Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0B040505.475ON67367335040.0
KAFR0E025405.475ON65968011951e-155
YOR138C (RUP1)5.475ON67168210441e-132
Kpol_543.95.475ON64268710121e-128
Skud_15.3025.475ON67868510111e-127
Smik_15.3185.475ON67267610051e-126
Suva_8.1905.475ON6665019711e-121
TDEL0A033905.475ON6226799281e-116
NCAS0H022705.475ON6967079141e-113
TPHA0J027805.475ON6316869061e-112
SAKL0G03564g5.475ON6056708801e-109
TBLA0A025405.475ON6787178351e-101
Kwal_55.212675.475ON6046668211e-100
KLTH0F15004g5.475ON5975437682e-92
ZYRO0D11264g5.475ON5476567371e-88
TBLA0B022305.475ON7907327313e-85
NDAI0C013905.475ON7095326834e-79
CAGL0I07205g5.475ON6035256267e-72
KLLA0E03169g5.475ON5445095333e-59
AER451Wna 1ON355111820.27
TDEL0D035503.270ON78051781.0
NCAS0I016203.270ON79565752.1
Suva_4.2953.270ON78257733.7
Kpol_1028.897.488ON87736725.6
NDAI0A054103.317ON486110706.6
ZYRO0G17996g7.488ON145534708.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0B04050
         (673 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0B04050 Chr2 (776430..778451) [2022 bp, 673 aa] {ON} Anc_5.4...  1354   0.0  
KAFR0E02540 Chr5 (519567..521546) [1980 bp, 659 aa] {ON} Anc_5.4...   464   e-155
YOR138C Chr15 complement(584309..586324) [2016 bp, 671 aa] {ON} ...   406   e-132
Kpol_543.9 s543 complement(22643..24571) [1929 bp, 642 aa] {ON} ...   394   e-128
Skud_15.302 Chr15 complement(538346..540382) [2037 bp, 678 aa] {...   394   e-127
Smik_15.318 Chr15 complement(545721..547739) [2019 bp, 672 aa] {...   391   e-126
Suva_8.190 Chr8 complement(339480..341480) [2001 bp, 666 aa] {ON...   378   e-121
TDEL0A03390 Chr1 complement(603062..604930) [1869 bp, 622 aa] {O...   362   e-116
NCAS0H02270 Chr8 complement(445144..447234) [2091 bp, 696 aa] {O...   356   e-113
TPHA0J02780 Chr10 complement(619045..620940) [1896 bp, 631 aa] {...   353   e-112
SAKL0G03564g Chr7 complement(294308..296125) [1818 bp, 605 aa] {...   343   e-109
TBLA0A02540 Chr1 (613560..615596) [2037 bp, 678 aa] {ON} Anc_5.4...   326   e-101
Kwal_55.21267 s55 (757685..759499) [1815 bp, 604 aa] {ON} YOR138...   320   e-100
KLTH0F15004g Chr6 (1228654..1230447) [1794 bp, 597 aa] {ON} weak...   300   2e-92
ZYRO0D11264g Chr4 complement(948942..950585) [1644 bp, 547 aa] {...   288   1e-88
TBLA0B02230 Chr2 (521358..523730) [2373 bp, 790 aa] {ON} Anc_5.4...   286   3e-85
NDAI0C01390 Chr3 (290301..292430) [2130 bp, 709 aa] {ON} Anc_5.4...   267   4e-79
CAGL0I07205g Chr9 (694434..696245) [1812 bp, 603 aa] {ON} simila...   245   7e-72
KLLA0E03169g Chr5 complement(292918..294552) [1635 bp, 544 aa] {...   209   3e-59
AER451W Chr5 (1502305..1503372) [1068 bp, 355 aa] {ON} Non-synte...    36   0.27 
TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.2...    35   1.0  
NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {O...    33   2.1  
Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON...    33   3.7  
Kpol_1028.89 s1028 complement(197927..200560) [2634 bp, 877 aa] ...    32   5.6  
NDAI0A05410 Chr1 (1223331..1224791) [1461 bp, 486 aa] {ON} Anc_3...    32   6.6  
ZYRO0G17996g Chr7 (1477518..1481885) [4368 bp, 1455 aa] {ON} wea...    32   8.7  

>KNAG0B04050 Chr2 (776430..778451) [2022 bp, 673 aa] {ON} Anc_5.475
           YOR138C
          Length = 673

 Score = 1354 bits (3504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 655/673 (97%), Positives = 655/673 (97%)

Query: 1   MGEEQDAVASLGEMGIPEDVALDALRRANGNLSAAVNYIFSNDMPAGEHVELPQPRESSD 60
           MGEEQDAVASLGEMGIPEDVALDALRRANGNLSAAVNYIFSNDMPAGEHVELPQPRESSD
Sbjct: 1   MGEEQDAVASLGEMGIPEDVALDALRRANGNLSAAVNYIFSNDMPAGEHVELPQPRESSD 60

Query: 61  LKPGDLDQVLRESQRTGPQLNQLVQLDSHPAADTNDEDTGGNIYLDEDDNIEVGSVQLNE 120
           LKPGDLDQVLRESQRTGPQLNQLVQLDSHPAADTNDEDTGGNIYLDEDDNIEVGSVQLNE
Sbjct: 61  LKPGDLDQVLRESQRTGPQLNQLVQLDSHPAADTNDEDTGGNIYLDEDDNIEVGSVQLNE 120

Query: 121 VSPATSIPPNSDIGSSPDDGTGDPPEYGGCKVPAAEEGAERPDSGAAPAAERYATNYLVL 180
           VSPATSIPPNSDIGSSPDDGTGDPPEYGGCKVPAAEEGAERPDSGAAPAAERYATNYLVL
Sbjct: 121 VSPATSIPPNSDIGSSPDDGTGDPPEYGGCKVPAAEEGAERPDSGAAPAAERYATNYLVL 180

Query: 181 FAFAVATYAPLQFVQQDFKNLNYDAEWYAGDAIQQPLCIVSDVGADGGSRQIVPEEEVTS 240
           FAFAVATYAPLQFVQQDFKNLNYDAEWYAGDAIQQPLCIVSDVGADGGSRQIVPEEEVTS
Sbjct: 181 FAFAVATYAPLQFVQQDFKNLNYDAEWYAGDAIQQPLCIVSDVGADGGSRQIVPEEEVTS 240

Query: 241 DTPVQPEMLWQLQRVISVCHSKLSERSYVSAKVFTKVFDTEVESCIRDSDHLYEALPSFI 300
           DTPVQPEMLWQLQRVISVCHSKLSERSYVSAKVFTKVFDTEVESCIRDSDHLYEALPSFI
Sbjct: 241 DTPVQPEMLWQLQRVISVCHSKLSERSYVSAKVFTKVFDTEVESCIRDSDHLYEALPSFI 300

Query: 301 KSIIRDAEMCPAQHSNTDVKSMFLSSAIQDAEQGAEPEETFLFLFHFPPEEYNANLYKMF 360
           KSIIRDAEMCPAQHSNTDVKSMFLSSAIQDAEQGAEPEETFLFLFHFPPEEYNANLYKMF
Sbjct: 301 KSIIRDAEMCPAQHSNTDVKSMFLSSAIQDAEQGAEPEETFLFLFHFPPEEYNANLYKMF 360

Query: 361 NALLYPEXXXXXXXXXXXXXXXXXXVQVEGSLKELAPLLTIIFNEADPGQLSAGAQDTCI 420
           NALLYPE                  VQVEGSLKELAPLLTIIFNEADPGQLSAGAQDTCI
Sbjct: 361 NALLYPEDDTIDDNSSDTDSSNDTDVQVEGSLKELAPLLTIIFNEADPGQLSAGAQDTCI 420

Query: 421 NSPQGVEVPFSFYPQLYTREVKEQVVKPILRQRKAARAELRQCLARMNQLKSYEGKGCCA 480
           NSPQGVEVPFSFYPQLYTREVKEQVVKPILRQRKAARAELRQCLARMNQLKSYEGKGCCA
Sbjct: 421 NSPQGVEVPFSFYPQLYTREVKEQVVKPILRQRKAARAELRQCLARMNQLKSYEGKGCCA 480

Query: 481 FLEQYAEVLAGRPCVSAVRSRTKNEMKEVIQKVTSIKLQLNEERAKLKKQYVDLSNKLQN 540
           FLEQYAEVLAGRPCVSAVRSRTKNEMKEVIQKVTSIKLQLNEERAKLKKQYVDLSNKLQN
Sbjct: 481 FLEQYAEVLAGRPCVSAVRSRTKNEMKEVIQKVTSIKLQLNEERAKLKKQYVDLSNKLQN 540

Query: 541 EWNISNPERKVIGEAKRLGLLDKPHLLSMVVLSPYFYLMRDSSGGSDWTLVQSNSYGTDG 600
           EWNISNPERKVIGEAKRLGLLDKPHLLSMVVLSPYFYLMRDSSGGSDWTLVQSNSYGTDG
Sbjct: 541 EWNISNPERKVIGEAKRLGLLDKPHLLSMVVLSPYFYLMRDSSGGSDWTLVQSNSYGTDG 600

Query: 601 LITKHVTEEKVQQYIRDCTKTANDNPLMFIYCREDFFVSQEETWSAIEKNMGCSEFNKAD 660
           LITKHVTEEKVQQYIRDCTKTANDNPLMFIYCREDFFVSQEETWSAIEKNMGCSEFNKAD
Sbjct: 601 LITKHVTEEKVQQYIRDCTKTANDNPLMFIYCREDFFVSQEETWSAIEKNMGCSEFNKAD 660

Query: 661 QLYLLTHREDRNE 673
           QLYLLTHREDRNE
Sbjct: 661 QLYLLTHREDRNE 673

>KAFR0E02540 Chr5 (519567..521546) [1980 bp, 659 aa] {ON} Anc_5.475
           YOR138C
          Length = 659

 Score =  464 bits (1195), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 269/680 (39%), Positives = 384/680 (56%), Gaps = 39/680 (5%)

Query: 1   MGEEQDAVASLGEMGIPEDVALDALRRANGNLSAAVNYIFSNDMPAGEHVELPQPRES-- 58
           M  E+ ++ SL EMGI ++VA+DAL++ +GNL AA+NYIFSNDM        PQP  +  
Sbjct: 1   MNGEESSLNSLLEMGISKNVAIDALQKFDGNLEAAINYIFSNDMSMESIQTHPQPNNNPF 60

Query: 59  ----------SDLKPGDLDQVLRESQRTGPQLNQLVQLDSHPAADTN----DEDTGGNIY 104
                     S  KPGDLD V+  + R G     L+QL S    + +    D+   G   
Sbjct: 61  LEEHTVELSDSKFKPGDLDTVI--TPRAGGDEKDLIQLSSSDEEEGSLQNPDQTVAGET- 117

Query: 105 LDEDDNIEVGSVQLNEVSPATSIPPNSDIGSSPDDGTGDPPEYGGCKVPAAEEGAERPDS 164
             E  NI + S   +  S +TS+   +++  S ++   +PPEY   +    +     P  
Sbjct: 118 --EKVNIPIDSQSSSYSSFSTSLSNENELRMS-ENTYNNPPEYSTVQHSERKSDIADPTI 174

Query: 165 GAAPAAERYATNYLVLFAFAVATYAPLQFVQQDFKNLNYDAEWYAGDAIQQPLCIVSDVG 224
                      NYL L+A ++A +  + F++ DFK+LNY  EWY   +I +P   V    
Sbjct: 175 VLPLPPNSLIENYLALYALSIANFFAIDFLKPDFKDLNYRKEWYRSSSIDEPFYRVKFNK 234

Query: 225 ADGGSRQIVPEEEVTSDTPVQPEMLWQLQRVISVCHSKLSERSYVSAKVFTKVFDTEVES 284
           AD    +IVP  E+T     QP++LWQLQ++I+V +S LSER+YVSAK+F    + +++S
Sbjct: 235 ADETENEIVPAAELTETDHPQPKLLWQLQKLIAVVNSDLSERAYVSAKIFNSSSNQQLQS 294

Query: 285 CIRDSDHLYEALPSFIKSIIRDAEMCPAQHSNTDVKSMFLSSAIQDAEQGAEPEETFLFL 344
            + D++HL E LP FIK++  D E C    S +D+K +F+SSA     Q    +ET+L  
Sbjct: 295 KLGDAEHLNEVLPYFIKALAVDLESCYGDKS-SDIKKLFISSAFYKPSQNEPLQETYLSF 353

