Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0B040205.477ON93493443680.0
KAFR0E025305.477ON84279421380.0
Suva_8.1925.477ON87981319700.0
Skud_15.3045.477ON88379719620.0
YOR141C (ARP8)5.477ON88181119440.0
TDEL0A034105.477ON83780119260.0
Smik_15.3205.477ON87381219110.0
ZYRO0D11308g5.477ON86880519100.0
NCAS0H022905.477ON86384218730.0
Kpol_543.105.477ON87680718240.0
CAGL0I07161g5.477ON83780017710.0
NDAI0C013705.477ON97483817640.0
TBLA0A025305.477ON85479817530.0
Kwal_55.212505.477ON77582616950.0
SAKL0G03608g5.477ON79483516260.0
TPHA0J027905.477ON88280416270.0
KLTH0F14960g5.477ON77582416090.0
AFR135W5.477ON79182115780.0
Ecym_23115.477ON77579915350.0
KLLA0E03213g5.477ON78884014320.0
TDEL0C031207.448ON438791056e-04
CAGL0K05335g7.448ON529851010.002
Suva_16.3647.448ON480771000.003
ZYRO0F02772g8.23ON375187990.003
NCAS0C037008.23ON375187970.005
YPR034W (ARP7)7.448ON47777980.005
Smik_16.2787.448ON47669970.007
Kpol_520.117.448ON48874950.011
Skud_16.3217.448ON47977930.018
NCAS0B071302.117ON381114930.019
KLLA0E22925g2.117ON38082910.032
Kpol_181.22.593ON463118900.043
NCAS0A147207.448ON48590900.045
KNAG0H036502.117ON38772890.048
AFR051W2.117ON40578890.059
TBLA0H028002.593ON484122890.063
ABR084W2.593ON46478880.077
TDEL0B048102.117ON37376850.16
Ecym_63852.117ON37782850.17
CAGL0H09042g2.117ON387168820.35
KLTH0D08624g2.593ON43279820.37
KAFR0L002404.14ON313357820.50
Skud_8.1902.117ON38472810.55
ACR184C7.448ON40163810.56
Ecym_23062.593ON407138800.67
TBLA0B010702.117ON383150790.80
Suva_15.3262.117ON38472790.85
Suva_13.2022.593ON467134790.91
ZYRO0G05676g2.117ON381148781.00
KAFR0K021507.448ON49086791.0
ZYRO0F01122g2.593ON46284791.0
TPHA0B014607.448ON48574781.3
TPHA0D002508.23ON37575771.6
Kpol_1058.158.23ON37575771.6
KNAG0L002508.23ON37575771.7
KAFR0D009408.23ON37575771.7
NDAI0G030408.23ON37575761.7
TDEL0C004708.23ON37575761.7
CAGL0K12694g8.23ON37575761.7
Suva_6.188.23ON37575761.7
Smik_6.398.23ON37575761.7
YFL039C (ACT1)8.23ON37575761.7
SAKL0B00968g8.23ON37575761.7
ABR222W8.23ON37675761.7
Ecym_15208.23ON37675761.8
Skud_6.318.23ON36075761.8
TBLA0C004408.23ON37575761.8
YHR129C (ARP1)2.117ON38472761.9
Smik_8.2102.117ON38472752.2
ZYRO0G21428g1.287ON48365762.3
SAKL0H17138g8.258ON419143752.5
KNAG0B021107.448ON48574753.0
Ecym_23798.693ON16770713.8
SAKL0B11220g2.593ON46663734.2
CAGL0M03201g1.287ON49351735.1
KLTH0C05324g7.448ON39978726.0
Skud_13.1892.593ON467134727.1
TDEL0B068602.593ON46178718.0
TDEL0D015501.287ON48067718.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0B04020
         (934 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0B04020 Chr2 (770325..773129) [2805 bp, 934 aa] {ON} Anc_5.4...  1687   0.0  
KAFR0E02530 Chr5 (516623..519151) [2529 bp, 842 aa] {ON} Anc_5.4...   828   0.0  
Suva_8.192 Chr8 complement(345067..347706) [2640 bp, 879 aa] {ON...   763   0.0  
Skud_15.304 Chr15 complement(543860..546511) [2652 bp, 883 aa] {...   760   0.0  
YOR141C Chr15 complement(589942..592587) [2646 bp, 881 aa] {ON} ...   753   0.0  
TDEL0A03410 Chr1 complement(608343..610856) [2514 bp, 837 aa] {O...   746   0.0  
Smik_15.320 Chr15 complement(551333..553954) [2622 bp, 873 aa] {...   740   0.0  
ZYRO0D11308g Chr4 complement(955212..957818) [2607 bp, 868 aa] {...   740   0.0  
NCAS0H02290 Chr8 complement(450017..452608) [2592 bp, 863 aa] {O...   726   0.0  
Kpol_543.10 s543 complement(25137..27767) [2631 bp, 876 aa] {ON}...   707   0.0  
CAGL0I07161g Chr9 (686948..689461) [2514 bp, 837 aa] {ON} simila...   686   0.0  
NDAI0C01370 Chr3 (283773..286697) [2925 bp, 974 aa] {ON} Anc_5.4...   684   0.0  
TBLA0A02530 Chr1 (610524..613088) [2565 bp, 854 aa] {ON} Anc_5.4...   679   0.0  
Kwal_55.21250 s55 (749673..752000) [2328 bp, 775 aa] {ON} YOR141...   657   0.0  
SAKL0G03608g Chr7 complement(299907..302291) [2385 bp, 794 aa] {...   630   0.0  
TPHA0J02790 Chr10 complement(621474..624122) [2649 bp, 882 aa] {...   631   0.0  
KLTH0F14960g Chr6 (1222278..1224605) [2328 bp, 775 aa] {ON} simi...   624   0.0  
AFR135W Chr6 (680340..682715) [2376 bp, 791 aa] {ON} Syntenic ho...   612   0.0  
Ecym_2311 Chr2 (604942..607269) [2328 bp, 775 aa] {ON} similar t...   595   0.0  
KLLA0E03213g Chr5 complement(299014..301380) [2367 bp, 788 aa] {...   556   0.0  
TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.4...    45   6e-04
CAGL0K05335g Chr11 (521914..523503) [1590 bp, 529 aa] {ON} simil...    44   0.002
Suva_16.364 Chr16 (646188..647630) [1443 bp, 480 aa] {ON} YPR034...    43   0.003
ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [112...    43   0.003
NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128...    42   0.005
YPR034W Chr16 (639525..640958) [1434 bp, 477 aa] {ON}  ARP7Compo...    42   0.005
Smik_16.278 Chr16 (516276..517706) [1431 bp, 476 aa] {ON} YPR034...    42   0.007
Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}...    41   0.011
Skud_16.321 Chr16 (604148..605587) [1440 bp, 479 aa] {ON} YPR034...    40   0.018
NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa] ...    40   0.019
KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]...    40   0.032
Kpol_181.2 s181 complement(1914..3305) [1392 bp, 463 aa] {ON} co...    39   0.043
NCAS0A14720 Chr1 (2903450..2904907) [1458 bp, 485 aa] {ON} Anc_7...    39   0.045
KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {O...    39   0.048
AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic ho...    39   0.059
TBLA0H02800 Chr8 (655357..656811) [1455 bp, 484 aa] {ON} Anc_2.5...    39   0.063
ABR084W Chr2 (540620..540649,540708..542072) [1395 bp, 464 aa] {...    39   0.077
TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.1...    37   0.16 
Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}...    37   0.17 
CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} simila...    36   0.35 
KLTH0D08624g Chr4 (722066..723364) [1299 bp, 432 aa] {ON} simila...    36   0.37 
KAFR0L00240 Chr12 complement(32708..42109) [9402 bp, 3133 aa] {O...    36   0.50 
Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON...    36   0.55 
ACR184C Chr3 complement(669411..670616) [1206 bp, 401 aa] {ON} S...    36   0.56 
Ecym_2306 Chr2 complement(594433..595656) [1224 bp, 407 aa] {ON}...    35   0.67 
TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.1...    35   0.80 
Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {...    35   0.85 
Suva_13.202 Chr13 (328209..328238,328325..329698) [1404 bp, 467 ...    35   0.91 
ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} simila...    35   1.00 
KAFR0K02150 Chr11 (441832..443304) [1473 bp, 490 aa] {ON} Anc_7....    35   1.0  
ZYRO0F01122g Chr6 complement(88017..89375,89479..89508) [1389 bp...    35   1.0  
TPHA0B01460 Chr2 complement(325847..327304) [1458 bp, 485 aa] {O...    35   1.3  
TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,...    34   1.6  
Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 b...    34   1.6  
KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp...    34   1.7  
KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128...    34   1.7  
NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128...    34   1.7  
TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,...    34   1.7  
CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,...    34   1.7  
Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 3...    34   1.7  
Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 3...    34   1.7  
YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375...    34   1.7  
SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp...    34   1.7  
ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {...    34   1.7  
Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376...    34   1.8  
Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON} Y...    34   1.8  
TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,...    34   1.8  
YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}  ...    34   1.9  
Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON...    33   2.2  
ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} high...    34   2.3  
SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} high...    33   2.5  
KNAG0B02110 Chr2 complement(399743..401200) [1458 bp, 485 aa] {O...    33   3.0  
Ecym_2379 Chr2 (736268..736771) [504 bp, 167 aa] {ON} similar to...    32   3.8  
SAKL0B11220g Chr2 (978268..978297,978363..979733) [1401 bp, 466 ...    33   4.2  
CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa] ...    33   5.1  
KLTH0C05324g Chr3 complement(458911..460110) [1200 bp, 399 aa] {...    32   6.0  
Skud_13.189 Chr13 (324460..324489,324579..325952) [1404 bp, 467 ...    32   7.1  
TDEL0B06860 Chr2 (1214531..1214560,1214657..1216012) [1386 bp, 4...    32   8.0  
TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {O...    32   8.2  

