  + K + +  +++  + + F D+      F++    +PD 
Sbjct: 17  ATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLEAGWQTFLDTGKALPDE 76

Query: 92  AVASI-NKNLIALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSIEGFKTTYSDV 148
            +  + N+   AL G + +P  K  G+ S  + LRK   L+ANVRP KS+    +    +
Sbjct: 77  TIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSV---LSQEKPI 133

Query: 149 DLVLIRENTEGEY-----SGIEHVVAPGVVQSIKLITRDASERVIRYAFEYA----KAIG 199
           D+V++RENTE  Y     + I+      V ++IK I+  A+  +   A E A    K  G
Sbjct: 134 DMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIALQRQKVNG 193

Query: 200 RPRVVVVHKSTIQRLADGLFVNVAKEL----SKEYPEIKLETELIDNTVLNVVSNPAGYT 255
              + V HKS +   +DGLF  + +++      ++  I    +++D+ V  +   P  + 
Sbjct: 194 SATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLFREPECFD 253

Query: 256 DAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEISIFEAVHGSAPDIAGQNKANPT 315
             V V PNLYGDI                  AN+G +  + E  HGSAPDIAG+  +NP 
Sbjct: 254 --VIVAPNLYGDILSDGAAALVGSLGVVPS-ANVGFDFVVGEPCHGSAPDIAGKGISNPV 310

Query: 316 ALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373
           A + S+ +ML  MG  + A  I +AV   +  ++  +T DLGG +TT    D V+  +
Sbjct: 311 ATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTV-KTPDLGGKSTTQQVVDDVLSRM 367

>Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar to
           Ashbya gossypii AAL012C
          Length = 363

 Score = 92.4 bits (228), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 79/276 (28%), Positives = 126/276 (45%), Gaps = 32/276 (11%)

Query: 120 LTLRKTFNLFANVRP----AKSIEGFKTTYSDV----DLVLIRENTEGEYSG-IEHVVAP 170
           L +RK   L+AN+RP    +KS+ G      ++    D V++RE   G Y G  +     
Sbjct: 94  LAIRKELGLYANLRPCSFISKSLLGLSPLKPEIAQGTDFVILRELVGGIYFGERKEDDGD 153

Query: 171 GVVQSIKLITRDASERVIRYAFEYAKAIGRP-------RVVVVHKSTIQRLADGLFVNVA 223
           GV    +  T    ER+ R     A     P       +  V+  S + R        V 
Sbjct: 154 GVAWDSEKYTVSEVERITRMGAFLALQHDPPLPLWSFDKANVLASSRLWRR------TVN 207

Query: 224 KELSKEYPEIKLETELIDNTVLNVVSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXX---- 279
           + + +E+P++ ++ +LID+  + ++ NP  + + + +  N++GDI               
Sbjct: 208 ETIKREFPQLSVQHQLIDSAAMIMIKNPRKF-NGIVITSNIFGDIISDAASVIPGSLGLL 266

Query: 280 -XXXXXXXANIGNEISIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLVDQASRI 337
                    +  N   ++E  HGSAPD+  + +ANP A +LS+ MML   + +VD+   I
Sbjct: 267 PSASLASEPDKNNAFGLYEPCHGSAPDLE-KGQANPIACILSAAMMLKLSLNMVDEGKAI 325

Query: 338 ERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373
           E AV   I S    RTGDLGG+ TT+   DAV   L
Sbjct: 326 ENAVKQVIESGI--RTGDLGGNNTTTEVGDAVTHAL 359

>TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON}
           Anc_1.402 YCL018W
          Length = 362

 Score = 92.0 bits (227), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 97/358 (27%), Positives = 157/358 (43%), Gaps = 34/358 (9%)

Query: 42  DVSFIEGDGIGPEISQSVKDIFKA-AEVPINWEFCDVTPIFVNGLTT------IPDPAVA 94
           ++  + GD +G EI++    + KA +EV  N  F +     + G         +PD A+ 
Sbjct: 4   NIVVLPGDHVGQEITEEAIKVLKAISEVRPNATF-NFQHHLIGGAAIDATGVPLPDEALE 62

Query: 95  SINKNLIALKGPLATP-IGKG----HRSLNLTLRKTFNLFANVRPAK-------SIEGFK 142
           +  K    L G +  P  G G     + L L +RK   L+AN+RP          +   K
Sbjct: 63  ASKKADAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELQLYANLRPCNFASDSLLELSPLK 121

Query: 143 TTYSD-VDLVLIRENTEGEYSG-IEHVVAPGVVQSIKLITRDASERVIRYAFEYAKAIGR 200
             Y+   D V++RE   G Y G  +     GV    +  +    +R+ R A   A     
Sbjct: 122 AQYAQGTDFVVVRELVGGIYFGERKEDEGDGVAWDSEQYSVPEVQRITRMAAFLALQHNP 181

Query: 201 PR-VVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELIDNTVLNVVSNPAGYTDAVS 259
           P  +  + K+ +   +      V K + +E+P + +  +LID+  + +V NP    + + 
Sbjct: 182 PLPIWSLDKANVLASSRLWRKTVEKTIKEEFPTLSVNHQLIDSAAMILVKNPT-QLNGII 240

Query: 260 VCPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGNEISIFEAVHGSAPDIAGQNKANP 314
           +  N++GDI                        +      ++E  HGSAPD+A + K NP
Sbjct: 241 ITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLA-KGKVNP 299

Query: 315 TALLLSSVMMLN-HMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIK 371
            A +LS+ MML   + +V++   IE+AV   +      RTGDLGGS +TS   DAV K
Sbjct: 300 VATILSAAMMLKLSLNMVEEGVAIEKAVKKVLDDGI--RTGDLGGSNSTSEVGDAVAK 355

>AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL018W
           (LEU2)
          Length = 372

 Score = 90.9 bits (224), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 92/351 (26%), Positives = 148/351 (42%), Gaps = 32/351 (9%)

Query: 46  IEGDGIGPEISQSVKDIFKAAEVPINWEFCDVTPIFVNGL------TTIPDPAVASINKN 99
           + GD IG E+ +    +  A E  ++    D     V G       + +PD A+ +  + 
Sbjct: 10  LPGDHIGREVVEEAVKVLGAVEQSLSDVHFDFQYHLVGGAAIDATGSALPDEALGAAKEA 69