Query: 345 FHFPPEEYNANLYKMFNALLYPEXXXXXXXXXXXXXXXXXXVQVEGSLKELAPLLTIIFN 404
           FHF PEEY+ NLYKMFN LL P+                   Q + SL  ++P LTI+FN
Sbjct: 354 FHFLPEEYDTNLYKMFNVLLIPDEDDEESGESDED-------QPDNSLNIISPFLTIVFN 406

Query: 405 EADPGQLSAGAQDTCINSPQGVEVPFSFYPQLYTREVKEQVVKPILRQRKAARAELRQCL 464
           E D    S     T   S QGV++PF FYPQLYT++ K++++K IL +RK ++++L+  L
Sbjct: 407 EMDE---STDDNMTTSASFQGVDIPFEFYPQLYTKKCKDELIKHILSKRKESKSKLKVIL 463

Query: 465 ARMNQLKSYEGKGCCAFLEQYAEVLAGRPCVSAVRSRTKNEMKEVIQKVTSIKLQLNEER 524
             +N LKSY GK    FL    + L       +       +  EV Q++  ++ Q+N  +
Sbjct: 464 QEINALKSYHGKDILMFLNSTIDFLQKDSNAEST------DHLEVAQELNDLRAQINGRK 517

Query: 525 AKLKKQYVDLSNKLQNEWNISNPERKVIGEAKRLGLLDKPHLLSMVVLSPYFYLMRDSSG 584
           A LK +Y +LS KL NEWN+S P+  +I  AK LGL+D P+LL+ VV+SPYFY MRD   
Sbjct: 518 AGLKDEYKELSQKLHNEWNLSYPDLHIIQTAKTLGLIDTPYLLTTVVISPYFYFMRDRKK 577

Query: 585 GSDWTLVQSNSYGTDGLITKHVTEEKVQQYIRDCTKTANDNPLMFIYCREDFFVSQEETW 644
              W LVQSN  GTD  IT  + +E V   I+  TK  N++PLMFIYC+E++  SQ++ W
Sbjct: 578 VDQWCLVQSNGLGTDFHITNFLDKENVSTTIKQYTKVPNESPLMFIYCKENYIASQDDIW 637

Query: 645 SAIEKNMGCSEFNKADQLYL 664
             IE+N GCS F KADQL+L
Sbjct: 638 KLIEENEGCSSFIKADQLHL 657

>YOR138C Chr15 complement(584309..586324) [2016 bp, 671 aa] {ON}
           RUP1Protein involved in regulation of Rsp5p, which is an
           essential HECT ubiquitin ligase; has a WW domain
           consensus motif of PPPSY (residues 131-135) that
           mediates binding of Rsp5p to Ubp2p; contains an UBA
           domain
          Length = 671

 Score =  406 bits (1044), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 252/682 (36%), Positives = 367/682 (53%), Gaps = 63/682 (9%)

Query: 4   EQDAVASLGEMGIPEDVALDALRRANGNLSAAVNYIFSNDMP----AGEHVELPQPRESS 59
           +  AV SL EMGIP +VA+DAL+R  GNL AAVN+IFSN++P     GE  +  QPR S 
Sbjct: 3   DNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQAEMGEENDGSQPRISE 62

Query: 60  D-----LKPGDL----DQVLRESQRTGPQLNQLVQLDSHPAADTNDEDTGGNIYLDEDDN 110
           +      KP D+    DQ +     +G  ++     D       ++  +G  +     D 
Sbjct: 63  NKIVAGTKPCDVPNNGDQDIDMPDVSGVDVDYDDDEDITDERSGSNSTSGCRVTAQNYDR 122

Query: 111 IEVGSVQLNEVSPATSIPPNSDIGSSPDDGTGDPPEYGGCKVPAAEEGAERPDSGAAPAA 170
             +           TSIPP               P Y   +    +     P        
Sbjct: 123 YSISE---------TSIPP---------------PSYSIVQHNEFKSNVGDPTVVLPLPL 158

Query: 171 ERYATNYLVLFAFAVATYAPLQFVQQDFKNLNYDAEWYAGDAIQQPLCIVSDVGADGGSR 230
                +Y  LFA   A Y P  F++ DFK+LNY A+W+ G +  +P   ++   A+ GS 
Sbjct: 159 NSLIESYFGLFALLTAVYFPHVFLKPDFKDLNYRADWFKGSSFTEPKYRLAYCEAEDGS- 217

Query: 231 QIVPEEEVTSDTP---VQPEMLWQLQRVISVCHSKLSERSYVSAKVFTKVFDTEVESCIR 287
                E V +  P   +QP +LWQLQ++ISV +++  ER++VSAKVFT   + ++ S + 
Sbjct: 218 --TTSEIVLASGPNEGLQPHLLWQLQKLISVVNTRKCERAFVSAKVFTSSLEPQLRSKLA 275

Query: 288 DSDHLYEALPSFIKSIIRDAEMCPAQHSNTDVKSMFLSSAIQDAEQGAEPEETFLFLFHF 347
           DS+HLYE LP+FIKS+  D EMCP    + + +S+F+SSA+    +   P ETFL LFHF
Sbjct: 276 DSEHLYEVLPAFIKSLAVDLEMCPGIR-DRETRSLFISSALHTPNKNEPPMETFLSLFHF 334

Query: 348 PPEEYNANLYKMFNALLYPEXXXXXXXXXX-XXXXXXXXVQVEGSLKELAPLLTIIFNEA 406
            PEEY++NLYKMFN LLYPE                   V+ E +LKE+AP+LTI+FNE 
Sbjct: 335 LPEEYDSNLYKMFNVLLYPEEEEEEEDVIRGGEQEEARYVEPENTLKEVAPVLTILFNEL 394

Query: 407 DPGQLSAGAQDTCINSPQGVEVPFSFYPQLYTREVKEQVVKPILRQRKAARAELRQCLAR 466
           +    S       ++ P GV++P  FYPQLYT++ K+Q+++ I+ +RK AR   R  L  
Sbjct: 395 ETNTES-------VSLPNGVDIPLEFYPQLYTKQCKDQLIRHIISKRKQARTRSRCLLQE 447

Query: 467 MNQLKSYEGKGCCAFLEQYAEVLAGRPCVSAVRSRTKNEMKEVIQKVTSIKLQLNEERAK 526
           +N+LKSY+GK     LE     L   P          +   E  +++ S+K  LN  RA 
Sbjct: 448 INELKSYQGKNISTILESTLAYLQTIP---------DDANNEAAKQIASLKDTLNSARAA 498

Query: 527 LKKQYVDLSNKLQNEWNISNPERKVIGEAKRLGLLDKPHLLSMVVLSPYFYLMRDSSGGS 586
             ++Y DL++KL  EWN+S+PE  +I  AK+LGL++ P++L+M  LSPY Y +R  +G  
Sbjct: 499 KMEEYKDLASKLHGEWNLSHPETHIINTAKQLGLIENPYILTMAALSPYSYFIRSRNGA- 557

Query: 587 DWTLVQSNSYGTDGLITKHVTEEKVQQYIRDCTKTANDNPLMFIYCREDFFVSQEETWSA 646
            W+ +QSN+ GT+  + K  +   VQ+ I+  TK A++ PLMFIYC E    ++E    A
Sbjct: 558 -WSWIQSNTLGTEFKVKKCSSPSVVQEAIKHGTKYASETPLMFIYCEEGKIPTEEVVAEA 616

Query: 647 IEKNMGCSEFNKADQLYLLTHR 668
           ++ N GC +F + DQ  L T R
Sbjct: 617 LKSNSGCLKFAEDDQNSLKTLR 638

>Kpol_543.9 s543 complement(22643..24571) [1929 bp, 642 aa] {ON}
           complement(22643..24571) [1929 nt, 643 aa]
          Length = 642

 Score =  394 bits (1012), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 241/687 (35%), Positives = 373/687 (54%), Gaps = 78/687 (11%)

Query: 1   MGE-EQDAVASLGEMGIPEDVALDALRRANGNLSAAVNYIFSNDMPA------------- 46
           MGE  ++++ SL EMGIP D+A+DAL RANGNL AAVN+IFSN++PA             
Sbjct: 1   MGELNENSINSLIEMGIPRDIAIDALSRANGNLEAAVNFIFSNELPAEAENSDIEIISYK 60

Query: 47  --GEHVELPQPRESSDLKPGDLDQVLRESQRTGPQLNQLVQLDSHPAADTN----DEDTG 100
               HVE+   +ES   +PGDL +V+   Q   P+    V  D+    D+N    D+   
Sbjct: 61  EKANHVEISN-KES--FQPGDLTEVIANQQPLQPEFQNYVN-DNSENIDSNCYVSDKIVD 116

Query: 101 GNIYLDEDDNIEVGSVQLNEVSPATSIPPNSDIGSSPDDGTGDPPEYGGCKVPAAEEGAE 160
              Y   D +    SV  N + P+  I  +SD  S   D T   P      +P       
Sbjct: 117 NMDYYSSDSDYITNSVTDNLLPPSYQIVKHSDHKSRLRDPTVILP------LP------- 163

Query: 161 RPDSGAAPAAERYATNYLVLFAFAVATYAPLQFVQQDFKNLNYDAEWYAGDAIQQP---L 217
            P+S           NY  L++  +  Y P   ++ DFK+L++  +W+ G +  +P   L
Sbjct: 164 -PNS--------MIENYFALYSLCITNYLPHIIMRPDFKDLSFTEDWFKGSSFSKPKNVL 214

Query: 218 CIVSDVGADGGSRQIVPEEEVTSDTPVQPEMLWQLQRVISVCHSKLSERSYVSAKVFTKV 277
             V+D      + +I P E++  D   QPE+LWQLQ++ S+ +S +SER+YV AK+F+ +
Sbjct: 215 KSVTDETTSKSTMKICPIEDMNQDDD-QPELLWQLQKLSSIVNSTMSERAYVCAKIFSVI 273

Query: 278 FDTEVESCIRDSDHLYEALPSFIKSIIRDAEMCPAQHSNTDVKSMFLSSAIQDAEQGAEP 337
            D + +  + ++DHL E LPSFIK ++ + E CP    + +++ +F+SSA         P
Sbjct: 274 LDQQSQIRLAEADHLNEVLPSFIKYLVVNLESCPGFEED-EIRKLFISSAFYTPSDDQAP 332

Query: 338 EETFLFLFHFPPEEYNANLYKMFNALLYPEXXXXXXXXXXXXXXXXXXVQVEGSLKELAP 397
             T L LFHF P+EY++NLYKMFN LLYP+                       SL +++P
Sbjct: 333 ITTLLSLFHFLPDEYDSNLYKMFNVLLYPDENDSDYESGDESEQG-------NSLGDISP 385

Query: 398 LLTIIFNEADPGQLSAGAQDTCINSPQGVEVPFSFYPQLYTREVKEQVVKPILRQRKAAR 457
           +L+I+F+EA+ G  S+G     I+ P+GVEVP  F+PQ+YT++ K +++K I+ +RK A+
Sbjct: 386 ILSIVFDEAEEG--SSG-----ISLPEGVEVPLEFFPQIYTKDCKNKLIKHIIAKRKDAQ 438

Query: 458 AELRQCLARMNQLKSYEGKGCCAFLEQYAEVLAGRPCVSAVRSRTKNEMKEVIQKVTSIK 517
            + ++ L  +N +KS++GK    F+    E L              N+   + +++  IK
Sbjct: 439 FKSKEILNDINSIKSFQGKDILKFINSSLEYL-----------ERDNKSDNITEELLKIK 487

Query: 518 LQLNEERAKLKKQYVDLSNKLQNEWNISNPERKVIGEAKRLGLLDKPHLLSMVVLSPYFY 577
             +   + +   +Y DL+ KLQNEWNISNPE  ++   ++LGL+ +P+LL M VLSPY Y
Sbjct: 488 NDMAIVKTQKMNEYRDLAQKLQNEWNISNPETHIVETGRKLGLIGEPYLLVMAVLSPYSY 547

Query: 578 LMRDSSGGSDWTLVQSNSYGTDGLITKHVTEEKVQQYIRDCTKTANDNPLMFIYCREDFF 637
            +R+ +G   W LVQ ++ G D  + +  +E +V+  I+  T+ A++ PLMF+YCR D  
Sbjct: 548 YIRERTGK--WNLVQCSTTGGDFDVRECSSELEVKDTIKQATRHASETPLMFMYCRRDVI 605

Query: 638 VSQEETWSAIEKNMGCSEFNKADQLYL 664
             + E   + E N GC  F K DQL L
Sbjct: 606 PEEYEIRKSFESNSGCLNFFKEDQLVL 632