>KNAG0B04020 Chr2 (770325..773129) [2805 bp, 934 aa] {ON} Anc_5.477
           YOR141C
          Length = 934

 Score = 1687 bits (4368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 834/934 (89%), Positives = 834/934 (89%)

Query: 1   MESELGTTAEVPVLEEDANSAASSSQDPGRDDGLHDSAQEDVSVMXXXXXXXXXXXXXXX 60
           MESELGTTAEVPVLEEDANSAASSSQDPGRDDGLHDSAQEDVSVM               
Sbjct: 1   MESELGTTAEVPVLEEDANSAASSSQDPGRDDGLHDSAQEDVSVMDDDTSGEDDEEEDDD 60

Query: 61  XXXXXXXXHVSKKMKVGLSKVGSPSGSSXXXXXXXXXXXXXXXXXXXGAVAAMETAVGDV 120
                   HVSKKMKVGLSKVGSPSGSS                   GAVAAMETAVGDV
Sbjct: 61  DDDDERDDHVSKKMKVGLSKVGSPSGSSNNDDNNNDEDKKNNKNNNDGAVAAMETAVGDV 120

Query: 121 PSATASPTPSVVMNGAADEKQEKDSKSAAGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIG 180
           PSATASPTPSVVMNGAADEKQEKDSKSAAGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIG
Sbjct: 121 PSATASPTPSVVMNGAADEKQEKDSKSAAGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIG 180

Query: 181 IEKVDSTTLPSTGGLKPLIVINQKNYSSDYIRKDDQIFALRERKFLRXXXXXXXXXXXXX 240
           IEKVDSTTLPSTGGLKPLIVINQKNYSSDYIRKDDQIFALRERKFLR             
Sbjct: 181 IEKVDSTTLPSTGGLKPLIVINQKNYSSDYIRKDDQIFALRERKFLRSAGTSNTTTTTTN 240

Query: 241 XXXXXXXXXXXXHTPEVATSTIPNEFTLKSXXXXXXXXXXXXXXQPGSESIKIGFATDET 300
                       HTPEVATSTIPNEFTLKS              QPGSESIKIGFATDET
Sbjct: 241 NGSNTNGVGSASHTPEVATSTIPNEFTLKSDDIDFTDATTTIVIQPGSESIKIGFATDET 300

Query: 301 PLVIPNCVAVPHSGETPIGNAANLTRDQPDQFLQFKEELQTSFKERMRHYKRRVQLSSYD 360
           PLVIPNCVAVPHSGETPIGNAANLTRDQPDQFLQFKEELQTSFKERMRHYKRRVQLSSYD
Sbjct: 301 PLVIPNCVAVPHSGETPIGNAANLTRDQPDQFLQFKEELQTSFKERMRHYKRRVQLSSYD 360

Query: 361 QVNTFNETTKPEIIEDQNDPAKIAWRGQPDPQEGKTIYVGDEALLCLREHYMHRRPFGCS 420
           QVNTFNETTKPEIIEDQNDPAKIAWRGQPDPQEGKTIYVGDEALLCLREHYMHRRPFGCS
Sbjct: 361 QVNTFNETTKPEIIEDQNDPAKIAWRGQPDPQEGKTIYVGDEALLCLREHYMHRRPFGCS 420

Query: 421 EGKYLFNLDEKRYTSLAALLCDVSRLLEHAIDKLLKKRDKDTEKDIKYKAVLVIPDLFEK 480
           EGKYLFNLDEKRYTSLAALLCDVSRLLEHAIDKLLKKRDKDTEKDIKYKAVLVIPDLFEK
Sbjct: 421 EGKYLFNLDEKRYTSLAALLCDVSRLLEHAIDKLLKKRDKDTEKDIKYKAVLVIPDLFEK 480

Query: 481 SHVETMIRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIVVE 540
           SHVETMIRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIVVE
Sbjct: 481 SHVETMIRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIVVE 540

Query: 541 NSIINLNYGGDDISKLFAVLLLMSNFPYQEWDIDSIPGRMIAEHLKKECLTFQDADITTQ 600
           NSIINLNYGGDDISKLFAVLLLMSNFPYQEWDIDSIPGRMIAEHLKKECLTFQDADITTQ
Sbjct: 541 NSIINLNYGGDDISKLFAVLLLMSNFPYQEWDIDSIPGRMIAEHLKKECLTFQDADITTQ 600