Query: 100 LIALKGPLATPIGKG-----HRSLNLTLRKTFNLFANVRPAKSIEGFKTTYS-------- 146
              L G +  P  +G      + L L LR+   ++AN+RP           S        
Sbjct: 70  DAVLLGAVGGPKWQGGAVRPEQGL-LKLRQELGVYANLRPCNFAADSLLELSPLRPEIAR 128

Query: 147 DVDLVLIRENTEGEYSGIEHV-VAPGVVQSIKLITRDASERVIRYAFEYAKAIGRPR-VV 204
           D D++++RE   G Y G  H     GV       T    +R+ R A   A     P  V 
Sbjct: 129 DTDIMVVRELLGGSYFGERHEDEGDGVAWDTDKYTVKEVQRIARMAGFLALQHDPPLPVW 188

Query: 205 VVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELIDNTVLNVVSNPAGYTDAVSVCPNL 264
            + K+ +   +      V +    E+P ++L+ +LID+  + +V NP  + + V V  N+
Sbjct: 189 SLDKANVLASSRLWRKTVEETFQSEFPNVQLQHQLIDSAAMILVKNPRAF-NGVVVTSNM 247

Query: 265 YGDIXXXXXXXXXXX-----XXXXXXXANIGNEISIFEAVHGSAPDIAGQNKANPTALLL 319
           +GDI                        +  +   ++E  HGSAPD+    KANP   +L
Sbjct: 248 FGDIISDEASVIPGSLGLLPSASLASLPDSKSAFGLYEPCHGSAPDLPA-GKANPIGCIL 306

Query: 320 SSVMMLN-HMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAV 369
           S+ MML   + +V     +E+AV   +   S  RTGDL GS++TS   DA+
Sbjct: 307 SAAMMLKLSLNMVAAGEAVEQAVQEVL--DSGVRTGDLLGSSSTSEVGDAI 355

>Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score = 89.4 bits (220), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 96/359 (26%), Positives = 158/359 (44%), Gaps = 34/359 (9%)

Query: 43  VSFIEGDGIGPEISQSVKDIFKA-AEVPINWEFCDVTPIFVNGLTT------IPDPAVAS 95
           +  + GD +G EI+     + KA ++V  N +F D     + G         +PD A+ +
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISDVRSNVKF-DFENHLIGGAAIDATGVPLPDEALEA 65

Query: 96  INKNLIALKGPLATP-IGKG----HRSLNLTLRKTFNLFANVRPAK-------SIEGFKT 143
             K    L G +  P  G G     + L L +RK   L+AN+RP          +   K 
Sbjct: 66  SKKADAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASESLLDLSPIKP 124

Query: 144 TYSD-VDLVLIRENTEGEYSG-IEHVVAPGVVQSIKLITRDASERVIRYAFEYAKAIGRP 201
            ++   D V++RE   G Y G  +     GV    +  T    +R+ R A   A     P
Sbjct: 125 QFAKGTDFVVVRELVGGIYFGERKEDDGDGVAWDCEQYTVPEVQRITRMAAFMALQHEPP 184

Query: 202 R-VVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELIDNTVLNVVSNPAGYTDAVSV 260
             +  + K+ +   +      V + +  E+P +K++ +LID+  + +V NP  + + + +
Sbjct: 185 LPIWSLDKANVLASSRLWRKTVEETIKNEFPTLKVQHQLIDSAAMILVKNPT-HLNGIII 243

Query: 261 CPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGNEISIFEAVHGSAPDIAGQNKANPT 315
             N++GDI                        +      ++E  HGSAPD+  +NK NP 
Sbjct: 244 TSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KNKVNPV 302

Query: 316 ALLLSSVMMLN-HMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373
           A +LS+ MML   + L ++   IE AV   + +    RTGDLGGS +T+   DAV K +
Sbjct: 303 ATILSAAMMLKLSLNLPEEGKAIEDAVKRVLDAGI--RTGDLGGSNSTTEVGDAVAKEV 359

>TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score = 88.6 bits (218), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 93/359 (25%), Positives = 157/359 (43%), Gaps = 33/359 (9%)

Query: 42  DVSFIEGDGIGPEISQSVKDIFKAAE-----VPINWEFCDVTPIFVNGL-TTIPDPAVAS 95
           ++  + GD +G EI +    + K  E     V  N+++  +    ++     +PD  + +
Sbjct: 6   NIVVLPGDHVGQEIVEEAVKVLKIVEEKRHGVKFNFQYHLIGGDAIDKTGDPLPDETLEA 65

Query: 96  INKNLIALKGPLATP-IGKG----HRSLNLTLRKTFNLFANVRPAKSIE----GFKTTYS 146
             ++   L G +  P  G G     + L L +RK   L+ N+RP K I     G      
Sbjct: 66  AKQSDAVLLGAVGGPKWGTGKVRPEQGL-LKIRKELGLYGNLRPCKFISDKLIGLSPLKE 124

Query: 147 DV----DLVLIRENTEGEYSG-IEHVVAPGVVQSIKLITRDASERVIRYAFEYAKAIGRP 201
           +V    D V++RE   G Y G  +     GV    +  + +  +R+ + A  +      P
Sbjct: 125 EVCKGTDFVVVRELVGGIYFGERQEDDGSGVAWDSEKYSIEEVKRITKMA-AFLSLQNDP 183

Query: 202 RVVVVHKSTIQRLADG-LFVNVAKELSKEYPEIKLETELIDNTVLNVVSNPAGYTDAVSV 260
            + +        LA   L+     E   E+P +K++ +LID+  + +V NP    + + +
Sbjct: 184 PLPIWSLDKANVLASSRLWRAAVDETIAEFPNLKVQHQLIDSAAMMLVKNPT-QLNGIIL 242

Query: 261 CPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGNEISIFEAVHGSAPDIAGQNKANPT 315
             N++GDI                        +      ++E  HGSAPD+A + K NP 
Sbjct: 243 TNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNKAFGLYEPCHGSAPDLA-RGKVNPV 301

Query: 316 ALLLSSVMMLN-HMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373
           A +LS+ MML   + +V +   IERAV  ++      RT DLGG++TTS   DAV + L
Sbjct: 302 ATILSAAMMLKLSLDMVQEGEAIERAV--SVVLDRGIRTADLGGNSTTSELGDAVAQEL 358

>Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score = 87.8 bits (216), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 97/362 (26%), Positives = 156/362 (43%), Gaps = 40/362 (11%)

Query: 43  VSFIEGDGIGPEISQSVKDIFKAAEVPINWEFCDVTPIFVNGL----------TTIPDPA 92
           +  + GD +G EI+     + KA    I+    DV   F N L            +PD A
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKA----ISEVRSDVNFDFENHLIGGAAIDATGVPLPDEA 62

Query: 93  VASINKNLIALKGPLATP-IGKG----HRSLNLTLRKTFNLFANVRPAK-------SIEG 140
           + +  K    L G +  P  G G     + L L +RK   L+AN+RP          +  
Sbjct: 63  LEASKKADAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLSP 121

Query: 141 FKTTYSD-VDLVLIRENTEGEYSGI-EHVVAPGVVQSIKLITRDASERVIRYAFEYAKAI 198
            K  ++   D V++RE   G Y G  +     GV    +  T    +R+ R A   A   
Sbjct: 122 IKPQFAKGTDFVVVRELVGGIYFGKRKEDDGDGVAWDSEQYTVPEVQRITRMAAFMALQH 181

Query: 199 GRPR-VVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELIDNTVLNVVSNPAGYTDA 257
             P  +  + K+ +   +      V + +  E+P +K++ +LID+  + +V NP  + + 
Sbjct: 182 EPPLPIWSLDKANVLASSRLWRKTVEETIKNEFPTLKVQHQLIDSAAMILVKNPT-HLNG 240

Query: 258 VSVCPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGNEISIFEAVHGSAPDIAGQNKA 312
           + +  N++GDI                        +      ++E  HGSAPD+  +NK 
Sbjct: 241 IIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KNKV 299

Query: 313 NPTALLLSSVMMLN-HMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIK 371
           NP A +LS+ MML   + L ++   IE AV   + +    RTGDLGGS +T+   DAV K
Sbjct: 300 NPIATILSAAMMLKLSLNLPEEGKAIEDAVKKVLDAGI--RTGDLGGSNSTTEVGDAVAK 357

Query: 372 NL 373
            +
Sbjct: 358 EV 359

>NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa]
           {ON} Anc_1.402
          Length = 363

 Score = 87.0 bits (214), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 98/357 (27%), Positives = 162/357 (45%), Gaps = 34/357 (9%)

Query: 43  VSFIEGDGIGPEISQSVKDIFKA-AEV--PINWEF----CDVTPIFVNGLTTIPDPAV-A 94
           +  + GD +G EI+     + KA AEV   IN++F         I   G+  +PD A+ A
Sbjct: 6   IVVLPGDHVGEEITAEAVKVLKAIAEVDNSINFDFQYHLIGGAAIDATGVP-LPDEALEA 64

Query: 95  SINKNLI---ALKGP-LATPIGKGHRSLNLTLRKTFNLFANVRP----AKSIEGFKTTYS 146
           S N + +   A+ GP   T   +  + L L +RK   L+AN+RP    ++S+ G      
Sbjct: 65  SKNSDAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELGLYANLRPCNFASESLLGLSPLRP 123

Query: 147 DV----DLVLIRENTEGEYSGI-EHVVAPGVVQSIKLITRDASERVIRYAFEYAKAIGRP 201
           ++    D +++RE   G Y G  +     GV    +  +    +R+ R A   A     P
Sbjct: 124 EIAKGTDFMVVRELVGGIYFGKRKEDEGDGVAWDSEQYSVPEVQRITRMAAFLALQHNPP 183

Query: 202 R-VVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELIDNTVLNVVSNPAGYTDAVSV 260
             +  + K+ +   +      V + +  E+P + ++ +LID+  + +V NP    + + +
Sbjct: 184 LPIWSLDKANVLASSRLWRKTVEETIKNEFPTLTVQNQLIDSAAMILVKNPT-QLNGIII 242

Query: 261 CPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGNEISIFEAVHGSAPDIAGQNKANPT 315
             N++GDI                        +      ++E  HGSAPD+  + K NP 
Sbjct: 243 TSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLP-KGKVNPI 301

Query: 316 ALLLSSVMMLN-HMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIK 371
           A +LS+ MML   + LV Q   IE AV   + +    RTGDLGGS +T+   DA+ K
Sbjct: 302 ATILSAAMMLKLSLNLVKQGDAIEEAVKKVLDAGI--RTGDLGGSNSTTEVGDAIAK 356

>ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON}
           uniprot|Q96WI0 Zygosaccharomyces rouxii LEU2 3-
           isopropylmalate dehydrogenase
          Length = 362

 Score = 87.0 bits (214), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 74/268 (27%), Positives = 121/268 (45%), Gaps = 20/268 (7%)

Query: 120 LTLRKTFNLFANVRPAK-------SIEGFKTTYSD-VDLVLIRENTEGEYSG-IEHVVAP 170
           L +RK   L+AN+RP          +   K  ++   D V++RE   G Y G  +     
Sbjct: 92  LKIRKELQLYANLRPCNFASESLLDLSPLKPQHAKGTDFVVVRELVGGIYFGERKEDEGD 151

Query: 171 GVVQSIKLITRDASERVIRYAFEYAKAIGRPR-VVVVHKSTIQRLADGLFVNVAKELSKE 229
           GV    +  T+   +R+ R A   A     P  +  + K+ +   +      V + +  E
Sbjct: 152 GVAWDSEKYTKPEVQRLTRMAAFLALQHNPPLPIWSLDKANVLASSRLWRKTVEETIKNE 211

Query: 230 YPEIKLETELIDNTVLNVVSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXX-----XXXXX 284
           +P++KL  +LID+  + +V +P    + + +  NL+GDI                     
Sbjct: 212 FPQLKLNHQLIDSAAMILVKSPT-QLNGIVLTSNLFGDIISDEASVIPGSLGLLPSASLA 270

Query: 285 XXANIGNEISIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLVDQASRIERAVLT 343
              +      ++E  HGSAPD+  + K NP A++LS+ MML   + L  +   +E+AV  
Sbjct: 271 SLPDTNEAFGLYEPCHGSAPDLP-KGKVNPIAMILSAAMMLKLSLNLSKEGEAVEKAVKQ 329