>Skud_15.302 Chr15 complement(538346..540382) [2037 bp, 678 aa] {ON}
           YOR138C (REAL)
          Length = 678

 Score =  394 bits (1011), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 244/685 (35%), Positives = 365/685 (53%), Gaps = 54/685 (7%)

Query: 4   EQDAVASLGEMGIPEDVALDALRRANGNLSAAVNYIFSNDMP----AGEHVELPQPRESS 59
           +  AV SL EMGIP +VA+DAL R  GNL AAVN+IFSN++P     G      QPR S 
Sbjct: 3   DNQAVKSLLEMGIPHEVAMDALHRTGGNLEAAVNFIFSNELPEQADTGGEGGAGQPRISE 62

Query: 60  DLKPGDLDQVLRESQRTGPQLNQLVQLDSHPAADTNDEDTGGNIYLDEDDNI------EV 113
           +              R     N     +S    D +  D  G     +D++         
Sbjct: 63  N--------------RMMAGSNSYDVPNSGDQEDIDMADVAGGEADYDDEDDEDITENHS 108

Query: 114 GSVQLNEVSPATSIPPNSDIGSSPDDGTGDPPEYGGCKVPAAEEGAERPDSGAAPAAERY 173
           GS   NE  PA     +  I  +    +  PP Y   +    +   + P           
Sbjct: 109 GSSSSNERGPAARDYDHYSISET----SIAPPSYNIVQQNEFKCAVDDPTVVLPLPLNSL 164

Query: 174 ATNYLVLFAFAVATYAPLQFVQQDFKNLNYDAEWYAGDAIQQPLCIVSDVGADGGS--RQ 231
             +Y  LFA  V+ Y P  F++ DF++LNY  +W+ G +   P   ++   AD GS   +
Sbjct: 165 IESYFGLFALLVSVYFPHVFLKPDFQDLNYSPDWFKGSSFTGPKYRLAYREADDGSATSE 224

Query: 232 IVPEEEVTSDTPVQPEMLWQLQRVISVCHSKLSERSYVSAKVFTKVFDTEVESCIRDSDH 291
           IV     + D  +QP +LWQLQ++ISV ++++ ER++VSA++FT   + +++S + DS+H
Sbjct: 225 IVLASGSSDD--LQPRLLWQLQKLISVINTRMCERAFVSARLFTLSLEPQLKSKLADSEH 282

Query: 292 LYEALPSFIKSIIRDAEMCPAQHSNTDVKSMFLSSAIQDAEQGAEPEETFLFLFHFPPEE 351
           LYE LP+FIKS+  D EMCP    + + +++F+SSA+    +   P ETFL LFHF PEE
Sbjct: 283 LYEVLPTFIKSLAVDLEMCPGIR-DRETRNLFISSALHTPNKNEPPMETFLSLFHFLPEE 341

Query: 352 YNANLYKMFNALLYPEXXXXXXXXXXX---XXXXXXXVQVEGSLKELAPLLTIIFNEADP 408
           Y++NLYKMFN LLYPE                      + E +LKE+AP+LTI+FNE + 
Sbjct: 342 YDSNLYKMFNVLLYPEEENDEEDATRNGGGGQEDEEFAEPENTLKEVAPVLTILFNELET 401

Query: 409 GQLSAGAQDTCINSPQGVEVPFSFYPQLYTREVKEQVVKPILRQRKAARAELRQCLARMN 468
              S       +  P GV++P  FYPQLYT+  K+Q+++ ++ +RK AR   R  L  +N
Sbjct: 402 NTES-------MTLPNGVDIPLEFYPQLYTKRCKDQLIRHVISKRKQARIRSRTLLQEIN 454

Query: 469 QLKSYEGKGCCAFLEQYAEVLAGRPCVSAVRSRTKNEMKEVIQKVTSIKLQLNEERAKLK 528
            LKSY+GK     LE     L   P          +   +  +++ S+K  LN  R+   
Sbjct: 455 NLKSYQGKNISTVLESTLAYLQASP---------NDANNKAARQIASLKDTLNSTRSAKM 505

Query: 529 KQYVDLSNKLQNEWNISNPERKVIGEAKRLGLLDKPHLLSMVVLSPYFYLMRDSSGGSDW 588
           ++Y DL++K+  EW++S+PE  +I  AK+L L++ P++L++  LSPY Y +R+ +G   W
Sbjct: 506 EEYKDLASKVHGEWDLSHPETHIIKTAKQLRLIENPYILTLAALSPYSYFLRNRNGV--W 563

Query: 589 TLVQSNSYGTDGLITKHVTEEKVQQYIRDCTKTANDNPLMFIYCREDFFVSQEETWSAIE 648
           + VQSN+ GT+  I    +   VQ+ I+  TK A++ PLMFIYC E    ++EE   A++
Sbjct: 564 SWVQSNALGTEFKIKNCPSPSVVQEAIKHGTKYASETPLMFIYCEEGKIPTEEEVSKALQ 623

Query: 649 KNMGCSEFNKADQLYLLTHREDRNE 673
            N GCS+F K D+  L T R   N+
Sbjct: 624 NNTGCSKFAKDDENSLRTLRSHFND 648

>Smik_15.318 Chr15 complement(545721..547739) [2019 bp, 672 aa] {ON}
           YOR138C (REAL)
          Length = 672

 Score =  391 bits (1005), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 243/676 (35%), Positives = 366/676 (54%), Gaps = 54/676 (7%)

Query: 4   EQDAVASLGEMGIPEDVALDALRRANGNLSAAVNYIFSNDMP------AGEHVELPQPRE 57
           +  AV SL EMGIP +VA++AL+R  GNL AAVN+IFSN++P         +VELP+  E
Sbjct: 3   DNQAVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIFSNELPDQGSMSTENNVELPRISE 62

Query: 58  SSDLKPGDLDQVLRESQRTGPQLNQLVQLDSHPAADTNDEDTGGNIYLDEDDNIEVGSVQ 117
           +  +     D      Q         V +D     D  D+ +G N      +     + +
Sbjct: 63  NRIMAGNSYDVPNNGEQDVDMPDVGGVDVDYDDDEDITDDRSGSN----STNEYRRAAQE 118

Query: 118 LNEVSPA-TSIPPNSDIGSSPDDGTGDPPEYGGCKVPAAEEGAERPDSGAAPAAERYATN 176
            +  S + TSIPP               P Y   +    +   + P             +
Sbjct: 119 YDHYSVSETSIPP---------------PSYNIVQHNEFKSTMDDPTVVLPLPLNSLIES 163

Query: 177 YLVLFAFAVATYAPLQFVQQDFKNLNYDAEWYAGDAIQQPLCIVSDVGADGGSRQIVPEE 236
           Y  LFA  V+ Y P  F++ DF++LN+  +W+ G +  +P   ++   AD GS      +
Sbjct: 164 YFGLFALLVSVYFPHVFLKPDFQDLNFRPDWFKGTSFTEPKYRIAYREADDGS---TTSD 220

Query: 237 EVTSDTP---VQPEMLWQLQRVISVCHSKLSERSYVSAKVFTKVFDTEVESCIRDSDHLY 293
            V +  P   +QP +LWQLQ++ISV ++++ ER++VSAK+FT   + +++S + +S+HLY
Sbjct: 221 IVLASGPSDELQPHLLWQLQKLISVVNTRMCERAFVSAKLFTLSLEPQLKSKLANSEHLY 280

Query: 294 EALPSFIKSIIRDAEMCPAQHSNTDVKSMFLSSAIQDAEQGAEPEETFLFLFHFPPEEYN 353
           E LP+FIKS+  D EMCP    + + +++F+SSA+    +   P ETFL LFHF PEEY+
Sbjct: 281 EVLPAFIKSLAVDLEMCPGIR-DQETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYD 339

Query: 354 ANLYKMFNALLYPEXXXXXXXXXX---XXXXXXXXVQVEGSLKELAPLLTIIFNEADPGQ 410
           +NLYKMFN LLYPE                     V+ E +LKE+AP+LTI+FNE +   
Sbjct: 340 SNLYKMFNVLLYPEEEEEEEEVIRRGGTGQEEERYVEPENTLKEVAPVLTILFNELETNT 399

Query: 411 LSAGAQDTCINSPQGVEVPFSFYPQLYTREVKEQVVKPILRQRKAARAELRQCLARMNQL 470
            S       +  P GV++P  FYPQLYT+  K+Q+++ I+ +RK AR   R  L  ++ L
Sbjct: 400 ES-------VTLPNGVDMPLEFYPQLYTKRCKDQLIRHIISKRKQARVRSRYLLEEISAL 452

Query: 471 KSYEGKGCCAFLEQYAEVLAGRPCVSAVRSRTKNEMKEVIQKVTSIKLQLNEERAKLKKQ 530
           KSY+GK     LE     L   P          +   E   ++ S+K  LN  R+   ++
Sbjct: 453 KSYQGKNTFTILESTLAYLQESP---------DDANNEAASQIASLKDTLNSMRSAKMEE 503

Query: 531 YVDLSNKLQNEWNISNPERKVIGEAKRLGLLDKPHLLSMVVLSPYFYLMRDSSGGSDWTL 590
           Y DL++KL  EWN+S+PE  +I  AK+LGL++ P++L+M  +SPY Y +R+ +G   W+ 
Sbjct: 504 YKDLASKLHGEWNLSHPETHIINTAKQLGLIENPYVLTMAAISPYSYFIRNRNGV--WSW 561

Query: 591 VQSNSYGTDGLITKHVTEEKVQQYIRDCTKTANDNPLMFIYCREDFFVSQEETWSAIEKN 650
           +QSN+ GT+  + K  +   VQ+ IR  TK A++ PLMFIYC E    ++E    A++ N
Sbjct: 562 IQSNTLGTEFKVNKCSSASVVQEAIRHGTKYASEMPLMFIYCEEGKIPTEEVVEKALDSN 621

Query: 651 MGCSEFNKADQLYLLT 666
            GCS+F K DQ  L T
Sbjct: 622 NGCSKFAKDDQSSLRT 637

>Suva_8.190 Chr8 complement(339480..341480) [2001 bp, 666 aa] {ON}
           YOR138C (REAL)
          Length = 666

 Score =  378 bits (971), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 205/501 (40%), Positives = 302/501 (60%), Gaps = 27/501 (5%)

Query: 176 NYLVLFAFAVATYAPLQFVQQDFKNLNYDAEWYAGDAIQQPLCIVSDVGADGGSRQIVPE 235
           +Y  LFA   + Y P  F++ DF++LNY  +W+ G +  +P   ++   +  GS      
Sbjct: 157 SYFGLFALLASMYFPHVFLKPDFQDLNYRPDWFKGSSFAEPRYRLAYRESSDGS---TTS 213

Query: 236 EEVTSDTP---VQPEMLWQLQRVISVCHSKLSERSYVSAKVFTKVFDTEVESCIRDSDHL 292
           E V +  P   VQP +LWQLQ++ISV ++K+ ER++VSAK+FT   + ++++ + DS+HL
Sbjct: 214 EIVVASGPSKDVQPHLLWQLQKLISVVNTKMCERAFVSAKLFTLSLEPQLKAKLADSEHL 273

Query: 293 YEALPSFIKSIIRDAEMCPAQHSNTDVKSMFLSSAIQDAEQGAEPEETFLFLFHFPPEEY 352
           YE LP+FIKS+  D EMCP    + + +++F+SSA+   ++   P ETFL LFHF PEEY
Sbjct: 274 YEVLPTFIKSLAVDLEMCPGIR-DRETRNLFISSALHTPDKNEPPMETFLSLFHFLPEEY 332

Query: 353 NANLYKMFNALLYPEXXXXXXXXXXXXXXXXXXVQVEGSLKELAPLLTIIFNEADPGQLS 412
           ++NLYKMFN LLYPE                   + E +LKE+AP+LTI+FNE +    S
Sbjct: 333 DSNLYKMFNVLLYPEEEEEEGEVVYGGDGAHQ--EPENTLKEVAPVLTILFNELETNTES 390

Query: 413 AGAQDTCINSPQGVEVPFSFYPQLYTREVKEQVVKPILRQRKAARAELRQCLARMNQLKS 472
                  +  P GV+VP  FYPQLYT+  K+Q+++ I+ +RK AR + R  L  +N LKS
Sbjct: 391 -------VTLPNGVDVPLEFYPQLYTKRCKDQLIRHIISKRKQARVKSRSLLQEINNLKS 443

Query: 473 YEGKGCCAFLEQYAEVLAGRPCVSAVRSRTKNEMKEVIQKVTSIKLQLNEERAKLKKQYV 532
           Y+GK     LE           ++ +++ TK+   E  +++ S+K  LN  RA   ++Y 
Sbjct: 444 YQGKNISTILES---------TLAYLQADTKDADNEASKQIASLKDTLNSSRAAKMEEYK 494