Query: 601 LFNFIKRVPGLPTEKIEFKTFDEVILAPLALFYPKIFSLLKPNKGKNLTNPKLKYQLPDS 660
           LFNFIKRVPGLPTEKIEFKTFDEVILAPLALFYPKIFSLLKPNKGKNLTNPKLKYQLPDS
Sbjct: 601 LFNFIKRVPGLPTEKIEFKTFDEVILAPLALFYPKIFSLLKPNKGKNLTNPKLKYQLPDS 660

Query: 661 RDLFTNKANNWKSLSEMDCATNTLYSDMVQESVLLDNLLGINSRREGPPKDSGVGSETTE 720
           RDLFTNKANNWKSLSEMDCATNTLYSDMVQESVLLDNLLGINSRREGPPKDSGVGSETTE
Sbjct: 661 RDLFTNKANNWKSLSEMDCATNTLYSDMVQESVLLDNLLGINSRREGPPKDSGVGSETTE 720

Query: 721 LNLTALDKSVIQSITNATLSLEPGKMASFYSNILIVGGSSNIPGFDTILKDRINMWRPKL 780
           LNLTALDKSVIQSITNATLSLEPGKMASFYSNILIVGGSSNIPGFDTILKDRINMWRPKL
Sbjct: 721 LNLTALDKSVIQSITNATLSLEPGKMASFYSNILIVGGSSNIPGFDTILKDRINMWRPKL 780

Query: 781 IALASFPNFYNELVKEIKDLETSAKXXXXXXXXXXXXXXXXXXXLNDDDAPKEVPEVKET 840
           IALASFPNFYNELVKEIKDLETSAK                   LNDDDAPKEVPEVKET
Sbjct: 781 IALASFPNFYNELVKEIKDLETSAKTSSAAIVTGGTATATPAPVLNDDDAPKEVPEVKET 840

Query: 841 SSDAKEYELNEKIQKLIEERLEKYLSAIERQNGNEHFMPVSVTPAPHNMNPSLLPWRGAG 900
           SSDAKEYELNEKIQKLIEERLEKYLSAIERQNGNEHFMPVSVTPAPHNMNPSLLPWRGAG
Sbjct: 841 SSDAKEYELNEKIQKLIEERLEKYLSAIERQNGNEHFMPVSVTPAPHNMNPSLLPWRGAG 900

Query: 901 VLAQIKLIEELFVTNIDWDVHGSRVLQHKCIFTY 934
           VLAQIKLIEELFVTNIDWDVHGSRVLQHKCIFTY
Sbjct: 901 VLAQIKLIEELFVTNIDWDVHGSRVLQHKCIFTY 934

>KAFR0E02530 Chr5 (516623..519151) [2529 bp, 842 aa] {ON} Anc_5.477
           YOR141C
          Length = 842

 Score =  828 bits (2138), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/794 (53%), Positives = 548/794 (69%), Gaps = 42/794 (5%)

Query: 146 KSAAGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKVDSTTLPSTGGLKPLIVINQKN 205
           K+ AG KVP HLLE+RR+GRIKAAE FAKKLK+IGIEK+++ TLP TG  +PL +INQKN
Sbjct: 86  KTMAGTKVPKHLLERRRIGRIKAAEAFAKKLKKIGIEKIENITLPQTGLFQPLNLINQKN 145

Query: 206 YSSDYIRKDDQIFALRERKFLRXXXXXXXXXXXXXXXXXXXXXXXXXHTPEVATSTIPNE 265
           YSSDYIRKDDQIFALRERK LR                            ++ T  + +E
Sbjct: 146 YSSDYIRKDDQIFALRERKTLRSSTNANNNNTSTPKAVV-----------DLKTGVMDDE 194

Query: 266 FTLKSXXXXXXXXXXXXXXQPGSESIKIGFATDETPLVIPNCVAVPHSGETP-IGNAANL 324
             L                QPGSE++KIGFA DETPL+IPN VA+P   ++      + L
Sbjct: 195 IDLNDPNSTIII-------QPGSETMKIGFALDETPLLIPNLVAIPKKDDSKGPSTESKL 247

Query: 325 TRDQPDQFLQFKEELQTSFKERMRHYKRRVQLSSYDQVNTFNETTKPEIIEDQNDPAKIA 384
             +Q ++F   K EL ++FKERMR+YKRR+Q +S++QV +FN   +PE I D NDPA+I 
Sbjct: 248 NTEQSEEFEDLKNELHSTFKERMRYYKRRIQPNSHEQVKSFNRNAQPETILDNNDPARIR 307

Query: 385 WRGQPDPQEGKTIYVGDEALLCLREHYMHRRPFGCSEGKYLFNLDEKRYTSLAALLCDVS 444
           W  Q D      +Y G++ALLC    + HR+PFG      LFNL    Y+S+  LL DV 
Sbjct: 308 WITQND-----KVYYGNDALLCPESFFSHRKPFGTCRNGALFNLMGSSYSSVQELLGDVI 362

Query: 445 RLLEHAIDKLLKKRDKDTEKDIKYKAVLVIPDLFEKSHVETMIRLLLSELPFNAVAIVQE 504
           +L+E  ++KLL+ ++KD     KYKA+LVIPDLFEKSHVE MIRLLL+ELPFNAVAI+QE
Sbjct: 363 KLIEFGLNKLLEAKNKD-----KYKAILVIPDLFEKSHVEEMIRLLLTELPFNAVAIIQE 417

Query: 505 SLATCYGSGISTSTCVVNVGATGTKVACVDEGIVVENSIINLNYGGDDISKLFAVLLLMS 564
           SLATCYG+GISTSTCVVNVGA+ T V+C+DEG+V+ENS+INLNYGGDDI++LF+VLL M+
Sbjct: 418 SLATCYGAGISTSTCVVNVGASETSVSCIDEGVVLENSLINLNYGGDDITRLFSVLLKMN 477

Query: 565 NFPYQEWDIDSIPGRMIAEHLKKECLTFQDADITTQLFNFIKRVPGLPTEKIEFKTFDEV 624
           NFPYQ+W+++SI G  IAE LKK+ +T QDAD+T QL NF+KRV   PTEK EFKTFDEV
Sbjct: 478 NFPYQDWNVESIAGWNIAETLKKQIVTLQDADVTVQLSNFMKRVFNEPTEKYEFKTFDEV 537

Query: 625 ILAPLALFYPKIFSLLKPNKGKNLTNPKLKYQLPDSRDLFTNKANNWKSLSEMDCATNTL 684
           +LAPLALF P+IFS L+  + KN T   L+YQLP+S+DLFT++ N+W+S+++  C  N  
Sbjct: 538 MLAPLALFAPRIFSYLRNEESKNST---LQYQLPESKDLFTHELNDWRSMTQEACKNNGS 594

Query: 685 YSDMVQESVLLDNLLGINSRREGPPKDSGVGSETTELNLTALDKSVIQSITNATLSLEPG 744
           Y D+  E  LL  LL ++S+ E    ++    +    N+  LDK++IQSIT+A LSL+P 
Sbjct: 595 YCDISDELQLLTALLEVDSKLEAFQSEATTTLDNKR-NMLPLDKAIIQSITDACLSLDPS 653