Query: 344 TIASSSKNRTGDLGGSATTSSFTDAVIK 371
            + S    RTGDLGGS +TS   DA+ K
Sbjct: 330 VLDSGV--RTGDLGGSNSTSEVGDAIAK 355

>YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}
           LEU2Beta-isopropylmalate dehydrogenase (IMDH), catalyzes
           the third step in the leucine biosynthesis pathway
          Length = 364

 Score = 86.7 bits (213), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 95/355 (26%), Positives = 156/355 (43%), Gaps = 34/355 (9%)

Query: 43  VSFIEGDGIGPEISQSVKDIFKA-AEVPINWEFCDVTPIFVNGLTT------IPDPAVAS 95
           +  + GD +G EI+     + KA ++V  N +F D     + G         +PD A+ +
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISDVRSNVKF-DFENHLIGGAAIDATGVPLPDEALEA 65

Query: 96  INKNLIALKGPLATP-IGKG----HRSLNLTLRKTFNLFANVRPAK-------SIEGFKT 143
             K    L G +  P  G G     + L L +RK   L+AN+RP          +   K 
Sbjct: 66  SKKADAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLSPIKP 124

Query: 144 TYSD-VDLVLIRENTEGEYSGI-EHVVAPGVVQSIKLITRDASERVIRYAFEYAKAIGRP 201
            ++   D V++RE   G Y G  +     GV    +  T    +R+ R A   A     P
Sbjct: 125 QFAKGTDFVVVRELVGGIYFGKRKEDDGDGVAWDSEQYTVPEVQRITRMAAFMALQHEPP 184

Query: 202 R-VVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELIDNTVLNVVSNPAGYTDAVSV 260
             +  + K+ +   +      V + +  E+P +K++ +LID+  + +V NP  + + + +
Sbjct: 185 LPIWSLDKANVLASSRLWRKTVEETIKNEFPTLKVQHQLIDSAAMILVKNPT-HLNGIII 243

Query: 261 CPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGNEISIFEAVHGSAPDIAGQNKANPT 315
             N++GDI                        +      ++E  HGSAPD+  +NK NP 
Sbjct: 244 TSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KNKVNPI 302

Query: 316 ALLLSSVMMLN-HMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAV 369
           A +LS+ MML   + L ++   IE AV   + +    RTGDLGGS +T+   DAV
Sbjct: 303 ATILSAAMMLKLSLNLPEEGKAIEDAVKKVLDAGI--RTGDLGGSNSTTEVGDAV 355

>KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 362

 Score = 86.3 bits (212), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 90/357 (25%), Positives = 156/357 (43%), Gaps = 32/357 (8%)

Query: 42  DVSFIEGDGIGPEISQSVKDIFKA-----AEVPINWEFCDVTPIFVNGL-TTIPDPAVAS 95
           ++  + GD +G E++     +  A      E+  N++   +    ++   T +PD A+ +
Sbjct: 4   NIVVLPGDHVGKEVTDEAIKVLNAIAEVRPEIKFNFQHHLIGGAAIDATGTPLPDEALEA 63

Query: 96  INKNLIALKGPLATP-IGKG----HRSLNLTLRKTFNLFANVRPAK-------SIEGFKT 143
             K    L G +  P  G G     + L L +RK   L+AN+RP          +   K 
Sbjct: 64  SKKADAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELGLYANLRPCNFASDSLLDLSPLKP 122

Query: 144 TYSD-VDLVLIRENTEGEYSG-IEHVVAPGVVQSIKLITRDASERVIRYAFEYAKAIGRP 201
            Y+   D V++RE   G Y G  +     GV    +  +    +R+ R A   A     P
Sbjct: 123 EYAKGTDFVVVRELVGGIYFGERKEDEGDGVAWDSEKYSVPEVQRITRMAAFLALQQNPP 182

Query: 202 R-VVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELIDNTVLNVVSNPAGYTDAVSV 260
             +  + K+ +   +      V + +  E+P++ ++ +LID+  + +V +P    + V +
Sbjct: 183 LPIWSLDKANVLASSRLWRKTVEETIKTEFPQLTVQHQLIDSAAMILVKSPTKL-NGVVI 241

Query: 261 CPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGNEISIFEAVHGSAPDIAGQNKANPT 315
             N++GDI                        +      ++E  HGSAPD+   NK NP 
Sbjct: 242 TNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNKAFGLYEPCHGSAPDLPA-NKVNPI 300

Query: 316 ALLLSSVMMLN-HMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIK 371
           A +LS+ MML   + LV++   +E AV   + +    RTGDLGGS +T+   DA+ K
Sbjct: 301 ATILSAAMMLKLSLDLVEEGRALEEAVRNVLDAGV--RTGDLGGSNSTTEVGDAIAK 355

>Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score = 84.7 bits (208), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 97/359 (27%), Positives = 157/359 (43%), Gaps = 34/359 (9%)

Query: 43  VSFIEGDGIGPEISQSVKDIFKA-AEVPINWEFCDVTPIFVNGL----TTIP--DPAVAS 95
           +  + GD +G EI++    + KA +EV  N +F D     + G     T +P  D A+ +
Sbjct: 7   IVVLPGDHVGQEITEEAIKVLKAISEVRPNVKF-DFEYHLIGGAAIDATGVPLTDEALEA 65

Query: 96  INKNLIALKGPLATP-IGKG----HRSLNLTLRKTFNLFANVRPAK-------SIEGFKT 143
             K    L G +  P  G G     + L L +RK   L+AN+RP          +   K 
Sbjct: 66  SKKADAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASESLLELSPIKP 124

Query: 144 TYS-DVDLVLIRENTEGEYSGI-EHVVAPGVVQSIKLITRDASERVIRYAFEYAKAIGRP 201
            ++   D V++RE   G Y G  +     GV    +  T    +R+ R A   A     P
Sbjct: 125 QFARGTDFVVVRELVGGIYFGKRKEDDGDGVAWDSEQYTVPEVQRITRMAAFMALQHQPP 184

Query: 202 R-VVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELIDNTVLNVVSNPAGYTDAVSV 260
             +  + K+ +   +      V + +  E+P +K++ +LID+  + +V NP    + + +
Sbjct: 185 LPIWSLDKANVLASSRLWRKTVEETIKNEFPTLKVQHQLIDSAAMILVKNPT-QLNGIII 243