Query: 533 DLSNKLQNEWNISNPERKVIGEAKRLGLLDKPHLLSMVVLSPYFYLMRDSSGGSDWTLVQ 592
           DL++KL  EWN+S+PE  +I  AK+LGL++ P++LSM VLSPY Y  RD  G  +W+ +Q
Sbjct: 495 DLASKLHGEWNLSHPEIHIINTAKQLGLIENPYILSMAVLSPYSYFTRDRDG--EWSWIQ 552

Query: 593 SNSYGTDGLITKHVTEEKVQQYIRDCTKTANDNPLMFIYCREDFFVSQEETWSAIEKNMG 652
           SN+ GT+  I K  +   VQ+ IR  TK A++ PLMFIYC E    + +E   A+E N G
Sbjct: 553 SNTLGTEFKINKCSSPSVVQEAIRHGTKYASEMPLMFIYCEEGRIPTDDEVSKALENNTG 612

Query: 653 CSEFNKADQLYLLTHREDRNE 673
           C +F K DQ  L T R   N+
Sbjct: 613 CVKFAKDDQSTLNTLRAQFND 633

>TDEL0A03390 Chr1 complement(603062..604930) [1869 bp, 622 aa] {ON}
           Anc_5.475 YOR138C
          Length = 622

 Score =  362 bits (928), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 234/679 (34%), Positives = 347/679 (51%), Gaps = 99/679 (14%)

Query: 4   EQDAVASLGEMGIPEDVALDALRRANGNLSAAVNYIFSNDMPAG--------EHVELPQP 55
           + DAV SL EMGI +DVA DALRR NG++ AA N+IF ND PA          H+ELP  
Sbjct: 3   DTDAVRSLVEMGISKDVAEDALRRTNGDVEAAGNFIFCNDAPAQISENVEQRAHIELP-A 61

Query: 56  RESSDLKPGDLDQVLRESQRTGPQLNQLVQLDSHPAADTNDEDTGGNIYLDEDDNIEVGS 115
             +S  +PGDL++ +                    A DT  ED        E+ ++E  S
Sbjct: 62  GSASGFQPGDLNEYISN------------------APDTESEDF-------EEIDVEEDS 96

Query: 116 VQLNEVSPATSIPPNSDIGSSPDDGTGDPPEYGGCKVPAAEEGAERPDSGAAPAAERYAT 175
           V   E  P+          S P      PP +         EG                 
Sbjct: 97  V---ETGPSLECSGRKGQISDPTVVLPLPPNF-------LFEG----------------- 129

Query: 176 NYLVLFAFAVATYAPLQFVQQDFKNLNYDAEWYAGDAIQQP---LCIVSDVGADGGSRQI 232
            Y  LF   VA Y P    + DF +LNYD  WY GD+       L  +S  G+D    +I
Sbjct: 130 -YFALFCLFVANYMPHLLARPDFIDLNYDKNWYRGDSYTNAEYRLKYLSKNGSDDEQIEI 188

Query: 233 VPEEEVT---SDTPVQPEMLWQLQRVISVCHSKLSERSYVSAKVFTKVFDTEVESCIRDS 289
           VP++E+T    D  +Q E+LWQLQ++ SV +S++S+R+YV AK+F    + +V+  + ++
Sbjct: 189 VPKDELTQEDGDYTLQSELLWQLQKLASVANSRMSDRAYVRAKMFAIAVEPQVQRNMAEA 248

Query: 290 DHLYEALPSFIKSIIRDAEMCPAQHSNTDVKSMFLSSAIQDAEQGAEPEE----TFLFLF 345
           +HL+E LPSFIKS+  D EMCP    N +V+  F+SSA       A  EE    T+L LF
Sbjct: 249 EHLHEVLPSFIKSVAVDLEMCPNFQDN-EVRECFISSAFHTPSNSAPQEESTMKTWLSLF 307

Query: 346 HFPPEEYNANLYKMFNALLYPEXXXXXXXXXXXXXXXXXXVQVEGSLKELAPLLTIIFNE 405
           HF PEEY  NLY+MFNALL+ +                   + E SL E+AP+ TI+F+E
Sbjct: 308 HFLPEEYETNLYRMFNALLFADDSVESDQSDSPDG------EGENSLSEIAPVFTIVFDE 361

Query: 406 ADPGQLSAGAQDTCINSPQGVEVPFSFYPQLYTREVKEQVVKPILRQRKAARAELRQCLA 465
            +            +   +GVE+P  FYPQLYT+E K++++K I+ +R+ ++ + R  L 
Sbjct: 362 MEETT-------EAVPLAEGVEMPLEFYPQLYTKECKDKLIKHIIAKRRQSQTDSRAILQ 414

Query: 466 RMNQLKSYEGKGCCAFLEQYAEVLAGRPCVSAVRSRTKNEMKEVIQKVTSIKLQLNEERA 525
            +  LKS++GK    F+    + L           +   +  E+I+ +  +K Q+  ++ 
Sbjct: 415 EITDLKSFQGKDLSKFINSSLDYL-----------QKDEKSPELIKGLLDLKDQITNKKT 463

Query: 526 KLKKQYVDLSNKLQNEWNISNPERKVIGEAKRLGLLDKPHLLSMVVLSPYFYLMRDSSGG 585
           K   +Y +++++LQ+EWN+S PE +++  AK LGL+D  +LL+M V+SPY Y  R+  G 
Sbjct: 464 KKMNEYKEIAHRLQSEWNLSLPEIQIVKTAKELGLIDDSYLLTMAVISPYMYYTRNRDG- 522

Query: 586 SDWTLVQSNSYGTDGLITKHVTEEKVQQYIRDCTKTANDNPLMFIYCREDFFVSQEETWS 645
             W  VQS  Y     +    +  ++Q  I+  T+  ++ PLMFIYC++ F    +    
Sbjct: 523 -QWFFVQSTPYEASYNVRACSSPLEIQDAIKQHTRRPSEAPLMFIYCKKGFIPDDDTVLK 581

Query: 646 AIEKNMGCSEFNKADQLYL 664
           A+E N GC  F K DQL L
Sbjct: 582 ALENNQGCHRFAKDDQLQL 600

>NCAS0H02270 Chr8 complement(445144..447234) [2091 bp, 696 aa] {ON}
           Anc_5.475 YOR138C
          Length = 696

 Score =  356 bits (914), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 231/707 (32%), Positives = 357/707 (50%), Gaps = 77/707 (10%)

Query: 3   EEQDAVASLGEMGIPEDVALDALRRANGNLSAAVNYIFSNDMPAGEHVELPQPRESSDLK 62
           E  + V +L EMGIP +VA+DAL R  GNL  AV +IFSN++P  E  +   P   +D  
Sbjct: 2   ENNETVKTLLEMGIPREVAVDALMRTGGNLEDAVAFIFSNELPQTEQEQPYIPININDQD 61

Query: 63  PGDLDQVLRESQRTGPQLNQLVQLDSHPAADTNDEDTGGNIYLDEDDNIEVGSVQLNEVS 122
           P   +Q L             V   ++P  ++N+       YL  D+ +E   VQ   + 
Sbjct: 62  PLPSEQDLANQDYRSSNTPSSVPGSNNPFRESNN-------YLG-DEYVEGQEVQRELID 113

Query: 123 PAT---------------------------SIPPNSDIGSSPDDGTGD--PPEYGGCKVP 153
             +                           ++P +  I S+ +  + +  PP+Y      
Sbjct: 114 VDSSDDEDEDEDDGMDGYRSESRSISQQNGNVPESFHIESATNSMSQEMIPPKYNLVAKG 173

Query: 154 AAEEGAERPDSGAAPAAERYATNYLVLFAFAVATYAPLQFVQQDFKNLNYDAEWYAGDAI 213
             ++  ++P             NYL LFA       P  F++ DFK+LNY+  WY G + 
Sbjct: 174 PLKDELDQPTIILPLPLNSMIENYLSLFALNAVINIPQFFLKTDFKDLNYNKNWYKGTSF 233

Query: 214 QQPLCIVS----------DVGADGGSR-----QIVPEEEVTSDTPVQPEMLWQLQRVISV 258
           + P  I+           +  A+ G +      I+P          QP +LWQLQ++ ++
Sbjct: 234 EMPKFILEFDSSNDTTTINENAERGDQYRKAVDIIPIGTSDKVEKQQPFLLWQLQKLAAI 293

Query: 259 CHSKLSERSYVSAKVFTKVFDTEVESCIRDSDHLYEALPSFIKSIIRDAEMCPAQHSNTD 318
               +SER+Y SA++F+ VF+ +V S +  SD+L + LP FIKSI  D ++CP+   +  
Sbjct: 294 NSFSMSERAYASARIFSLVFNGQVRSVLSKSDNLIDVLPLFIKSITTDLQLCPSNSDDES 353

Query: 319 VKSMFLSSAIQDAEQGAEPEETFLFLFHFPPEEYNANLYKMFNALLYPEXXXXXXXXXXX 378
            + +F++SA    E+     ET L  FHF PEEYN NLYKMFN LLYP+           
Sbjct: 354 PQDLFITSAFHLPEKSQSLVETKLAFFHFMPEEYNENLYKMFNVLLYPDDPSENNEDNGE 413

Query: 379 XXXXXXXVQVEGSLKELAPLLTIIFNEADPGQLSAGAQDTCINSPQGVEVPFSFYPQLYT 438
                       SL + A ++T+IFNEAD       A    + S  GVE+P +FYPQLY 
Sbjct: 414 QEEV-----YNNSLNKAAHIITVIFNEAD-------AYTPEMTSNSGVEIPLTFYPQLYF 461

Query: 439 REVKEQVVKPILRQRKAARAELRQCLARMNQLKSYEGKGCCAFLEQYAEVLAGRPCVSAV 498
           ++ K+Q++K IL +R+ A A  +Q L  + QLKS+EGK     LE   E L         
Sbjct: 462 KKCKDQLIKHILEKRRQALARSKQLLDEIRQLKSFEGKDISMTLESAKEYL--------- 512

Query: 499 RSRTKNEM-KEVIQKVTSIKLQLNEERAKLKKQYVDLSNKLQNEWNISNPERKVIGEAKR 557
             + +N M K + + +T I++ + E++    ++Y  LS++L  +WN+S+PE ++I  AK 
Sbjct: 513 -QKEENPMGKNLHETITKIEMMIAEKKNSKMEEYKILSSQLHKDWNLSHPELQIIETAKT 571

Query: 558 LGLLDKPHLLSMVVLSPYFYLMRDSSGGSDWTLVQSNSYGTDGLITKHVTEEKVQQYIRD 617
           LGL+D+P+LL+ V++SPY Y +R   G   W  VQ N+ GTD  +++  +   VQ+ I+ 
Sbjct: 572 LGLIDEPYLLTTVIISPYLYYIRKKDGI--WYSVQCNTLGTDFQVSQLESGAAVQEIIKA 629

Query: 618 CTKTANDNPLMFIYCREDFFVSQEETWSAIEKNMGCSEFNKADQLYL 664
            T   N+ PLMF++CRE     ++    A+E+N+GC +F K DQL L
Sbjct: 630 QTSRPNETPLMFLFCRESIIPDEDTVRKAMEENLGCLQFAKQDQLSL 676

>TPHA0J02780 Chr10 complement(619045..620940) [1896 bp, 631 aa] {ON}
           Anc_5.475 YOR138C
          Length = 631

 Score =  353 bits (906), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 230/686 (33%), Positives = 343/686 (50%), Gaps = 88/686 (12%)

Query: 1   MGEEQDAVASLGEMGIPEDVALDALRRANGNLSAAVNYIFSNDMP--------------A 46
           M + +++V S+ +MGIPEDVA+DAL R NG+L AAVN+IFSN++P               
Sbjct: 1   MNDNKNSVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIFSNELPDNNMGESVGNEKYTT 60

Query: 47  GEHVELPQPRESSDLKPGDLDQVLRESQRTGPQLNQLVQLDSHPAADTNDEDTGGNIYLD 106
            EHV +      ++ + GDL +V+  S                   D   E   G++  D
Sbjct: 61  SEHVNISN---DNNFQAGDLSEVMNVSNY---------------GYDNRFETDSGDLSSD 102

Query: 107 EDDNIEVGSVQLNEVSPATSIPPNSDIGSSPDDGTGDPPEYGGCKVPAAEEGAERPDSGA 166
           E  + E+     N++S    +P                  Y   K    +     P    
Sbjct: 103 EVSDPEIVE---NDISNNLKLPA-----------------YNIVKHEVEKTSLSDPTVVM 142