Query: 745 KMASFYSNILIVGGSSNIPGFDTILKDRINMWRPKLIALASFPNFYNELVKEIKDLE--- 801
           KM SFYSNIL+VGGSSNIP FD +L DRIN+WRP+L++L+SFP FY  L KEIKDLE   
Sbjct: 654 KMDSFYSNILVVGGSSNIPAFDFMLTDRINIWRPRLLSLSSFPQFYKNLSKEIKDLEMES 713

Query: 802 -TSAKXXXXXXXXXXXXXXXXXXXLNDDDAPKEVPEVKETSSDAKEYELNEKIQKLIEER 860
            ++AK                    N  +  + + ++ E S      +L+  I  LI+ +
Sbjct: 714 QSTAKLQAQTGSVVPTTGSSTPLATNAGNDGETMADLNEVSK-----KLSSNINDLIKTK 768

Query: 861 LEKYLSAIERQNGNEHFMPVSVTPAPHNMNPSLLPWRGAGVLAQIKLIEELFVTNIDWDV 920
           L+ Y+S +E QN NEH+ PV V P P +M+ ++L W+GA VLAQIKL+EELF+TN+DWD+
Sbjct: 769 LQDYISNVESQNSNEHYFPVGVVPPPRDMSAAILSWKGASVLAQIKLVEELFITNLDWDM 828

Query: 921 HGSRVLQHKCIFTY 934
           HGSR+LQHKCIFTY
Sbjct: 829 HGSRILQHKCIFTY 842

>Suva_8.192 Chr8 complement(345067..347706) [2640 bp, 879 aa] {ON}
           YOR141C (REAL)
          Length = 879

 Score =  763 bits (1970), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/813 (49%), Positives = 543/813 (66%), Gaps = 97/813 (11%)

Query: 145 SKSAAGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKVDSTTLPSTGGLKPLIVINQK 204
           +K+  GKKVPLHLLEKRRLGRIKAAEEFAK LK+IGIEKV++TTLP+TG  +PL++INQK
Sbjct: 141 AKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVEATTLPATGLFQPLLLINQK 200

Query: 205 NYSSDYIRKDDQIFALRERKFLRXXXXXXXXXXXXXXXXXXXXXXXXXHTPEVATSTIPN 264
           NYSSDY++KDDQIFALR+RKFLR                         +T +V+++  P+
Sbjct: 201 NYSSDYLKKDDQIFALRDRKFLRNN-----------------------NTTQVSSTNTPD 237

Query: 265 EFTLKSXXXXXXXX------------XXXXXXQPGSESIKIGFATDETPLVIPNCVAVPH 312
              +KS                           PGS SIKIGF  DE P+V+PNCVAVP 
Sbjct: 238 VVDMKSLPNSEPSTAPLNDEIDLNDPTATIVIHPGSNSIKIGFPKDEHPIVVPNCVAVPK 297

Query: 313 -----SGETPIGNAANLTRDQPDQFLQFKEELQTSFKERMRHYKRRVQLSSYDQVNTFNE 367
                + +   GN + L R Q ++F   K E++ +F+ERMR+YKR+V  ++++QV +FNE
Sbjct: 298 KWLNLANDQNEGNIS-LQRKQSEEFESIKSEMEKNFRERMRYYKRKVPGNAHEQVVSFNE 356

Query: 368 TTKPEIIEDQNDPAKIAWRGQPDPQEGKTIYVGDEALLCLREHYMHRRPF--GCSEGKYL 425
           ++KPE++  +NDP+ I W       +   +Y G +AL C+ E ++ R+PF  GC      
Sbjct: 357 SSKPEVVSVKNDPSPIEWIF-----DDSKLYYGSDALRCVDEKFVIRKPFKGGC------ 405

Query: 426 FNLDEKRYTSLAALLCDVSRLLEHAIDKLLKKRDKDTEKDIKYKAVLVIPDLFEKSHVET 485
           FN+D   Y SLA L+ DV +LLE+A+D   +  +    K  +YK VLVIPD+F+KSHVET
Sbjct: 406 FNIDSPYYKSLAELISDVIKLLEYALDS--ETLNVKPTKFNQYKVVLVIPDVFKKSHVET 463

Query: 486 MIRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIVVENSIIN 545
            IR+LL+EL F AVAI+QESLATCYG+GISTSTCVVN+GAT T++ACVDEG V+ENS + 
Sbjct: 464 FIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGATETRIACVDEGTVLENSAVT 523

Query: 546 LNYGGDDISKLFAVLLLMSNFPYQEWDIDSIPGRMIAEHLKKECLTFQDADITTQLFNFI 605
           L+YGGDDI++LFA+LLL S+FP Q+W I+S  G ++AE LKK   TFQDADI  QL+NFI
Sbjct: 524 LDYGGDDITRLFALLLLQSDFPLQDWKINSEHGWLLAEQLKKNFTTFQDADIAVQLYNFI 583

Query: 606 KRVPGLPTEKIEFKTFDEVILAPLALFYPKIFSLLKPNKGKNLTNPKLKYQLPDSRDLFT 665
            R P  PTEK EFK FDEV+LAPLALF+P+IF L++   GKN +   L++QLP+SRDLFT
Sbjct: 584 NRSPNKPTEKYEFKLFDEVMLAPLALFFPQIFKLIRAPSGKNSS---LEFQLPESRDLFT 640

Query: 666 NKANNWKSLSEMDCATNTLYSDMVQESVLLDNLLG----INSRREGPPKDSGVGSETTEL 721
           N+ N+W SLS+ +     LY ++  +  +L+  L     I+  ++ P K    GS + E 
Sbjct: 641 NELNDWNSLSQFESKEGDLYCNLNDDLKILNKTLDAHTMIDQLQDKPEK---YGSTSKE- 696

Query: 722 NLTALDKSVIQSITNATLSLEPGKMASFYSNILIVGGSSNIPGFDTILKDRINMWRPKLI 781
           NLT L+K++IQSITNA+++ +  +M+SFYSNILIVGGSS IP  D IL DRIN+WRP L+
Sbjct: 697 NLTPLEKAIIQSITNASVTADVTRMSSFYSNILIVGGSSKIPALDFILTDRINIWRPSLL 756

Query: 782 ALASFPNFYNELVKEIKDLETSAKXXXXXXXXXXXXXXXXXXXLNDDDAPKEVPEVKETS 841
           +  SFP FY +L KEIKDLE+                           AP+   + +E +
Sbjct: 757 SSTSFPQFYKKLTKEIKDLESHFVS-----------------------APE---KTEEEN 790

Query: 842 SDAKEYELNEKIQKLIEERLEKYLSAIERQNGNEHFMPVSVTPAPHNMNPSLLPWRGAGV 901
               + ++NEK+   ++E+ +    +IE QNGNEH  P+S+ P P +MNP+L+ W+GA V
Sbjct: 791 KQVLQLQINEKVVAELDEQHQ----SIEHQNGNEHLFPISIIPPPRDMNPALIIWKGASV 846