Query: 261 CPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGNEISIFEAVHGSAPDIAGQNKANPT 315
             N++GDI                        +      ++E  HGSAPD+  +NK NP 
Sbjct: 244 TSNMFGDIISDEASCIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KNKVNPI 302

Query: 316 ALLLSSVMMLN-HMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373
           A +LS+ MML   + +  +   IE AV   + +    RTGDLGGS +T    DAV K +
Sbjct: 303 ATILSAAMMLKLSLNMTAEGQAIEDAVKKVLDAGI--RTGDLGGSNSTIEVGDAVAKEV 359

>TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score = 81.3 bits (199), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 89/358 (24%), Positives = 154/358 (43%), Gaps = 33/358 (9%)

Query: 42  DVSFIEGDGIGPEISQSVKDIFKAAE------VPINWEFCDVTPIFVNGL-TTIPDPAVA 94
           ++  + GD +G E+++    I KA E      V  N+E+  +    ++     +PD ++ 
Sbjct: 6   NIVVLPGDHVGGEVTEEAVKILKAIEEVRNNKVKFNFEYHLIGGAAIDATGNPLPDESLE 65

Query: 95  SINKNLIALKGPLATP-IGKG----HRSLNLTLRKTFNLFANVRPAK-------SIEGFK 142
           +  +    L G +  P  G G     + L L +RK   L+AN+RP          +   K
Sbjct: 66  ASKRADAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLSPLK 124

Query: 143 TTYSD-VDLVLIRENTEGEYSGI-EHVVAPGVVQSIKLITRDASERVIRYAFEYAKAIGR 200
             Y+   D  ++RE   G Y G  +     GV    +  +    +R+ R A   A     
Sbjct: 125 EKYAKGTDFTVVRELVGGIYFGKRKEDDGDGVAWDSEQYSVPEVQRITRMAAFLAMQHNP 184

Query: 201 PR-VVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELIDNTVLNVVSNPAGYTDAVS 259
           P  +  + K+ +   +      V + +  E+P +K+  +LID+  + +V NP    + + 
Sbjct: 185 PLPIWSLDKANVLASSRLWRKTVEETIQNEFPSLKVSHQLIDSAAMILVKNPT-QLNGII 243

Query: 260 VCPNLYGDIXXXXXX-----XXXXXXXXXXXXANIGNEISIFEAVHGSAPDIAGQNKANP 314
           +  N++GDI                        +  +   ++E  HGSAPD+  + K NP
Sbjct: 244 ITNNMFGDIISDEASVIPGSLGLLPSASLSSLPDTNSAFGLYEPCHGSAPDLP-KGKVNP 302

Query: 315 TALLLSSVMMLN-HMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIK 371
              +LS  MML   + L ++   +E AV   + ++   RT DLGGS +TS   DAV K
Sbjct: 303 IGTILSVAMMLKLSLNLKEEGIAVEEAVRRVLDNNI--RTADLGGSNSTSDIGDAVAK 358

>NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {ON}
           Anc_1.402
          Length = 365

 Score = 80.5 bits (197), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 88/357 (24%), Positives = 155/357 (43%), Gaps = 33/357 (9%)

Query: 43  VSFIEGDGIGPEISQSVKDIFKAAE------VPINWEFCDVTPIFVNGL-TTIPDPAVAS 95
           +  + GD +G EI++    + KA E      V  ++++  +    ++     + D A+ +
Sbjct: 7   IVVLPGDHVGGEITEEAIKVLKAIEQVESSKVKFDFQYHLIGGAAIDAAGVPLTDEALEA 66

Query: 96  INKNLIALKGPLATP-IGKG----HRSLNLTLRKTFNLFANVRP----AKSIEGFKTTYS 146
             K    L G +  P  G G     + L L +RK   L+AN+RP    ++ + G      
Sbjct: 67  SKKADAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELGLYANLRPCNFASEPLLGLSPLRP 125

Query: 147 DV----DLVLIRENTEGEYSG-IEHVVAPGVVQSIKLITRDASERVIRYAFEYAKAIGRP 201
           ++    D +++RE   G Y G  +     GV    +  +    ER+ R A   A     P
Sbjct: 126 EIAKGTDFMVVRELVGGIYFGERKEDDGDGVAWDSEKYSVPEVERITRMAAFLALQHNPP 185

Query: 202 R-VVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELIDNTVLNVVSNPAGYTDAVSV 260
             +  + K+ +   +      V   +  E+P + ++ +LID+  + +V NP    + + +
Sbjct: 186 LPIWSLDKANVLASSRLWRKTVEATIKNEFPTLTVQNQLIDSAAMILVKNPT-QLNGIII 244

Query: 261 CPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGNEISIFEAVHGSAPDIAGQNKANPT 315
             N++GDI                        +      ++E  HGSAPD+  +NK NP 
Sbjct: 245 TSNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAPDLP-KNKVNPV 303

Query: 316 ALLLSSVMMLN-HMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIK 371
           A +LS+ MML   + +V +   +E AV   + +    RTGDLGGS +T    DA+ K
Sbjct: 304 ATILSAAMMLKLSLNMVKEGEAVEEAVRRVLDAGV--RTGDLGGSNSTQEVGDAIAK 358

>Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W
           (LEU2) - beta-IPM (isopropylmalate) dehydrogenase
           [contig 82] FULL
          Length = 364

 Score = 80.1 bits (196), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 89/356 (25%), Positives = 153/356 (42%), Gaps = 34/356 (9%)

Query: 46  IEGDGIGPEISQSVKDIFKA-------AEVPINWEFCDVTPIFVNGLTTIPDPAVASINK 98
           + GD +G EI++    + KA        +    +       I   G   +PD ++ +  K
Sbjct: 10  LPGDHVGQEITEEAVKVLKAISEVRPEKQFEFQYHLIGGAAIDATG-EPLPDASLEAAKK 68

Query: 99  NLIALKGPLATP-IGKG----HRSLNLTLRKTFNLFANVRP----AKSIEGFKTTYSDV- 148
           +   L G +  P  G G     + L L +RK   L+AN+RP    ++S+        +  
Sbjct: 69  SDAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELQLYANLRPCNFASESLLDLSPLKPECA 127

Query: 149 ---DLVLIRENTEGEYSG-IEHVVAPGVVQSIKLITRDASERVIRYAFEYAKAIGRPR-V 203
              D V++RE   G Y G  +     GV    +  +    +R+ R A   A     P  V
Sbjct: 128 RGTDFVVVRELVGGIYFGERKEDTGDGVAWDSEQYSVPEVQRITRMAAFLALQHSPPLPV 187