Query: 167 APAAERYATNYLVLFAFAVATYAPLQFVQQDFKNLNYDAEWYAGDAIQQPLCIVS----D 222
                    +Y  LF+  ++ Y P   ++ DFK+LNYD EWY G     P   +     +
Sbjct: 143 PLPHNSIIESYFGLFSMFISIYLPHLLLKPDFKDLNYDNEWYNGLKFVAPKFGIKVHNEE 202

Query: 223 VGADGGSRQIVPEEEVTSDTPVQPEMLWQLQRVISVCHSKLSERSYVSAKVFTKVFDTEV 282
              D     I P   V  D   QP++LWQLQ++ ++ +S +SERSYVS+K+F+   D   
Sbjct: 203 SLKDDLHTSIEPLTCVDRDLDDQPKLLWQLQKLSTIMNSTMSERSYVSSKLFSLCLDRNA 262

Query: 283 ESCIRDSDHLYEALPSFIKSIIRDAEMCPAQHSNTDVKSMFLSSAIQDAEQGAEPEETFL 342
           +  ++D++HLYE LPSFIK +  + EMCP    + ++++  +SSA         P +T L
Sbjct: 263 KMKLQDAEHLYEVLPSFIKYLTSNLEMCPDFRPD-EIRNELISSAYYLPSDDEPPVKTLL 321

Query: 343 FLFHFPPEEYNANLYKMFNALLYPEXXXXXXXXXXXXXXXXXXVQVEGSLKELAPLLTII 402
            LFHF P+EY +NLYKMFN LLY +                  +    SL  LAP LTII
Sbjct: 322 TLFHFLPDEYESNLYKMFNILLYAD-----------DEDGDGAIDEGNSLNYLAPNLTII 370

Query: 403 FNEADPGQLSAGAQDTCINSPQGVEVPFSFYPQLYTREVKEQVVKPILRQRKAARAELRQ 462
           F+E D  +LS+         P+GV +P  FYPQLYT+E K+Q++K I+ +R+ A+ E RQ
Sbjct: 371 FDEID--ELSSMTP-----LPEGVSIPLEFYPQLYTKECKDQLIKHIIGKRQDAQKESRQ 423

Query: 463 CLARMNQLKSYEGKGCCAFLEQYAEVLAGRPCVSAVRSRTKNEMKE----VIQKVTSIKL 518
            L  +N LKS++GK    FL    + L           + +N + E    +++ +T IK 
Sbjct: 424 HLKDLNSLKSFQGKDILKFLNSTLDFLDR-------DGQRQNGLTEGNGKLMEGLTDIKE 476

Query: 519 QLNEERAKLKKQYVDLSNKLQNEWNISNPERKVIGEAKRLGLLDKPHLLSMVVLSPYFYL 578
           QL +++ +    Y DL+ KL   WN+SNPE  +I  AK+LGL+D+P+ LSM V+SP  Y 
Sbjct: 477 QLTKKKTEKMNAYKDLTQKLNTSWNLSNPEVSIIATAKKLGLIDEPYHLSMAVMSPNLYY 536

Query: 579 MRDSSGGSDWTLVQSNSYGTDGLITKHVTEEKVQQYIRDCTKTANDNPLMFIYCREDFFV 638
           ++   G   W LVQ    G D  I K  +  ++Q  +R  T+  ++ PLMF+Y +E    
Sbjct: 537 IKKRDGT--WYLVQITENGDDFDIRKCSSGVEIQDCVRQYTRHGSETPLMFVYTKEGSIP 594

Query: 639 SQEETWSAIEKNMGCSEFNKADQLYL 664
             +     +E N GC +F K DQ  L
Sbjct: 595 DDDSVQKILEANTGCLQFLKDDQKLL 620

>SAKL0G03564g Chr7 complement(294308..296125) [1818 bp, 605 aa] {ON}
           similar to uniprot|Q12242 Saccharomyces cerevisiae
           YOR138C RUP1
          Length = 605

 Score =  343 bits (880), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 214/670 (31%), Positives = 348/670 (51%), Gaps = 93/670 (13%)

Query: 1   MGEEQDAVASLGEMGIPEDVALDALRRANGNLSAAVNYIFSNDMPAG-EHVELPQPRESS 59
           M +   ++  L +MGI  +VA+DAL R NG+L A+VNYIFS ++ A  EHV+L Q    S
Sbjct: 1   MEQANQSIQPLLDMGISHEVAVDALSRTNGDLEASVNYIFSGELQATTEHVDLTQDDSDS 60

Query: 60  D--LKPGDLDQVLRESQRTGPQLNQLVQLDSHPAADTNDEDT---GGNIYLDEDDNIEVG 114
           +  +KPG L+ V+       P  + +  +++    +T  +D     G +    D   ++ 
Sbjct: 61  ENGIKPGMLNDVI-------PNTDNVTTVETREVENTIPDDVLAPSGIM----DSTTQLL 109

Query: 115 SVQLNEVSPATSIPPNSDIGSSPDDGTGDPPEYGGCKVPAAEEGAERPDSGAAPAAERYA 174
              LN+ +    +PPN+                                           
Sbjct: 110 KDSLNDPTVVLPLPPNA-----------------------------------------LL 128

Query: 175 TNYLVLFAFAVATYAPLQFVQQDFKNLNYDAEWYAGDAIQQPLCIVSDVGADGGSRQIVP 234
            NY  LF  +V    P  F++ DF++LNY+  W+ G    +P   +    +   +  IVP
Sbjct: 129 ENYFALFCLSVGISFPHHFLKPDFQDLNYNRNWFKG-YYSKPEYRLQ--FSSNNNVSIVP 185

Query: 235 EEEVT--SDTPVQPEMLWQLQRVISVCHSKLSERSYVSAKVFTKVFDTEVESCIRDSDHL 292
           + ++T      +QPE+LWQ Q+ I+V +S +S+R +VSAK+F KV +  V   +   DHL
Sbjct: 186 KAQLTIQDSLTLQPELLWQFQKFIAVLNSSISDRKFVSAKIFHKVLEPLVLDKLGSCDHL 245

Query: 293 YEALPSFIKSIIRDAEMCPAQHSNTDVKSMFLSSAIQDAEQGAEPEETFLFLFHFPPEEY 352
           +E LPSFIKS+  D EMC  +    D++ +F+S+A     +  +  ET + L HF PEEY
Sbjct: 246 FEVLPSFIKSLANDVEMCLLKEDARDIRGLFISTAYHKPSKDEKTIETLVSLLHFLPEEY 305

Query: 353 NANLYKMFNALLYPEXXXXXXXXXXXXXXXXXXVQVEGSLKELAPLLTIIFNEADPGQLS 412
           + NLY+MFN LLYPE                   +VE SL  LAP+LT++F+E D    +
Sbjct: 306 DTNLYRMFNTLLYPEEDEDGE-------------EVENSLGNLAPMLTVVFDEMDESTEN 352

Query: 413 AGAQDTCINSPQGVEVPFSFYPQLYTREVKEQVVKPILRQRKAARAELRQCLARMNQLKS 472
              Q       QGV+VP  FYPQ+YT+  K+ ++  ++ +RK A++     L  +N LKS
Sbjct: 353 VSLQ-------QGVDVPLKFYPQIYTKSSKDSLINHVIAKRKEAQSASHAILQDLNGLKS 405

Query: 473 YEGKGCCAFLEQYAEVLAGRPCVSAVRSRTKNEMKEVIQKVTSIKLQLNEERAKLKKQYV 532
           ++GK   +FL    +  A  P       +   + +E+++ + SIK Q+  ++    ++Y 
Sbjct: 406 FQGKHINSFLNSTVDFAAKDPLF-----QNDKDTEELLKSLVSIKEQITTKKTNKMEEYK 460

Query: 533 DLSNKLQNEWNISNPERKVIGEAKRLGLLDKPHLLSMVVLSPYFYLMRDSSGGSDWTLVQ 592
           ++S+ + N+WN+S+P+  V+  AK++GL+D+P+LL+  +LSPY Y +R   G   W  V 
Sbjct: 461 NISHMIHNKWNLSHPDLYVVDAAKKMGLIDEPYLLTSAILSPYHYYIRKRDGI--WYRVI 518

Query: 593 SNSYGTDGLITKHVTE-EKVQQYIRDCTKTANDNPLMFIYCREDFFVSQEETWSAIEKNM 651
           S + G+D  +   +TE  +V + I+  T+ A++ PLMF YC+E    ++     ++E N 
Sbjct: 519 SEANGSD--LEASITEPHEVSESIKLATRHASETPLMFTYCKESKIGNENSIRKSLEDNQ 576

Query: 652 GCSEFNKADQ 661
           G S+F K DQ
Sbjct: 577 GVSKFVKMDQ 586

>TBLA0A02540 Chr1 (613560..615596) [2037 bp, 678 aa] {ON} Anc_5.475
           YOR138C
          Length = 678

 Score =  326 bits (835), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 221/717 (30%), Positives = 345/717 (48%), Gaps = 111/717 (15%)

Query: 14  MGIPEDVALDALRRANGNLSAAVNYIFSNDMPAGEHVELPQPRESSDLKPGDL------- 66
           MGI +DVA   L +  GNL AA+N+IF         ++ P  +E   +   DL       
Sbjct: 1   MGIAKDVATSTLNKVGGNLEAAINHIF---------LDTPDTQEREAISTSDLLTAQKTI 51

Query: 67  -----------DQVLRESQRTGPQLNQLVQLDSHPAADTNDEDTGGNIYL---DEDDNIE 112
                           +SQ T   + +L + +S    ++N  +   N ++     + N  
Sbjct: 52  SSNNYNNDNSNSSFDSDSQATSCHI-ELSRKNSR-KVNSNTSNLPSNTFIISGGSNSNNI 109

Query: 113 VGSVQLNEVSPATSI----------------PPNSDIGSSPDDGTGD---PPEYGGCKVP 153
           +    L+E S  +SI                P   D   + +D +     PP Y      
Sbjct: 110 LSRENLSENSSDSSIDSKEEYQPLYLTDTQPPTYQDFTMTSNDNSQQIFVPPVYSKGTYK 169

Query: 154 AAEEGAERPDSGAAPAAERYATNYLVLFAFAVATYAPLQFVQQDFKNLNYDAEWYAGDAI 213
             +   + P    +    +  +NY  LF+ ++A +AP  F+  DF NLN++  W  G  I
Sbjct: 170 VQKSLPDDPTVLLSLEPSKLLSNYFGLFSMSLALFAPDLFMGPDFVNLNFNDNWNKGLQI 229

Query: 214 QQP-----------------LCIVSDVGADGGSRQIVPEEEVTSDTPVQPEMLWQLQRVI 256
             P                 + IV+ +      R++            QP +LWQLQ+VI
Sbjct: 230 DTPEYEVKYTHNLEPGLEDRIEIVNAINLSEKERELT----------YQPYILWQLQKVI 279

Query: 257 SVCHSKLSERSYVSAKVFTKVFDTEVESCIRDSDHLYEALPSFIKSIIRDAEMCPAQHSN 316
           S+ +S++S R+Y+S+ +++   D   +  + ++ HLY+ LP+FI+S++ D +  P    N
Sbjct: 280 SIMNSQISSRAYISSGIYSLCLDDNTQKKLMETSHLYDILPTFIRSLMNDCKHVPDLDQN 339

Query: 317 TDVKSMFLSSAIQDAEQGAEPEETFLFLFHFPPEEYNANLYKMFNALLYPEX------XX 370
             +K+MF+S A        EP +  LFLFHF PEEY++NLYKMFN+LLY           
Sbjct: 340 R-MKNMFVSKAFHQIPIHKEPTKVSLFLFHFLPEEYDSNLYKMFNSLLYRSYDEPIYPRT 398

Query: 371 XXXXXXXXXXXXXXXVQVEGSLKELAPLLTIIFNEADPGQLSAGAQDT-CINSPQGVEVP 429
                           + E SL E++ +LT+IF+E D        QDT  I  P GVE+P
Sbjct: 399 NQNSADSSSSDDEISNEEESSLDEISTILTVIFDELD--------QDTELITQPDGVEIP 450

Query: 430 FSFYPQLYTREVKEQVVKPILRQRKAARAELRQCLARMNQLKSYEGKGCCAFLEQYAEVL 489
           F FYP+LYT++ KE+++  IL  R   + ++++ L  +N LKS+EGK    FL    E L
Sbjct: 451 FEFYPELYTKKCKEKLINGILHTRYQNKLKMKEVLNDLNSLKSFEGKDILRFLNSTLEYL 510