Query: 902 LAQIKLIEELFVTNIDWDVHGSRVLQHKCIFTY 934
           LAQIKL+EELF+TN DWDVHGSR+LQ+KCIFTY
Sbjct: 847 LAQIKLVEELFITNNDWDVHGSRILQYKCIFTY 879

>Skud_15.304 Chr15 complement(543860..546511) [2652 bp, 883 aa] {ON}
           YOR141C (REAL)
          Length = 883

 Score =  760 bits (1962), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/797 (49%), Positives = 538/797 (67%), Gaps = 65/797 (8%)

Query: 145 SKSAAGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKVDSTTLPSTGGLKPLIVINQK 204
           +K+  GKKVPLHLLEKRRLGRIKAAEEFAK LK+IGIEKV++TTLP+TG  +PL++INQK
Sbjct: 145 AKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVEATTLPATGLFQPLMLINQK 204

Query: 205 NYSSDYIRKDDQIFALRERKFLRXXXXXXXXXXXXXXXXXXXXXXXXXHTPEVATSTIPN 264
           NYSSDY++KDDQIFALR+RKFLR                         HT E +T+ + +
Sbjct: 205 NYSSDYLKKDDQIFALRDRKFLRNNNTTQVSSTNTPDVVDLKNLS---HT-EPSTAPLND 260

Query: 265 EFTLKSXXXXXXXXXXXXXXQPGSESIKIGFATDETPLVIPNCVAVPHS----GETPIGN 320
           E  L                 PGS SIKIGF  DE P+++PNCVAVP      G  P  +
Sbjct: 261 EIDLNDPTATIVI-------HPGSNSIKIGFPKDEHPIIVPNCVAVPKKWLNLGNGPNED 313

Query: 321 AANLTRDQPDQFLQFKEELQTSFKERMRHYKRRVQLSSYDQVNTFNETTKPEIIEDQNDP 380
             +L R+Q D+F   K E++ +F+ERMR+YKR+V  ++++QV +FNE +KPEII ++NDP
Sbjct: 314 NISLQREQSDEFENIKSEMEKNFRERMRYYKRKVPGNAHEQVVSFNENSKPEIISEKNDP 373

Query: 381 AKIAWRGQPDPQEGKTIYVGDEALLCLREHYMHRRPFGCSEGKYLFNLDEKRYTSLAALL 440
           + I W       +   +Y G +AL C+ E ++ R+PF        FN++   Y SLA L+
Sbjct: 374 SPIEWIF-----DDSKLYYGSDALRCVDEKFVVRKPFQGGS----FNINSPYYESLAELI 424

Query: 441 CDVSRLLEHAIDKLLKKRDKDTEKDIKYKAVLVIPDLFEKSHVETMIRLLLSELPFNAVA 500
            DV++LLE+A+    +  +  + K  +YK VLVIPD+F+K+HVET IR+LL+EL F AVA
Sbjct: 425 SDVTKLLEYALAS--ETLNVKSTKFNQYKVVLVIPDVFKKNHVETFIRVLLTELQFQAVA 482

Query: 501 IVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIVVENSIINLNYGGDDISKLFAVL 560
           ++QESLATCYG+GISTSTCVVN+GAT T++ACVDEG V+E+S + LNYGGDDI++LFA+L
Sbjct: 483 VIQESLATCYGAGISTSTCVVNIGATETRIACVDEGTVLEHSAVTLNYGGDDITRLFALL 542

Query: 561 LLMSNFPYQEWDIDSIPGRMIAEHLKKECLTFQDADITTQLFNFIKRVPGLPTEKIEFKT 620
           LL S+FP Q+W ID+  G ++AE LKK   TFQDADI  QL+NFI R P  P+EK EFK 
Sbjct: 543 LLQSDFPLQDWKIDTKHGWLLAEQLKKNFTTFQDADIAVQLYNFINRSPNQPSEKYEFKL 602

Query: 621 FDEVILAPLALFYPKIFSLLKPNKGKNLTNPKLKYQLPDSRDLFTNKANNWKSLSEMDCA 680
           FDEV+LAPLALF+P+IF L++ + GK   N  L++QLP+SRDLFTN+ N+W SLS+ +  
Sbjct: 603 FDEVMLAPLALFFPQIFKLIRSSSGK---NSNLEFQLPESRDLFTNELNDWNSLSQFESK 659

Query: 681 TNTLYSDMVQESVLLDNLL---GINSRREGPPKDSGVGSETTELNLTALDKSVIQSITNA 737
              LYS++  +  +L+ +L    I  + +  P++ G   +T++ N   L+K++IQSI NA
Sbjct: 660 EGDLYSNLNDDLKILNKILEAHTIIDQIQDKPENYG---DTSKENFAPLEKAIIQSIANA 716

Query: 738 TLSLEPGKMASFYSNILIVGGSSNIPGFDTILKDRINMWRPKLIALASFPNFYNELVKEI 797
           +++ +  +M SFYSNILIVGG+S IP  D IL DRIN+WRP L++ ASFP FY +L KEI
Sbjct: 717 SITADVTRMNSFYSNILIVGGTSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEI 776

Query: 798 KDLETSAKXXXXXXXXXXXXXXXXXXXLNDDDAPKEVPEVKETSSDAKEYELNEKIQKLI 857
           KDLE+                          +AP    + +E +    + ++ +K+   +
Sbjct: 777 KDLESHFV-----------------------NAPD---KTEEENKQVMQSQIKDKVVAEL 810

Query: 858 EERLEKYLSAIERQNGNEHFMPVSVTPAPHNMNPSLLPWRGAGVLAQIKLIEELFVTNID 917
           +E+ +     IE QNGNEH  PVS+ P P +MNP+L+ W+GA VLAQIKL+EELF+TN D
Sbjct: 811 DEQHQN----IENQNGNEHLFPVSIIPPPRDMNPALIIWKGASVLAQIKLVEELFITNND 866

Query: 918 WDVHGSRVLQHKCIFTY 934
           WDVHGSR+LQ+KCIFTY
Sbjct: 867 WDVHGSRILQYKCIFTY 883

>YOR141C Chr15 complement(589942..592587) [2646 bp, 881 aa] {ON}
           ARP8Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes; has mRNA binding activity
          Length = 881

 Score =  753 bits (1944), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/811 (49%), Positives = 532/811 (65%), Gaps = 93/811 (11%)

Query: 145 SKSAAGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKVDSTTLPSTGGLKPLIVINQK 204
           +K+  GKKVPLHLLEKRRLGRIKAAEEFAK LK+IGIEKV++TTLP+TG  +PL++INQK
Sbjct: 143 AKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVETTTLPATGLFQPLMLINQK 202

Query: 205 NYSSDYIRKDDQIFALRERKFLRXXXXXXXXXXXXXXXXXXXXXXXXXHTPEVATSTIPN 264
           NYSSDY++KDDQIFALR+RKFLR                         +T +++++  P+
Sbjct: 203 NYSSDYLKKDDQIFALRDRKFLRNN-----------------------NTSQISSTNTPD 239

Query: 265 EFTLKSXXXXXXXXX------------XXXXXQPGSESIKIGFATDETPLVIPNCVAVPH 312
              LKS                           PGS SIKIGF  D+ P+V+PNCVAVP 
Sbjct: 240 VIDLKSLPHSEASAAPLNDEIDLNDPTATIVIHPGSNSIKIGFPKDDHPVVVPNCVAVPK 299