Query: 204 VVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELIDNTVLNVVSNPAGYTDAVSVCPN 263
             + K+ +   +      V + +  E+P + ++ +LID+  + +V NP    + V +  N
Sbjct: 188 WSLDKANVLASSRLWRKTVEETIKNEFPTLTVQHQLIDSAAMILVKNPT-QLNGVIITNN 246

Query: 264 LYGDIXXXXXXXXXXX-----XXXXXXXANIGNEISIFEAVHGSAPDIAGQNKANPTALL 318
           ++GDI                        +      ++E  HGSAPD+  + K NP A +
Sbjct: 247 MFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAPDLP-KGKVNPIATI 305

Query: 319 LSSVMMLN-HMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373
           LS+ MML   + + ++ + +E AV   + S    RT DL G++TTS   +AV+K L
Sbjct: 306 LSAAMMLKLSLDMFEEGAAVEEAVRKVLDSGV--RTADLKGTSTTSEVGEAVVKAL 359

>Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON}
           (182096..183190) [1095 nt, 365 aa]
          Length = 364

 Score = 77.8 bits (190), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 82/307 (26%), Positives = 135/307 (43%), Gaps = 26/307 (8%)

Query: 86  TTIPDPAVASINKNLIALKGPLATP-IGKG----HRSLNLTLRKTFNLFANVRP----AK 136
           T +PD A+ +   +   L G +  P  G G     + L L +RK   L+AN+RP    + 
Sbjct: 56  TPLPDEALDAAKNSDAVLLGAVGGPKWGTGDVRPEQGL-LKIRKELQLYANLRPCNFVSD 114

Query: 137 SIEGFKTTYSDV----DLVLIRENTEGEYSGI-EHVVAPGVVQSIKLITRDASERVIRYA 191
           S+ G      ++    D  ++RE   G Y G  +     G     +  T    +R+ R A
Sbjct: 115 SLLGLSPLKEEIAKGTDFTVVRELVGGIYFGDRKEDDGDGSAWDCEKYTIPEVQRITRMA 174

Query: 192 FEYAKAIGRPR-VVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELIDNTVLNVVSN 250
              A     P  +  + K+ +   +      V + +  E+P +K++ +LID+  + +V +
Sbjct: 175 AFLALQHDPPLPIWSLDKANVLASSRLWRKTVEETIKNEFPNLKVQHQLIDSAAMILVKS 234

Query: 251 PAGYTDAVSVCPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGNEISIFEAVHGSAPD 305
           P    + + +  N++GDI                        +      ++E  HGSAPD
Sbjct: 235 PR-QLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPD 293

Query: 306 IAGQNKANPTALLLSSVMMLN-HMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSS 364
           +  + K NP A +LS+ MML   + LVD+   IE+AV   + +    RT DL GS +TS 
Sbjct: 294 LP-KGKVNPIATILSAAMMLKLSLNLVDEGIAIEQAVKQVLDAGI--RTADLKGSNSTSE 350

Query: 365 FTDAVIK 371
             DAV K
Sbjct: 351 VGDAVAK 357

>KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 364

 Score = 77.8 bits (190), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 91/354 (25%), Positives = 152/354 (42%), Gaps = 34/354 (9%)

Query: 46  IEGDGIGPEISQSVKDIFKA-AEVPINWEFCDVTPIFVNGLTT------IPDPAVASINK 98
           + GD +G EI+     + KA +EV  + +F +     + G         +PD ++ +  K
Sbjct: 10  LPGDHVGQEITDEAIKVLKAISEVRSSVKF-EFQQHLIGGAAIDATGEPLPDASLEAAKK 68

Query: 99  NLIALKGPLATP-IGKG----HRSLNLTLRKTFNLFANVRPAK-------SIEGFKTTYS 146
               L G +  P  G G     + L L +RK   L+AN+RP          +   K  ++
Sbjct: 69  ADAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELQLYANLRPCNFASESLLDLSPLKAEHA 127

Query: 147 -DVDLVLIRENTEGEYSG-IEHVVAPGVVQSIKLITRDASERVIRYAFEYAKAIGRPR-V 203
              D V++RE   G Y G  +     GV    +  +    +R+ R A   A     P  V
Sbjct: 128 RGTDFVVVRELVGGIYFGERKEDEGDGVAWDSEKYSVPEVQRITRMAAFLALQHNPPLPV 187

Query: 204 VVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELIDNTVLNVVSNPAGYTDAVSVCPN 263
             + K+ +   +      V + +  E+P + ++ +LID+  + +V NP    + V +  N
Sbjct: 188 WSLDKANVLASSRLWRKTVEETIKNEFPTLTVQHQLIDSAAMIMVKNPT-QLNGVIITNN 246

Query: 264 LYGDIXXXXXXXXXXX-----XXXXXXXANIGNEISIFEAVHGSAPDIAGQNKANPTALL 318
           ++GDI                        +      ++E  HGSAPD+  + K NP A +
Sbjct: 247 MFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLE-KGKVNPIATI 305

Query: 319 LSSVMMLN-HMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIK 371
           LS+ MML   + + ++ + +E AV   +   S  RTGDL GS +T    DAV K
Sbjct: 306 LSAAMMLELSLDMFEEGTAVEEAVRRVL--DSGIRTGDLRGSNSTQEVGDAVAK 357

>KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.402
           YCL018W
          Length = 365

 Score = 77.8 bits (190), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 92/358 (25%), Positives = 149/358 (41%), Gaps = 34/358 (9%)

Query: 42  DVSFIEGDGIGPEI-SQSVKDIFKAAEV------PINWEFCDVTPIFVNGLTTIPDPAVA 94
           +++   GD IG EI  ++VK +   AEV        N++      I   G     +    
Sbjct: 6   NITVFPGDHIGTEIVRETVKVLDAIAEVSPNVSFKYNYQLIGGAAIDATGEPLTDEALQV 65

Query: 95  SINKNLIALKGPLATPIGKGHRSLN-----LTLRKTFNLFANVRPAKSIEGF-------- 141
           + N + I L G +  P   GH  +      L +RK   ++AN+RP + +           
Sbjct: 66  AKNSDAILL-GAVGGP-KWGHGLVRPEQGLLKIRKELGVYANLRPCQFVSETLLDLSPLK 123