Query: 490 AGRPCVSAVRSRTKNEMKE--VIQKVTSIKLQLNEERAKLKKQYVDLSNKLQNEWNISNP 547
                        + + KE  ++ K++ +K QL+  + +   +Y  +S  LQNEWNI  P
Sbjct: 511 -------------QRDGKEGPMVNKLSYVKEQLSRAKTEKMLEYKTISRSLQNEWNIDKP 557

Query: 548 ERKVIGEAKRLGLLDKPHLLSMVVLSPYFYLMRDSSGGSDWTLVQSNSYGTDGLITKHVT 607
           E  +I +A+ LGL+  PHLL M VLSPY Y  RD      W   QS+  GTD  ITK+ +
Sbjct: 558 ELSIIEQAQDLGLIGDPHLLVMAVLSPYLYFFRDRRNR--WFKFQSSIMGTDFEITKYES 615

Query: 608 EEKVQQYIRDCTKTANDNPLMFIYCREDFFVSQEETWSAIEKNMGCSEFNKADQLYL 664
           ++ VQ  I+  TK+A++ P+MF+YC++D   +         KN GCS F +AD++ L
Sbjct: 616 DKTVQDEIKLNTKSASETPIMFVYCKKDAIPNDSLVLQKFAKNQGCSAFAQADEMSL 672

>Kwal_55.21267 s55 (757685..759499) [1815 bp, 604 aa] {ON} YOR138C -
           Hypothetical ORF [contig 130] FULL
          Length = 604

 Score =  320 bits (821), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 213/666 (31%), Positives = 322/666 (48%), Gaps = 90/666 (13%)

Query: 5   QDAVASLGEMGIPEDVALDALRRANGNLSAAVNYIFSNDMPAGEHVELPQPRESSDLKPG 64
           + A+ SL +MGI  DVA++AL + NG++  +VNYIFS ++P        Q  ES  L+P 
Sbjct: 3   ESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIFSGELPQ-------QGPESKPLQP- 54

Query: 65  DLDQVLRESQRTGPQLNQLVQLDSHPAADTNDEDTGGNIYLDEDDNIEVGSVQLNEVSPA 124
                L      GPQ                +ED   +  L+  +   V +  L E    
Sbjct: 55  -----LHADAEQGPQ---------------KEEDREDSALLEHTEYASVSNGPLEE---- 90

Query: 125 TSIPPNSDIGSSPDDGTGDPPEYGGCKVPAAEEGA-------ERPDSGAAPAAERYATNY 177
                              P  Y    +   EE A       E P      ++     NY
Sbjct: 91  -------------------PERYRDYTLSTQEEAANEVKNDQEDPLVVKPESSNALFENY 131

Query: 178 LVLFAFAVATYAPLQFVQQDFKNLNYDAEWYAGDAIQQPLCIVSDVGADGGSRQIVPEEE 237
             LF  AV    P  F+  DFK+LNY  +W  G  ++    I  +   D     IVP E 
Sbjct: 132 FALFCLAVGLGFPHYFLGPDFKDLNYGPDWARGQFLKPQFRIKFETNED---VTIVPRET 188

Query: 238 VTS--DTPVQPEMLWQLQRVISVCHSKLSERSYVSAKVFTKVFDTEVESCIRDSDHLYEA 295
           +TS  +  +QPE+LWQ Q+ ++V HS  S R  VSA+  TK  + +V   + +++HL++ 
Sbjct: 189 LTSQDNLTLQPELLWQFQKFLAVQHSPSSYRKQVSARYLTKALEPQVVEKLNNAEHLHDV 248

Query: 296 LPSFIKSIIRDAEMCPAQHSNTDVKSMFLSSAIQDAEQGAEPEETFLFLFHFPPEEYNAN 355
           LPSFI+S+  D E+CP   S   +K +F+S+A         P ET + L HF PEEY++N
Sbjct: 249 LPSFIRSLANDVELCPGSQS---IKELFISTAYYKPASEPVPIETLVSLLHFMPEEYDSN 305

Query: 356 LYKMFNALLYPEXXXXXXXXXXXXXXXXXXVQVEGSLKELAPLLTIIFNEADPGQLSAGA 415
           +YKMFNALLYP                    + + SL  LA ++TI+F+E D        
Sbjct: 306 IYKMFNALLYPNDADDDDDVE----------ETQNSLGNLASMITIVFDEMDEST----- 350

Query: 416 QDTCINSPQGVEVPFSFYPQLYTREVKEQVVKPILRQRKAARAELRQCLARMNQLKSYEG 475
               I  P GVEVP  FYPQLYT + K+ ++K + +     +      L  +N+LKS++G
Sbjct: 351 --DDIRLPHGVEVPMKFYPQLYTEDAKQSLIKDVTKHAGEGQQRAHSILKTLNELKSFQG 408

Query: 476 KGCCAFLEQYAEVLAGRPCVSAVRSRTKNEMKEVIQKVTSIKLQLNEERAKLKKQYVDLS 535
           K   +FL    + +A R   +   +   N++ + +Q    IK  L++++     +Y  +S
Sbjct: 409 KHIHSFLNSTLDFIA-RDSSAVTENPQINDLVDTLQH---IKQDLSKKKTDGMAEYKAIS 464

Query: 536 NKLQNEWNISNPERKVIGEAKRLGLLDKPHLLSMVVLSPYFYLMRDSSGGSDWTLVQSNS 595
           +KL N+WN+S+PE  +I + ++LGL+D+P++L+  V+SP+ Y +R     S W  V    
Sbjct: 465 HKLNNDWNLSHPELGIIEQGEKLGLIDEPYILTTAVISPFNYFIRKRD--SQWYHVLGKQ 522

Query: 596 YGTDGLITKHVTEEKVQQYIRDCTKTANDNPLMFIYCREDFFVSQEETWSAIEKNMGCSE 655
           +  D L       E V   IR  T+TA++ PLMF Y +E    + E    AIEKN G + 
Sbjct: 523 HN-DALNVAKTDAETVTNTIRLNTRTASETPLMFTYFKESAIDTNETLTEAIEKNTGVTS 581

Query: 656 FNKADQ 661
           F + DQ
Sbjct: 582 FAEQDQ 587

>KLTH0F15004g Chr6 (1228654..1230447) [1794 bp, 597 aa] {ON} weakly
           similar to uniprot|Q12242 Saccharomyces cerevisiae
           YOR138C RUP1
          Length = 597

 Score =  300 bits (768), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 190/543 (34%), Positives = 286/543 (52%), Gaps = 40/543 (7%)

Query: 128 PPNSDIGSSPDDGTGDPPEYGGCKVPAAEEG--AERPDSGAAPAAERYATNYLVLFAFAV 185
           PP+ D  +        P E   C++    E     RP SG A        NY  LF  AV
Sbjct: 79  PPSEDEATDQQGVAVSPREQIACQLKNRPEDPLVVRPASGNA-----LFENYFALFCLAV 133

Query: 186 ATYAPLQFVQQDFKNLNYDAEWYAGDAIQQPLCIVSDVGADGGSRQIVPEEEVTS--DTP 243
               P  F++ DF++L Y  +WY G  ++ P   V     D  S  IVP+E +TS  +  
Sbjct: 134 GLGFPHHFLEPDFQDLTYGQDWYKGQFLK-PAYRVKFENNDDVS--IVPQETLTSQDNLI 190

Query: 244 VQPEMLWQLQRVISVCHSKLSERSYVSAKVFTKVFDTEVESCIRDSDHLYEALPSFIKSI 303
           +QPE+LWQ Q+ ++V +S    R YV+A+  TKV + +V   + +SDHL+EALPSFIKS+
Sbjct: 191 LQPELLWQFQKFLAVQNSPQCRRKYVTARYLTKVLEPQVVEKLNNSDHLHEALPSFIKSL 250

Query: 304 IRDAEMCPAQHSNTDVKSMFLSSAIQDAEQGAEPEETFLFLFHFPPEEYNANLYKMFNAL 363
             D E+CP  HS   VK +F+S+A        EP ET + L HF PEEY+ N+YKMFNAL
Sbjct: 251 ANDVELCPGAHS---VKELFISTAYYKPVSEPEPIETLVSLLHFMPEEYDTNIYKMFNAL 307

Query: 364 LYPEXXXXXXXXXXXXXXXXXXVQVEGSLKELAPLLTIIFNEADPGQLSAGAQDTCINSP 423
           LYP+                    ++ SL  LAP++TI+F+E D     A         P
Sbjct: 308 LYPDSNEDAEMD-----------DIQNSLGNLAPMITIVFDEMDESTEQATL-------P 349

Query: 424 QGVEVPFSFYPQLYTREVKEQVVKPILRQRKAARAELRQCLARMNQLKSYEGKGCCAFLE 483
            GV+VP  FYPQLYT E K  ++K + +    ++ + R  L  +N LKS++GK   +FL 
Sbjct: 350 HGVDVPLEFYPQLYTEEAKNLLIKEVTKLSADSQTQARSILRNLNDLKSFQGKQIHSFLN 409

Query: 484 QYAEVLAGRPCVSAVRSRTKNEMKEVIQKVTSIKLQLNEERAKLKKQYVDLSNKLQNEWN 543
              + +     +S V  ++   ++E++  +  +K QL  ++ +   QY  +S++L NE N
Sbjct: 410 SALDFITKD--MSGVSEQSG--VQELVDSLQEVKQQLGSKKTEKMAQYKAVSHRLNNELN 465

Query: 544 ISNPERKVIGEAKRLGLLDKPHLLSMVVLSPYFYLMRDSSGGSDWTLVQSNSYGTDGLIT 603
           +S+PE  +I  AK LGL+D+P+LL+  V+S   Y +R ++G     + +SNS   D   T
Sbjct: 466 LSHPELGIIQRAKDLGLIDEPYLLTSAVISASNYFIRQNNGQWFHVVGRSNSEHMDVTKT 525

Query: 604 KHVTEEKVQQYIRDCTKTANDNPLMFIYCREDFFVSQEETWSAIEKNMGCSEFNKADQLY 663
              T   V   IR  T+ A+++PLMF Y +     ++ +   A+  N G   F + DQ +
Sbjct: 526 DAST---VSSAIRFHTRCASESPLMFTYFKPSAIDTEAQVKEAVGHNKGAKLFAEQDQKH 582

Query: 664 LLT 666
           + T
Sbjct: 583 INT 585

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 32/41 (78%)

Query: 5  QDAVASLGEMGIPEDVALDALRRANGNLSAAVNYIFSNDMP 45
          ++A+ SL +MGI  +VA++AL + NG++  +VNYIFS ++P
Sbjct: 3  ENAIQSLLDMGITREVAIEALAKTNGDVENSVNYIFSGELP 43

>ZYRO0D11264g Chr4 complement(948942..950585) [1644 bp, 547 aa] {ON}
           similar to uniprot|Q12242 Saccharomyces cerevisiae
           YOR138C RUP1
          Length = 547

 Score =  288 bits (737), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 206/656 (31%), Positives = 317/656 (48%), Gaps = 116/656 (17%)

Query: 6   DAVASLGEMGIPEDVALDALRRANGNLSAAVNYIFSNDMPAGEHVELPQPRESSDLKPGD 65
           +A  SL EMGI  +VA  AL++ +GNL AAVNYIFS ++   + V  PQ        PG 
Sbjct: 2   NAQQSLIEMGITPEVAQRALQQTHGNLEAAVNYIFSGEVSDDQPVNQPQSAPMPGFAPGS 61

Query: 66  LDQVLRESQRTGPQLNQLVQLDSHPAADTNDEDTGGNIYLDEDDNIEVGSVQLNEVSPAT 125
           L         +G   NQ+   +   ++ +                         E+SP  
Sbjct: 62  L---------SGVMTNQIDDDEDDDSSSSE-----------------------RELSPP- 88

Query: 126 SIPPNSDIGSSPDDGTGDPPEYGGCKVPAAEEGAERPDSGAAPAAERYATNYLVLFAFAV 185
            +PP    G S   G  +  E    ++ + ++      +   P       NY  LF+ ++
Sbjct: 89  -LPPRDSPGFS---GMSEGVE---IEIQSPKKSLVTDPTVVIPLPHSLFENYFALFSLSM 141

Query: 186 ATYAPLQFVQQDFKNLNYDAEWYAGDAIQQPLCIVSDVGADGGSRQIVPEEEVTSDTPVQ 245
             Y P    + +  +L Y+ +W  G                            +SD    
Sbjct: 142 CQYLPHLMAKPELGDLMYNPKWAQG----------------------------SSDPST- 172