Query: 313 S-----GETPIGNAANLTRDQPDQFLQFKEELQTSFKERMRHYKRRVQLSSYDQVNTFNE 367
                     + N   L R+Q ++F   K E++ +F+ERMR+YKR+V  ++++QV +FNE
Sbjct: 300 KWLDLENSEHVENVC-LQREQSEEFNNIKSEMEKNFRERMRYYKRKVPGNAHEQVVSFNE 358

Query: 368 TTKPEIIEDQNDPAKIAWRGQPDPQEGKTIYVGDEALLCLREHYMHRRPF-GCSEGKYLF 426
            +KPEII ++NDP+ I W       +   +Y G +AL C+ E ++ R+PF G S     F
Sbjct: 359 NSKPEIISEKNDPSPIEWIF-----DDSKLYYGSDALRCVDEKFVIRKPFRGGS-----F 408

Query: 427 NLDEKRYTSLAALLCDVSRLLEHAIDKLLKKRDKDTEKDIKYKAVLVIPDLFEKSHVETM 486
           N+    Y SLA L+ DV++LLEHA++   +  +    K  +YK VLVIPD+F+KSHVET 
Sbjct: 409 NVKSPYYKSLAELISDVTKLLEHALNS--ETLNVKPTKFNQYKVVLVIPDIFKKSHVETF 466

Query: 487 IRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIVVENSIINL 546
           IR+LL+EL F AVAI+QESLATCYG+GISTSTCVVN+GA  T++ACVDEG V+E+S I L
Sbjct: 467 IRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAITL 526

Query: 547 NYGGDDISKLFAVLLLMSNFPYQEWDIDSIPGRMIAEHLKKECLTFQDADITTQLFNFIK 606
           +YGGDDI++LFA+ LL S+FP Q+W IDS  G ++AE LKK   TFQDAD+  QL+NF+ 
Sbjct: 527 DYGGDDITRLFALFLLQSDFPLQDWKIDSKHGWLLAERLKKNFTTFQDADVAVQLYNFMN 586

Query: 607 RVPGLPTEKIEFKTFDEVILAPLALFYPKIFSLLKPNKGKNLTNPKLKYQLPDSRDLFTN 666
           R P  PTEK EFK FDEV+LAPLALF+P+IF L++ +  KN +   L++QLP+SRDLFTN
Sbjct: 587 RSPNQPTEKYEFKLFDEVMLAPLALFFPQIFKLIRTSSHKNSS---LEFQLPESRDLFTN 643

Query: 667 KANNWKSLSEMDCATNTLYSDMVQESVLLDNLL---GINSRREGPPKDSGVGSETTELNL 723
           + N+W SLS+ +     LY D+  +  +L+ +L    I  + +  P++ G    T + N 
Sbjct: 644 ELNDWNSLSQFESKEGNLYCDLNDDLKILNRILDAHNIIDQLQDKPENYG---NTLKENF 700

Query: 724 TALDKSVIQSITNATLSLEPGKMASFYSNILIVGGSSNIPGFDTILKDRINMWRPKLIAL 783
             L+K+++QSI NA+++ +  +M SFYSNILIVGGSS IP  D IL DRIN+WRP L++ 
Sbjct: 701 APLEKAIVQSIANASITADVTRMNSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSS 760

Query: 784 ASFPNFYNELVKEIKDLETSAKXXXXXXXXXXXXXXXXXXXLNDDDAPKEVPEVKETSSD 843
           ASFP FY +L KEIKDLE                           +AP       + + D
Sbjct: 761 ASFPQFYKKLTKEIKDLEGHYV-----------------------NAP-------DKTED 790

Query: 844 AKEYELNEKIQKLIEERLEKYLSAIERQNGNEHFMPVSVTPAPHNMNPSLLPWRGAGVLA 903
             +  L  +I++ I E LE+    IE QNGNEH  PVS+ P P +MNP+L+ W+GA VLA
Sbjct: 791 ENKQILQAQIKEKIVEELEEQHQNIEHQNGNEHIFPVSIIPPPRDMNPALIIWKGASVLA 850

Query: 904 QIKLIEELFVTNIDWDVHGSRVLQHKCIFTY 934
           QIKL+EELF+TN DWDVHGSR+LQ+KCIFTY
Sbjct: 851 QIKLVEELFITNSDWDVHGSRILQYKCIFTY 881

>TDEL0A03410 Chr1 complement(608343..610856) [2514 bp, 837 aa] {ON}
           Anc_5.477 YOR141C
          Length = 837

 Score =  746 bits (1926), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/801 (47%), Positives = 520/801 (64%), Gaps = 78/801 (9%)

Query: 145 SKSAAGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKVDSTTLPSTGGLKPLIVINQK 204
           +K+  GKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEK++STTLP+TG  +P+++INQK
Sbjct: 104 AKAPPGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKIESTTLPATGLFQPVLLINQK 163

Query: 205 NYSSDYIRKDDQIFALRERKFLRXXXXXXXXXXXXXXXXXXXXXXXXXHTPEV-----AT 259
           NYSSDY++KD+QIFALRERK LR                         +TP+V       
Sbjct: 164 NYSSDYLKKDEQIFALRERKTLRNNTQTSSIN----------------NTPDVIDIKNTN 207

Query: 260 STIPNEFTLKSXXXXXXXXXXXXXXQPGSESIKIGFATDETPLVIPNCVAVPHSGETPIG 319
           + +P+                     PGS  ++IGFA DE PLV+P+CVA+P +      
Sbjct: 208 TEVPDYIAAADEDIDLSDANTTLVIHPGSRHLRIGFAKDEVPLVVPSCVAIPKTELNDEF 267

Query: 320 NAANLTRDQPDQFLQFKEELQTSFKERMRHYKRRVQLSSYDQVNTFNETTKPEIIEDQND 379
             A L R+QP++F + K  +Q SF+ERMR+YKR+V  ++++QV ++N+ +KP++IEDQND
Sbjct: 268 QEAPLKREQPEEFEELKSTIQHSFRERMRYYKRKVPFNAHEQVVSYNKNSKPQMIEDQND 327

Query: 380 PAKIAWRGQPDPQEGKTIYVGDEALLCLREHYMHRRPF--GCSEGKYLFNLDEKRYTSLA 437
           P  I W  +   +     Y G EAL C +E +  R PF  G S     FN+    Y SL 
Sbjct: 328 PGAINWIKKSSKR-----YYGSEALKCSKETFRIRCPFTKGGS-----FNVSSPDYASLQ 377

Query: 438 ALLCDVSRLLEHAIDKLLKKRDKDTEKDIKYKAVLVIPDLFEKSHVETMIRLLLSELPFN 497
            L+ DV  LLEHA+    +  + +  +  +YK VLVIPDLF KSHVET IR LL+E+ F 
Sbjct: 378 DLINDVISLLEHALSA--EGLNLERAQFSQYKVVLVIPDLFHKSHVETFIRFLLTEMQFQ 435