Query: 142 KTTYSDVDLVLIRENTEGEYSGIEHVVAP-GVVQSIKLITRDASERVIRYAFEYAKAIGR 200
           +      D V++RE   G Y G        GV    +  +    +R+ R A   A     
Sbjct: 124 REIVQGTDFVIVRELVGGIYFGERQEAGDDGVAWDKESYSVPEIQRITRMAAFLALQHNP 183

Query: 201 PR-VVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELIDNTVLNVVSNPAGYTDAVS 259
           P  V  + K+ +   +      V + +  E+P + +   LID+  + +V NP    + V 
Sbjct: 184 PLPVWSLDKANVLATSRLWRKTVEETIKNEFPTLTINHHLIDSAAMTLVQNPTKL-NGVV 242

Query: 260 VCPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGNEISIFEAVHGSAPDIAGQNKANP 314
           +  N++GDI                        +  + + ++E  HGSAPD+   + ANP
Sbjct: 243 ITTNMFGDIISDEASVIPGSLGLLPSASLASLPDKNDALGLYEPCHGSAPDLPA-DHANP 301

Query: 315 TALLLSSVMMLN-HMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIK 371
            A +LS+ MM    + L  + + IE AV  TI +  K  TGDLGG  TT+   +AV K
Sbjct: 302 IATILSAAMMCKLSLNLTKEGNAIEEAVKRTIDAGIK--TGDLGGKNTTTEVGNAVAK 357

>SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {ON}
           highly similar to uniprot|P04173 Saccharomyces
           cerevisiae YCL018W LEU2 Beta-isopropylmalate
           dehydrogenase catalyzes the third step in the leucine
           biosynthesis pathway
          Length = 364

 Score = 77.0 bits (188), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 70/268 (26%), Positives = 119/268 (44%), Gaps = 20/268 (7%)

Query: 120 LTLRKTFNLFANVRPAK-------SIEGFKTTYSD-VDLVLIRENTEGEYSG-IEHVVAP 170
           L +RK   L+AN+RP          +   K  Y+   D V++RE   G Y G  +     
Sbjct: 94  LKIRKELQLYANLRPCNFASDSLLDLSPLKPEYAKGTDFVVVRELVGGIYFGERKEDEGD 153

Query: 171 GVVQSIKLITRDASERVIRYAFEYAKAIGRPR-VVVVHKSTIQRLADGLFVNVAKELSKE 229
           GV    +  +    +R+ R A   A     P  +  + K+ +   +      V + +  E
Sbjct: 154 GVAWDSEKYSVPEVQRITRMAAFLALQQNPPLPIWSLDKANVLASSRLWRKTVEETIKNE 213

Query: 230 YPEIKLETELIDNTVLNVVSNPAGYTDAVSVCPNLYGDIXXXXXXXXXXX-----XXXXX 284
           +P + ++ +LID+  + +V +P    + + +  N++GDI                     
Sbjct: 214 FPTLTVQHQLIDSAAMILVKSPTKL-NGIVITSNMFGDIISDEASVIPGSLGLLPSASLA 272

Query: 285 XXANIGNEISIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLVDQASRIERAVLT 343
              +      ++E  HGSAPD+  +NK NP A +LS+ MML   + LV++ + +E AV  
Sbjct: 273 SLPDSNTAFGLYEPCHGSAPDLP-KNKVNPIATILSAAMMLKLSLNLVEEGNAVEEAVRR 331

Query: 344 TIASSSKNRTGDLGGSATTSSFTDAVIK 371
            + +    RT DL G  +TS   DAV+K
Sbjct: 332 VLDAGI--RTADLRGENSTSEVGDAVVK 357

>KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {ON}
           Anc_1.402 YCL018W
          Length = 447

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 90/354 (25%), Positives = 151/354 (42%), Gaps = 34/354 (9%)

Query: 46  IEGDGIGPEISQSVKDIFKA-AEVPINWEFCDVTPIFVNGLTT------IPDPAVASINK 98
           + GD +G EI++    +  A + V  N  F D     + G         +PD A+ +  K
Sbjct: 93  LPGDHVGQEITEEAIKVLNAISSVRPNVNF-DFQHHLIGGAAIDATGVPLPDEALEASKK 151

Query: 99  NLIALKGPLATP-IGKG----HRSLNLTLRKTFNLFANVRP----AKSIEGFKTTYSDV- 148
               L G +  P  G G     + L L +RK   L+AN+RP    + S+        ++ 
Sbjct: 152 ADAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLSPLKPEIV 210

Query: 149 ---DLVLIRENTEGEYSG-IEHVVAPGVVQSIKLITRDASERVIRYAFEYAKAIGRPR-V 203
              D+ ++RE   G Y G  +     GV    +  +    +R+ R A   A     P  V
Sbjct: 211 KGTDICIVRELVGGIYFGERKEDEGDGVAWDSEKYSVSEVQRITRMAGFLALQHNPPLPV 270

Query: 204 VVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELIDNTVLNVVSNPAGYTDAVSVCPN 263
             + K+ +   +      V + +  E+P + ++ +LID+  + +V NP  + + V +  N
Sbjct: 271 WSLDKANVLASSRLWRKTVEETIKNEFPTLTVQHQLIDSAAMILVKNPT-HLNGVVIANN 329

Query: 264 LYGDIXXXXXXXXXXX-----XXXXXXXANIGNEISIFEAVHGSAPDIAGQNKANPTALL 318
           ++GDI                        +      ++E  HGSAPD+  + K NP A +
Sbjct: 330 MFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLP-KGKVNPVATI 388

Query: 319 LSSVMMLN-HMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIK 371
           LS  MML   + + ++   +E+AV   + S    RT DL GS +TS   DA+ K
Sbjct: 389 LSVAMMLKLSLNMTEEGIAVEKAVKQVLDSGV--RTADLRGSNSTSEVGDAIAK 440

>CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}
          Length = 365

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 89/358 (24%), Positives = 156/358 (43%), Gaps = 35/358 (9%)

Query: 43  VSFIEGDGIGPEISQSVKDIFKAAEV----PINWEF----CDVTPIFVNGLTTIPDPAVA 94
           +  + GD +G EI++    +  A +      +N++F         I   G+  +PD A+ 
Sbjct: 7   IVVLPGDHVGQEITEEAIKVLNAIQECRPDKVNFKFDHHLIGGAAIDATGVP-LPDEALE 65