Query: 246 PEMLWQLQRVISVCHSKLSERSYVSAKVFTKVFDTEVESCIRDSDHLYEALPSFIKSIIR 305
              + QLQR+ SV ++  S+R YVSAK+F  V D  ++  + +++HL+E LPSFI+S+I 
Sbjct: 173 -SFIQQLQRLCSVVNASFSDRCYVSAKLFAAVLDAPLKRKLAEAEHLHEVLPSFIRSLIH 231

Query: 306 DAEMCPAQHSNTDVKSMFLSSAIQDAEQGAEPEETFLFLFHFPPEEYNANLYKMFNALLY 365
             E C   ++   ++S+F+SSA+      +   ++ L +  F PEEY ++LY MFNALLY
Sbjct: 232 ALEECGC-YAEDQIRSLFVSSAL------SSECKSLLSVLQFMPEEYESSLYAMFNALLY 284

Query: 366 PEXXXXXXXXXXXXXXXXXXVQVEGSLKELAPLLTIIFNEADPGQLSAGAQDTCINSPQG 425
           PE                   +   SL +LAP+LTI+F+E D         DT + S +G
Sbjct: 285 PELEEGE--------------ESGNSLLDLAPVLTIVFDEMD--------ADTEVTSNRG 322

Query: 426 VEVPFSFYPQLYTREVKEQVVKPILRQRKAARAELRQCLARMNQLKSYEGKGCCAFLEQY 485
           V+VP  FYPQLYT+ VK+ +V+P+ +QRKAA+   RQ LA MN LKSY+GK    F+   
Sbjct: 323 VDVPLEFYPQLYTKSVKDAIVRPLQQQRKAAQERSRQVLAEMNGLKSYQGKDTLKFINST 382

Query: 486 AEVLAGRPCVSAVRSRTKNEMKEVIQKVTSIKLQLNEERAKLKKQYVDLSNKLQNEWNIS 545
            + L           +  N+ KE+I K+ S+K  + + + + K +Y +LS KL  EWN+S
Sbjct: 383 LDYL-----------QRDNQSKEIIDKLESLKNSIADHKTQRKNEYKELSQKLHGEWNLS 431

Query: 546 NPERKVIGEAKRLGLLDKPHLLSMVVLSPYFYLMRDSSGGSDWTLVQSNSYGTDGLITKH 605
           +P   +I EA   GL+D+P+LL+MVVLSP  YL R  SG   W +++++S   + +    
Sbjct: 432 HPTY-LINEAMERGLIDEPYLLAMVVLSPGHYLQRSRSG--QWKMIRTDS---NMIRISD 485

Query: 606 VTEEKVQQYIRDCTKTANDNPLMFIYCREDFFVSQEETWSAIEKNMGCSEFNKADQ 661
               +VQ  IR  T   +  PLM +Y +            ++E N G + F + DQ
Sbjct: 486 CAPSQVQATIRQHTTFPSKTPLMLLYVKSSHVSVDTIVSKSLESNEGITNFLRIDQ 541

>TBLA0B02230 Chr2 (521358..523730) [2373 bp, 790 aa] {ON} Anc_5.475
           YOR138C
          Length = 790

 Score =  286 bits (731), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 217/732 (29%), Positives = 351/732 (47%), Gaps = 147/732 (20%)

Query: 3   EEQDAVASLGEMGIPEDVALDALRRANGNLSAAVNYIFSNDMP--AGEHVELPQPR--ES 58
           E+Q+ + +L +MGIP DVA +ALR ANGN+ AAVNYIFSN++P  A +  ELP PR  E+
Sbjct: 2   EDQEKIQTLIDMGIPPDVANNALRAANGNVEAAVNYIFSNELPPQASQMPELP-PRIDEN 60

Query: 59  SD-----------------------LKPGDLDQVLRESQRTGPQLNQLVQ---LDSHPAA 92
           SD                        +PGDL++ L +        N +VQ     SH A 
Sbjct: 61  SDNNTNTNVYNDNTGNTIPISGSNGFQPGDLNKYLTDKN------NAIVQDTDSTSHNAT 114

Query: 93  --------------DTNDEDTGGNIYLDEDD-NIEVGSVQLNEVSP---ATSIPPNSDIG 134
                         ++N        Y+ E D +I++ +    E+S    + S  P +   
Sbjct: 115 INTSFINNTTTTTSNSNSNSNPNTNYMSESDIDIDMMTSSTRELSTDIRSQSFKPQASYT 174

Query: 135 SSPDDGTGDPPEYGGCKVPAAEEGAERPDSGAAPAAERYATNYLVLFAFAVATYAPLQ-F 193
           S+      DP       +P ++              E Y    L LF +++    PLQ F
Sbjct: 175 STHKLQISDP----TVLLPLSQNC----------LLENY----LSLFLYSLCMLCPLQIF 216

Query: 194 VQQDFKNLNYDAEWYAGDAIQQPLCIVSDVGADGGSRQIVPEEEVTSDTPVQPEMLWQLQ 253
             Q F +L Y+ +WY+          +S+             E  T+D+     +  QLQ
Sbjct: 217 ETQQFNDLMYNKKWYS----------ISNNN-----------ENTTTDS-----LFLQLQ 250

Query: 254 RVISVCHSKLSERSYVSAKVFTKVFDTEVESCIRDSDHLYEALPSFIKSIIRDAEMCPAQ 313
           RV S+ +S++SER+++S K+F+  F+ ++   +  SDHL E    FI+S++    + P  
Sbjct: 251 RVTSIINSRMSERAFISTKMFSFAFNKDLNYLLSQSDHLNEIFNPFIESLVTTV-LPPI- 308

Query: 314 HSNTDVKSMFLSSAIQDAEQGAEPEETFLFLFHFPPEEYNANLYKMFNALLYPE----XX 369
                 K + +++AI    Q  E   + + + +F PEEY +NLYKMFN L+YP       
Sbjct: 309 -----FKDILVTTAINKDSQTNEIFRSPISMINFLPEEYESNLYKMFNNLVYPNEYGRND 363

Query: 370 XXXXXXXXXXXXXXXXVQVEGSLKELAPLLTIIFNEADPGQLSAGAQDTCINSPQGVEVP 429
                              + +L+E++P+ TI+F E D    S+         P+GVE+P
Sbjct: 364 DEQSDESLQTDDDDNDDANDSALEEISPIFTILFEEYDESDSSSTTL------PEGVEIP 417

Query: 430 FSFYPQLYTREVKEQVVKPILRQRKAARAELRQCLARMNQLKSYEGKGCCAFLEQYAEVL 489
             FYPQLY+++V +Q++K I+ +RK A+++ R  L  +N LKS++GK     L+   + +
Sbjct: 418 LQFYPQLYSKKVNDQLIKHIISKRKEAQSKSRSLLNEINSLKSFQGKDIMKILQSTIDYI 477

Query: 490 AGRPCVSAVRSRTKNEMKEVIQKVTSIKLQLNEERAKLK-KQYVDLSNKLQNEWNISNPE 548
                 S   +++ N +  ++ ++ + K         LK  QY +L+ KL +EWN+S+PE
Sbjct: 478 EKD---SQRETKSANNLTNILTEMKNCK--------NLKMDQYKELTRKLHSEWNLSHPE 526

Query: 549 RKVIGEAKRLGLLDKPHLLSMVVLSPYFYLMRDSSGGSDWTLVQSNSYGT---------- 598
             +I  AK+L L+D P+ LSMV+ SP  YL++      DW L+   S             
Sbjct: 527 GSIIETAKQLNLIDSPYNLSMVIFSPDLYLIK--KANVDWYLIDCRSINQMQNKNRNNNN 584

Query: 599 -----DGLITKHVTEE-KVQQYIRDCTKTANDNPLMFIYCREDFFVSQEETWSAIEKNMG 652
                D  + +    E ++Q  I+  T+  ++ PLMFIYC+E F  ++++   + E NM 
Sbjct: 585 NNNNPDLFVLRKCNSEIEIQDIIKQKTRNPSETPLMFIYCKESFLPNEDDVMKSFESNMA 644

Query: 653 CSEFNKADQLYL 664
           C++F K DQL L
Sbjct: 645 CTKFLKEDQLTL 656

>NDAI0C01390 Chr3 (290301..292430) [2130 bp, 709 aa] {ON} Anc_5.475
           YOR138C
          Length = 709

 Score =  267 bits (683), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 171/532 (32%), Positives = 271/532 (50%), Gaps = 62/532 (11%)

Query: 176 NYLVLFAFAVATYAPLQFVQQDFKNLNYDAEWYAGDAIQQP---LCIVSDVGADG----- 227
           NYL L   A+A   P  F++ DFK+LNY+ +WY G+++  P   L I +D  AD      
Sbjct: 186 NYLALIMLAIAINIPTPFLRPDFKDLNYENDWYKGNSLSIPNYGLKIQNDHDADDEGVSE 245

Query: 228 -GSRQIVP---EEEVTSDTPVQPEMLWQLQRVISVCHSKLSERSYVSAKVFTKVFDTEVE 283
                I+    E+    +  +QP++LWQLQ++ISV +S LSERSY+S KVF+     +V 
Sbjct: 246 PSDTNILDGEGEKNNQRNDDIQPKLLWQLQKLISVVNSTLSERSYISTKVFSLGLTPDVR 305

Query: 284 SCIRDSDHLYEALPSFIKSIIRDAEMCPA-------------------------QHSNTD 318
             + + ++L + LP F KS+  + E C A                         +    +
Sbjct: 306 YTLANYENLADVLPVFYKSLATEMEKCVAIFGSDITENDKVDNADNDNNNGNSEERMRGE 365

Query: 319 VKSMFLSSAIQDAEQGAEPEETFLFLFHFPPEEYNANLYKMFNALLYPEXXXXXXXXXXX 378
           ++S+F+S+A  +     E  +T +    F PEEY +NLYKMFN LL+PE           
Sbjct: 366 MESLFVSTASYEDAATGERLKTPVTTLSFSPEEYESNLYKMFNTLLFPE-----IDNPSK 420

Query: 379 XXXXXXXVQVEGSLKELAPLLTIIFNEADPGQLSAGAQDTCINSPQGVEVPFSFYPQLYT 438
                  V   G L  +AP+ T++F+  D       +    ++ P GV++P  FYPQLYT
Sbjct: 421 TAVSEGDVPGTGCLDYIAPIFTVVFHAMD-------STTDEVDLPGGVDMPMEFYPQLYT 473

Query: 439 REVKEQVVKPILRQRKAARAELRQCLARMNQLKSYEGKGCCAFLEQYAEVLAGRPCVSAV 498
              ++ +V+ +  +RK A    ++ L + NQL+S++GK    FL+   + L  + C S  
Sbjct: 474 STCRDALVRDVFPRRKEAHRLSKELLQKFNQLRSFQGKDITMFLKSTMDYLT-KDCGSET 532

Query: 499 RSRTKNEMKEVIQKVTSIKLQLNEERAKLKKQYVDLSNKLQNEWNISNPERKVIGEAKRL 558
           ++  + ++ E +         +N  +  + + Y  LS  LQ   N+S+PE  +I +AK  
Sbjct: 533 KALEEMKILETL---------INNAKNTIMEDYKALSADLQGPLNVSHPEVSIIDQAKAS 583

Query: 559 GLL-DKPHLLSMVVLSPYFYLMRDSSGGSDWTLVQSNSYGTDGLITKHVTEEKVQQYIRD 617
            L+ D+P+LL+M V+SP  Y +R+  G   W LV+ N   T+  IT+  +   VQ  I+ 
Sbjct: 584 NLIDDEPYLLTMAVISPLAYFIRNRQGK--WYLVRFNMISTEFQITECESIRNVQTAIKQ 641

Query: 618 CTKTANDNPLMFIYCREDFFVSQEETWSAIEKNMGCSEFNKADQLYLLTHRE 669
           CT  AN+ PLMFIYCR+   +        +E N GC +F+K DQ+ L   R+
Sbjct: 642 CTIHANEEPLMFIYCRKSAILDDLIIQKYLEDNKGCLQFSKDDQIALDVLRQ 693

>CAGL0I07205g Chr9 (694434..696245) [1812 bp, 603 aa] {ON} similar
           to uniprot|Q12242 Saccharomyces cerevisiae YOR138c
          Length = 603

 Score =  245 bits (626), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 170/525 (32%), Positives = 270/525 (51%), Gaps = 88/525 (16%)