Query: 498 AVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIVVENSIINLNYGGDDISKLF 557
           AVAI+QESLA CYG+G S+STCVVN+GAT T +AC+DEG V+ENS+++L+YGGDD++KLF
Sbjct: 436 AVAIIQESLAGCYGAGQSSSTCVVNIGATHTSIACIDEGTVLENSLVSLDYGGDDLTKLF 495

Query: 558 AVLLLMSNFPYQEWDIDSIPGRMIAEHLKKECLTFQDADITTQLFNFIKRVPGLPTEKIE 617
           A+ LL S FPYQ+WDI+S  G ++AE LKK+  TFQDA++  QL+NFIKRVP   +E+ E
Sbjct: 496 ALFLLQSEFPYQDWDINSSHGWILAEELKKKYTTFQDANVAVQLYNFIKRVPDQQSEQYE 555

Query: 618 FKTFDEVILAPLALFYPKIFSLLKPNKGKNLTNPKLKYQLPDSRDLFTNKANNWKSLSEM 677
           FK FDEV LAPLALFYP+I S L     ++  N  ++ QLP SRD+FTN  N+W+SLS+ 
Sbjct: 556 FKVFDEVSLAPLALFYPEIISYLHSKSSQHSGNSNVESQLPASRDIFTNTVNDWRSLSQS 615

Query: 678 DCATNTLYSDMVQESVLLDNLLGINSR----REGPPKDSGVGSETTELNLTALDKSVIQS 733
           +C    LYS      +++  LL + +     +  PP ++      +  N T L+K++IQS
Sbjct: 616 ECLDGDLYSGNNNNQLIMSKLLDLQTSFDDFQSKPPMEAD-----SRKNYTPLEKAIIQS 670

Query: 734 ITNATLSLEPGKMASFYSNILIVGGSSNIPGFDTILKDRINMWRPKLIALASFPNFYNEL 793
           ITNA+  ++  KM+SFYSNIL+VGG S IP  D IL DRIN+WRP+L++L SFPNFY +L
Sbjct: 671 ITNASTPIDVAKMSSFYSNILVVGGGSKIPALDFILTDRINIWRPRLLSLTSFPNFYKKL 730

Query: 794 VKEIKDLETSAKXXXXXXXXXXXXXXXXXXXLNDDDAPKEVPEVKETSSDAKEYELNEKI 853
            K+ KD++T+ K                                  T    +E + ++KI
Sbjct: 731 AKQAKDIKTAGK----------------------------------TGESEEEDQSSKKI 756

Query: 854 QKLIEERLEKYLSAIERQNGNEHFMPVSVTPAPHNMNPSLLPWRGAGVLAQIKLIEELFV 913
            ++I   L+ Y  +IE QNG+EH +PV+V P P +M+ + L W+GA VLAQIKL+EEL++
Sbjct: 757 NEMISAELQAYWDSIEAQNGSEHLLPVNVLPPPRDMDAAELAWKGACVLAQIKLVEELYL 816

Query: 914 TNIDWDVHGSRVLQHKCIFTY 934
           T+ DWD+HGSR+LQ+KC+FTY
Sbjct: 817 TSTDWDIHGSRILQYKCLFTY 837

>Smik_15.320 Chr15 complement(551333..553954) [2622 bp, 873 aa] {ON}
           YOR141C (REAL)
          Length = 873

 Score =  740 bits (1911), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/812 (47%), Positives = 528/812 (65%), Gaps = 95/812 (11%)

Query: 145 SKSAAGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKVDSTTLPSTGGLKPLIVINQK 204
           +K+  GKKVPLHLLEKRRLGRIKAAEEFAK LK+IGIEKV++TTLP+TG  +PL++INQK
Sbjct: 135 AKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVEATTLPATGLFQPLMLINQK 194

Query: 205 NYSSDYIRKDDQIFALRERKFLRXXXXXXXXXXXXXXXXXXXXXXXXXHTPEVATSTIPN 264
           NYSSDY++KDDQIFALR+RKFLR                         +T +V+++  P+
Sbjct: 195 NYSSDYLKKDDQIFALRDRKFLRNN-----------------------NTTQVSSTNTPD 231

Query: 265 EFTLKSXXXXXXXX------------XXXXXXQPGSESIKIGFATDETPLVIPNCVAVP- 311
              LK+                           PGS S+KIGF  DE P+++PNCVAVP 
Sbjct: 232 VIDLKNLPHSEANTASLNEEIDLNDSTATIVIHPGSNSVKIGFPKDEHPVLVPNCVAVPK 291

Query: 312 -----HSGETPIGNAANLTRDQPDQFLQFKEELQTSFKERMRHYKRRVQLSSYDQVNTFN 366
                 S E       +L R+Q ++F   K +++ +F+ERMR+YKR+V  ++++QV +FN
Sbjct: 292 KWLNLESSEN--DEIFSLQREQSEKFHSIKSDMEKNFRERMRYYKRKVPGNAHEQVISFN 349

Query: 367 ETTKPEIIEDQNDPAKIAWRGQPDPQEGKTIYVGDEALLCLREHYMHRRPFGCSEGKYLF 426
           E +KPEII ++NDP+ I W       +   +Y G +AL C+ E ++ R+PF        F
Sbjct: 350 ENSKPEIISEKNDPSPIKWIF-----DDSKLYYGSDALRCVDEKFIIRKPFKGGS----F 400

Query: 427 NLDEKRYTSLAALLCDVSRLLEHAIDKLLKKRDKDTEKDIKYKAVLVIPDLFEKSHVETM 486
           N++   Y SLA L+ DV++LLE+A+    +  +    K  +YK VLVIPD+F+KSH+ET 
Sbjct: 401 NINSPYYKSLAELISDVTKLLEYALKS--ETLNVKPAKFNQYKVVLVIPDIFKKSHIETF 458

Query: 487 IRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIVVENSIINL 546
           IR+LL+EL F AVAI+QESLATCYG+GISTSTCVVN+GA+ T++ACVDEG V+E+S I L
Sbjct: 459 IRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGASETRIACVDEGTVLEHSAITL 518

Query: 547 NYGGDDISKLFAVLLLMSNFPYQEWDIDSIPGRMIAEHLKKECLTFQDADITTQLFNFIK 606
           +YGGDDI++LF + LL S+FP Q+W I+S  G ++AE LKK   TFQDAD+  QL+NFI 
Sbjct: 519 DYGGDDITRLFGLFLLQSDFPLQDWKINSEHGWLLAEQLKKNFTTFQDADVAVQLYNFIN 578

Query: 607 RVPGLPTEKIEFKTFDEVILAPLALFYPKIFSLLKPNKGKNLTNPKLKYQLPDSRDLFTN 666
           R P  PTEK EFK FDEV+LAPLALF+P+IF L++ +  KN +   L++QLP+SRDLFTN
Sbjct: 579 RSPNQPTEKYEFKLFDEVMLAPLALFFPQIFKLIRTSSDKNSS---LEFQLPESRDLFTN 635

Query: 667 KANNWKSLSEMDCATNTLYSDMVQESVLLDNLLG----INSRREGPPKDSGVGSETTELN 722
           + N+W SLS+ +     LY ++  +  +L  +L     I+  ++ P     +  E    N
Sbjct: 636 ELNDWNSLSQFESKEGNLYCNLDDDLEILKKILQAHNMIDQLQDKPENYGNISKE----N 691