Query: 95  SINKNLIALKGPLATP-IGKG----HRSLNLTLRKTFNLFANVRP----AKSIEGFKTTY 145
           +  K    L G +  P  G G     + L L +RK   L+AN+RP    + S+       
Sbjct: 66  ASKKADAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLSPLK 124

Query: 146 SDV----DLVLIRENTEGEYSG-IEHVVAPGVVQSIKLITRDASERVIRYAFEYAKAIGR 200
            ++    D V++RE   G Y G  +     GV    +  +    +R+ R A   A     
Sbjct: 125 PEIARGTDFVVVRELVGGIYFGERKEDEGDGVAWDSEKYSVPEVQRITRMAAFMALQHNP 184

Query: 201 PR-VVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELIDNTVLNVVSNPAGYTDAVS 259
           P  +  + K+ +   +      V + +  E+P++ ++ +LID+  + +V NP  + + + 
Sbjct: 185 PLPIWSLDKANVLASSRLWRKTVEETIKNEFPQLTVQHQLIDSAAMILVKNPT-HLNGII 243

Query: 260 VCPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGNEISIFEAVHGSAPDIAGQNKANP 314
           +  N++GDI                        +      ++E  HGSAPD+  + K NP
Sbjct: 244 ITNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KGKVNP 302

Query: 315 TALLLSSVMMLN-HMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIK 371
            A +LS+ MML   + L ++   IE+AV   + S    RT DL G+ +T+   DAV K
Sbjct: 303 VATILSAAMMLKLSLDLFEEGEIIEQAVKKVLDSGI--RTADLKGTNSTTEVGDAVAK 358

>Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C
           (REAL)
          Length = 53

 Score = 50.1 bits (118), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (72%), Gaps = 1/51 (1%)

Query: 323 MMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373
           +MLNH+GL + A+RI +AV  TIA   K+ T D+GGS++T+ FT+ +I  L
Sbjct: 1   LMLNHLGLNESATRISKAVHETIA-EGKHTTRDIGGSSSTTDFTNEIINKL 50

>TDEL0C03250 Chr3 complement(573410..576646) [3237 bp, 1078 aa] {ON}
           Anc_7.461 YJR090C
          Length = 1078

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 24/50 (48%)

Query: 122 LRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPG 171
           L   FN +       S E   T +S VD     +  + EY G+++VVAPG
Sbjct: 823 LEDVFNWYETPPRGLSSEELATLWSQVDQKFCEDPFDEEYDGLDNVVAPG 872

>TBLA0F00410 Chr6 complement(95724..103754) [8031 bp, 2676 aa] {ON}
            Anc_8.155 YGL195W
          Length = 2676

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 77/179 (43%), Gaps = 39/179 (21%)

Query: 76   DVTPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNLTLRKTFNLF----AN 131
            ++ P+F   LT   D   A+I +N+I L G LAT + KG   +   + +  N      ++
Sbjct: 1252 ELIPVFEESLTAYQD---AAIKENVIILYGSLATHLPKGDARITTIVERLLNTLDTPSSD 1308

Query: 132  VRPA-------------KSIEGFKTTYSDVDL--VLIRENTEGEYSGIEHVVAP------ 170
            V+ A             K +E +  T  D  L   + +   +G   GI  +V        
Sbjct: 1309 VQQAVSQCLSPLVKMFSKDVESYINTLMDKLLNPTIPKSIRKGAAWGIAGLVQGYGISAL 1368

Query: 171  ---GVVQSIKLITRDASERVIR----YAFEY-AKAIGR---PRVVVVHKSTIQRLADGL 218
                +++++     D  E + R    YAFEY +K++G+   P V+ V  + ++ L D +
Sbjct: 1369 SDFDIIRNLIEAAEDKKEAIRRESVAYAFEYLSKSLGKFFEPYVIEVLPNILKNLGDSV 1427

>TPHA0A01440 Chr1 (281826..284477) [2652 bp, 883 aa] {ON} Anc_8.352
           YLR144C
          Length = 883

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 42/97 (43%), Gaps = 5/97 (5%)

Query: 159 GEYSGIEHVVAPGVVQSIKLITRDASERVIRYA--FEYAKAIGRPRVVVVHKSTIQRLAD 216
           G  S + H + P +  SI   + +    + RY   FE     GR  ++ +      R+A 
Sbjct: 335 GFVSAVYHYITPVIYSSIGFRSLEELPAISRYTQKFESILENGRKWIIYISSPDNTRIAF 394

Query: 217 GLFVNVAKELSKEYPEIKLETELIDNTVLNVVSNPAG 253
               N A    K  PEI L+T ++D   +N + N AG
Sbjct: 395 KKMSNNAYSADKRLPEILLQT-VVDG--INEIDNAAG 428

>TDEL0A04220 Chr1 complement(748109..752113) [4005 bp, 1334 aa] {ON}
           Anc_5.559 YDR443C
          Length = 1334

 Score = 31.2 bits (69), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 30/136 (22%), Positives = 61/136 (44%), Gaps = 27/136 (19%)

Query: 81  FVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNLTL-RKTFNLFANVRPAKSIE 139
            ++ L+TI +P++                 + K H  +N++   + F+ F NV+PAK I+
Sbjct: 869 LISSLSTIKEPSIY----------------VKKHHSMMNMSADSQVFSKFLNVKPAKGIK 912

Query: 140 GFK-----TTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITRDASERVIRYAFEY 194
            F+     T+Y++  L  +    +  Y G E     G  + +KL + D+   +    F+ 
Sbjct: 913 NFRFLMLTTSYAEDCLSFVSTLCQ-TYIGYEF----GFCELLKLTSDDSQGLMQLPDFDK 967

Query: 195 AKAIGRPRVVVVHKST 210
           ++ +     +V + ST
Sbjct: 968 SRLLLLAAQIVTYCST 983

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,302,457
Number of extensions: 1342392
Number of successful extensions: 3972
Number of sequences better than 10.0: 91
Number of HSP's gapped: 3740
Number of HSP's successfully gapped: 91
Length of query: 373
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 262
Effective length of database: 40,753,473
Effective search space: 10677409926
Effective search space used: 10677409926
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)