Query: 167 APAAERYATNYLVLFAFAVATYAPLQFVQQDFKN--LNYDAEWYAG---DAIQQPLCIVS 221
           APA   +   Y  LFA  ++ + P  FV+ D  +  L +  +W+     +   +PL ++ 
Sbjct: 144 APAVPNHIY-YCALFALFISIHLPHYFVKADHDDMPLLFSPDWFNDIDREPEDEPLLVLR 202

Query: 222 DVGADGGSRQIVPEEEVTSDTPVQPEMLWQLQRVISVCHSK-LSERSYVSAKVFTKVFDT 280
           D                            QL ++I+V +S   S R++V++K+F    D 
Sbjct: 203 D----------------------------QLHKLIAVQNSNDHSARAFVTSKMF----DV 230

Query: 281 EVESCIRDSD---------HLYEALPSFIKSIIRDAEMCPAQHSNTDVKSMFLSSAIQDA 331
           +++S I+ ++         HLY+ LPSFIK+I        A  S T+ K++F+SSAIQ  
Sbjct: 231 DLQSVIQSNEPMLTNPNYFHLYQILPSFIKTI--------ANLSYTE-KNLFISSAIQGG 281

Query: 332 EQGAEPEETFLFLFHFPPEEYNANLYKMFNALLYPEXXXXXXXXXXXXXXXXXXVQVEGS 391
           E+ +  +E+ L LFHF PEEY +NLYKMFN LLYP+                     E S
Sbjct: 282 EEASSSKESLLSLFHFLPEEYESNLYKMFNVLLYPDDDHDIGEDEDEVS--------ENS 333

Query: 392 LKELAPLLTIIFNEADPGQLSAGAQDTCINSPQGVEVPFSFYPQLYTREVKEQVVKPILR 451
           LKELAP++TIIFNEA+    +A   +       GVEVP  FYPQLYT++ K+Q++  +L 
Sbjct: 334 LKELAPVMTIIFNEAENIDENAPVTN-------GVEVPLKFYPQLYTKKCKDQLISHVLS 386

Query: 452 QRKAARAELRQCLARMNQLKSYEGKGCCAFLEQYAEVLAGRPCVSAVRSRTKNEMKEVIQ 511
           +RK  R EL+Q L  +  LKSY+GK   +F+    + L         + +  + + E + 
Sbjct: 387 KRKDGRKELKQILKDIGNLKSYQGKDILSFINSSLDYLT--------KDKDDSGIAEELH 438

Query: 512 KVTSIKLQLNEERAKLKKQYVDLSNKLQNEWNISNPERKVIGEAKRLGLLDKPHLLSMVV 571
           K   +K +L  ++ +    Y  +S K+  EWNI NPE K++  A +LGL+D+P+ L++ V
Sbjct: 439 K---LKDELTAKKTEKMNSYKQISEKMHTEWNIQNPELKIVETATKLGLIDEPYFLNLAV 495

Query: 572 LSPYFYLMRDSSGGSDWTLVQSNSYGT--DGL-ITKHVTEEKVQQYIRDCTKTANDNPLM 628
           +SP+FY +R+     +W  V+ N + T  D + + K     +V Q++++ T   N  PLM
Sbjct: 496 VSPFFYFVRNRK--DEWYEVRFNPFNTAEDKISVGKCDGPGEVIQHVKNSTTVPNSTPLM 553

Query: 629 FIYCREDFFVSQEETWSAIEKNMGCSEFNKADQLYLLTHREDRNE 673
           F+Y ++ +     E    + +N    +F K DQ+YL      R E
Sbjct: 554 FVYSKDSYMADDTEMQELLSQNKTLLDFFKQDQIYLQNFENARGE 598

>KLLA0E03169g Chr5 complement(292918..294552) [1635 bp, 544 aa] {ON}
           weakly similar to uniprot|Q12242 Saccharomyces
           cerevisiae YOR138C RUP1
          Length = 544

 Score =  209 bits (533), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 138/509 (27%), Positives = 252/509 (49%), Gaps = 49/509 (9%)

Query: 176 NYLVLFAFAVATYAPLQFVQQDFKNLNYDAEWYAGDAIQQPLCIVSDVGADGGSRQIVPE 235
           +Y  LFA  +A   P +F+  DFK L Y+  W+ G+ +Q    +V     + G   I   
Sbjct: 68  SYFPLFALCMAVNVPTKFLNVDFKELVYNPHWFKGELVQSDYRLVH---RNAGPLLIHKR 124

Query: 236 EEVTSD-TPVQPEMLWQLQRVISVCHSKLSERSYVSAKVFTKVFDTEVESCIRDSDHLYE 294
           E   S+   +QPE++ ++Q +I + +   S R +V++++  K  D  V   + + DHL E
Sbjct: 125 ELTGSEYLEMQPELIPRMQLLIGIANDPESMRRFVASELINKGTDFNVSRALSECDHLSE 184

Query: 295 ALPSFIKSIIRDAEMCPAQHSNTDVKSMFLSSAIQDAEQGAEPEETFLFLFHFPPEEYNA 354
             P FIK++  D ++C     +T    +FLS A+         + T L + +F PE Y  
Sbjct: 185 VFPQFIKNLHNDMDLCLKDDKST--SKLFLSKALHRPNVLEPFQPTSLSVLNFSPENYAY 242

Query: 355 NLYKMFNALLYPEXXXXXXXXXXXXXXXXXXVQVEGSLKELAPLLTIIFNEADPGQLSAG 414
            LY+MFN +L PE                   ++E +   LAP+ TIIF++ D       
Sbjct: 243 TLYEMFNPMLLPEDSGRG-------------YEIENAFDFLAPVFTIIFDDMD------- 282

Query: 415 AQDTC--INSPQGVEVPFSFYPQLYTREVKEQVVKPILRQRKAARAELRQCLARMNQLKS 472
             DT   +N   GV++P  FYPQLYT+   E+VV P+L +  A R   +  + +M+ L+S
Sbjct: 283 --DTTEEVNLSHGVQIPIEFYPQLYTKNALEKVVVPVLEETDALRNTNKLKVDQMSSLQS 340

Query: 473 YEGKGCCAFLEQYAEVLAGRPCVSAVRSRTKNEMKEVIQKVTSIKLQLNEERAKLKKQYV 532
           ++GK   +FL      L   P     +S      KE++  +  IK QL+ ++ ++   Y 
Sbjct: 341 FQGKQISSFLNSSINYLEEIPLGDEDKS------KELVDTLEKIKYQLSNKKREMMADYT 394

Query: 533 DLSNKLQNEWNISNPERKVIGEAKRLGLLDKPHLLSMVVLSPYFYLM-RDSSGGSDWTLV 591
           +   ++ +  +   P  K+I  AK++G++D+P+LL +VV SP  Y++ R  S     T +
Sbjct: 395 ETQRQI-DLLSFEGPSEKIIDLAKQVGIIDEPYLLRLVVFSPNDYIIARGISADDGNTGM 453

Query: 592 QSNS-----------YGTDGLITKHVTEEKVQQYIRDCTKTANDNPLMFIYCREDFFVSQ 640
           ++ +           +G+  L  + +T ++ Q   +  T+ A++ P++F+Y ++D   + 
Sbjct: 454 ETGNNNLQYIRNIIEFGSSSLTQEELTAQETQDITKSHTRHASETPILFVYIKKDHIDAP 513

Query: 641 EETWSAIEKNMGCSEFNKADQLYLLTHRE 669
           ++  ++I +N   + F K +    + +++
Sbjct: 514 QDILASISENETLTNFLKEEHTTYVNYKQ 542

>AER451W Chr5 (1502305..1503372) [1068 bp, 355 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YDL244W (THI13)
          Length = 355

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 52/111 (46%), Gaps = 17/111 (15%)

Query: 465 ARMNQLKSYEGKGCCAFLEQYA----EVLAGRP-----CVSAVRSRTK---NEMKEVIQK 512
           ARM ++      GCC F         E LA  P      + AV+  T+   NE ++  ++
Sbjct: 193 ARMMRIDQLACLGCCCFCTILYICNDEFLAANPDKVRSFLRAVKRSTEFVLNEPEQAWRE 252

Query: 513 VTSIKLQLNEERA--KLKKQYVDLSNKLQNEWNISNPERKVIGEAKRLGLL 561
              +K QLN E +  + ++ Y   S+ L   +N+    RKV G  KRLG+L
Sbjct: 253 YLVLKPQLNNELSYKQYQRCYAYFSSCL---YNVHRDWRKVTGYGKRLGVL 300

>TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.270
           YBR058C
          Length = 780

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 33/51 (64%), Gaps = 3/51 (5%)

Query: 4   EQDAVASLGEMGIPEDVALDALRRANGNLSAAVNYIFSNDMPAGEHVELPQ 54
           +Q+A++S+  MG+   +   AL   NG+++++V+++F+N    G   ELPQ
Sbjct: 649 DQEAISSMTAMGLDAKLCKKALILNNGDVTSSVDWVFNNMDDDG---ELPQ 696

>NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {ON}
           Anc_3.270 YBR058C
          Length = 795

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 40/65 (61%), Gaps = 1/65 (1%)

Query: 4   EQDAVASLGEMGIPEDVALDALRRANGNLSAAVNYIFSNDMPAGEHVELPQP-RESSDLK 62
           +Q++++++ +MG+ E +++ AL    G+++A++ ++F+N    GE      P R+   + 
Sbjct: 666 DQESLSNMIDMGLNEKLSIKALVLNKGDINASIEWVFNNPDDNGELPSETTPKRDEEGII 725

Query: 63  PGDLD 67
            G+LD
Sbjct: 726 YGNLD 730

>Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 34/57 (59%), Gaps = 3/57 (5%)

Query: 4   EQDAVASLGEMGIPEDVALDALRRANGNLSAAVNYIFSNDMPAGEHVELPQPRESSD 60
           ++D++AS+  MG+   +   AL   NG+++ +V ++F+N     ++ ELP P   S+
Sbjct: 651 DEDSLASMLSMGLSPKLCRKALIINNGDVNRSVEWVFNN---MDDNGELPDPEGQSE 704

>Kpol_1028.89 s1028 complement(197927..200560) [2634 bp, 877 aa]
           {ON} complement(197927..200560) [2634 nt, 878 aa]
          Length = 877

 Score = 32.3 bits (72), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 21/36 (58%)

Query: 7   AVASLGEMGIPEDVALDALRRANGNLSAAVNYIFSN 42
           A+  L  MG  ED A+ AL + N +L AA N++  N
Sbjct: 841 AIEELCGMGFTEDEAVKALEKHNWDLDAATNFLLDN 876

>NDAI0A05410 Chr1 (1223331..1224791) [1461 bp, 486 aa] {ON}
           Anc_3.317 YBL031W
          Length = 486

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 54/110 (49%), Gaps = 7/110 (6%)

Query: 230 RQIVPEEEVTSDTPVQPEMLWQLQRVI--SVCHSKL-SERSYVSAKVFTKVFDTE-VESC 285
           R  VP+   TS T  +P  L QLQR +  S  +S L +++SY +  + TK  +T+ V   
Sbjct: 317 RPAVPDNTHTSRTSFRPPKLKQLQRTVPHSASNSILRTKQSYNNNNIATKSSNTKTVPES 376

Query: 286 IRDSDHLYEAL---PSFIKSIIRDAEMCPAQHSNTDVKSMFLSSAIQDAE 332
           + ++  +++ L    +  +S   +    PA  +N +  +   SS+I +  
Sbjct: 377 VSNNRSVFDRLYTQSTISRSTSTNTIKLPASSTNKNRHTNITSSSISNGN 426

>ZYRO0G17996g Chr7 (1477518..1481885) [4368 bp, 1455 aa] {ON} weakly
            similar to uniprot|P34216 Saccharomyces cerevisiae
            YBL047C EDE1 Key endocytic protein involved in a network
            of interactions with other endocytic proteins binds
            membranes in a ubiquitin-dependent manner may also bind
            ubiquitinated membrane-associated proteins
          Length = 1455

 Score = 31.6 bits (70), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 19/34 (55%)

Query: 7    AVASLGEMGIPEDVALDALRRANGNLSAAVNYIF 40
            AV  L  MG  E  A+DAL R   +L AA NY+ 
Sbjct: 1419 AVEELSGMGFTEQEAVDALERCKWDLEAATNYLL 1452

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 72,309,383
Number of extensions: 3254652
Number of successful extensions: 8427
Number of sequences better than 10.0: 62
Number of HSP's gapped: 8609
Number of HSP's successfully gapped: 69
Length of query: 673
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 557
Effective length of database: 40,180,143
Effective search space: 22380339651
Effective search space used: 22380339651
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 69 (31.2 bits)