Query: 723 LTALDKSVIQSITNATLSLEPGKMASFYSNILIVGGSSNIPGFDTILKDRINMWRPKLIA 782
              L+K++IQSI NA+++ +  +M SFYSNILIVGGSS IP  D IL DRIN+WRP L++
Sbjct: 692 FAPLEKAIIQSIANASITADVTRMNSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLS 751

Query: 783 LASFPNFYNELVKEIKDLETSAKXXXXXXXXXXXXXXXXXXXLNDDDAPKEVPEVKETSS 842
            ASFP FY +L KEIKDLE+                          +AP +  E      
Sbjct: 752 SASFPQFYKKLTKEIKDLESHFV-----------------------NAPDKTEE------ 782

Query: 843 DAKEYELNEKIQKLIEERLEKYLSAIERQNGNEHFMPVSVTPAPHNMNPSLLPWRGAGVL 902
              +  L  +I++ + E L++    IE QNGNEH  P+S+ P P +MNP+L+ W+GA VL
Sbjct: 783 -ENKLVLQRQIKEKVVEELDEQHQNIENQNGNEHVFPISIIPPPRDMNPALIIWKGASVL 841

Query: 903 AQIKLIEELFVTNIDWDVHGSRVLQHKCIFTY 934
           AQIKL+EELF+TN DWDVHGSR+LQ+KCIFTY
Sbjct: 842 AQIKLVEELFITNNDWDVHGSRILQYKCIFTY 873

>ZYRO0D11308g Chr4 complement(955212..957818) [2607 bp, 868 aa] {ON}
           similar to uniprot|Q12386 Saccharomyces cerevisiae
           YOR141C ARP8 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 868

 Score =  740 bits (1910), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/805 (48%), Positives = 525/805 (65%), Gaps = 75/805 (9%)

Query: 145 SKSAAGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKVDSTTLPSTGGLKPLIVINQK 204
           +K+  GKKVPLHLLEKRRLGRIKAAEEFA+KLK+IGIEKV++ TLP TG  +P+I+INQK
Sbjct: 124 AKAPPGKKVPLHLLEKRRLGRIKAAEEFARKLKKIGIEKVETNTLPPTGLFQPMILINQK 183

Query: 205 NYSSDYIRKDDQIFALRERKFLRXXXXXXXXXXXXXXXXXXXXXXXXXHTPEVATSTIPN 264
           NYSSDY++KD+Q+FALR+RK LR                         +TP+VA     N
Sbjct: 184 NYSSDYLKKDEQVFALRDRKVLRNNTQVPSMA----------------NTPDVADLKREN 227

Query: 265 EFTLK------SXXXXXXXXXXXXXXQPGSESIKIGFATDETPLVIPNCVAVPHS---GE 315
             T +                      PGS S+K+GFA DE+P VIP+CVA+P S    +
Sbjct: 228 GNTTELNEAAGDEDIDLSDANTTLVIHPGSNSLKVGFAKDESPFVIPSCVAIPKSELHNQ 287

Query: 316 TPIG--NAANLTRDQPDQFLQFKEELQTSFKERMRHYKRRVQLSSYDQVNTFNETTKPEI 373
            P+   N    TRDQP +F + K E+Q SF+ERMR YKR+VQ ++++QV  FN+ +KPE+
Sbjct: 288 IPMDQKNQTCYTRDQPTEFEEIKAEMQHSFRERMRFYKRKVQPNAHEQVINFNKVSKPEL 347

Query: 374 IEDQNDPAKIAWRGQPDPQEGKTIYVGDEALLCLREHYMHRRPF--GCSEGKYLFNLDEK 431
           IED+ND  +I W   PD +     Y G +AL C ++H++ R P   G S     FN+   
Sbjct: 348 IEDKNDYNRINWITTPDRR-----YYGADALRCSKDHFVIRYPIVKGGS-----FNIASP 397

Query: 432 RYTSLAALLCDVSRLLEHAID--KLLKKRDKDTEKDIKYKAVLVIPDLFEKSHVETMIRL 489
            Y SL  L+ D + LLEH +   +   KR +  +    YK VLVIPDLFEKSHVET+IR 
Sbjct: 398 DYRSLQDLMGDFTGLLEHVLRSPRFQLKRSQFAQ----YKVVLVIPDLFEKSHVETLIRC 453

Query: 490 LLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIVVENSIINLNYG 549
           L++E+ F AVAI+QESLATCYG+GISTSTCVVN+GAT T++ACVDEG V+++S I L+YG
Sbjct: 454 LITEMQFQAVAIMQESLATCYGAGISTSTCVVNIGATQTRIACVDEGTVLQDSCITLDYG 513

Query: 550 GDDISKLFAVLLLMSNFPYQEWDIDSIPGRMIAEHLKKECLTFQDADITTQLFNFIKRVP 609
            DDI+KLFA+ LL S FPYQ+WDI++  G  +AE LKK   TFQDA++T QL+NFIKR+P
Sbjct: 514 SDDITKLFALFLLQSEFPYQDWDIETAHGWHLAEELKKNYTTFQDANVTVQLYNFIKRIP 573

Query: 610 GLPTEKIEFKTFDEVILAPLALFYPKIFSLLKPNKGKNLTNPKLKYQLPDSRDLFTNKAN 669
           G   EK +FK FDEVILAPL+LFYP I + L+        N KL+ +LP SRD+FT+  +
Sbjct: 574 GQQAEKFDFKVFDEVILAPLSLFYPGIVAQLRNELKPRSQNEKLESELPISRDIFTDNLD 633

Query: 670 NWKSLSEMDCATNTLYSDMVQESVLLDNLLGINSRREGPPKDSGVGSETTELNLTALDKS 729
           +W+SLS+ +C  N LY     E  +L  LL   SR +    ++ +  +  + N   L+K+
Sbjct: 634 DWRSLSQTECLDNQLYCGNQDEFQMLCKLLDAPSRLDELQAENRLEPDIRQ-NYAPLEKA 692

Query: 730 VIQSITNATLSLEPGKMASFYSNILIVGGSSNIPGFDTILKDRINMWRPKLIALASFPNF 789
           ++QSITNA LS +  KM+SFYSNIL+ GG SN+P FD IL DRIN+WRP++++  SFP+ 
Sbjct: 693 IVQSITNACLSFDVSKMSSFYSNILVCGGGSNVPAFDFILTDRINIWRPRILSHTSFPDL 752

Query: 790 YNELVKEIKDLETSAKXXXXXXXXXXXXXXXXXXXLNDDDAPKEVPEVKETSSDAKEYEL 849
           Y +L K+IKD++ S K                       + P+E            + +L
Sbjct: 753 YKKLSKQIKDIKNSVKNGE-----------------GKSNGPQE------------DEQL 783

Query: 850 NEKIQKLIEERLEKYLSAIERQNGNEHFMPVSVTPAPHNMNPSLLPWRGAGVLAQIKLIE 909
            EK+Q++I++ LE+Y   IE QN  +H +PVSV P P +++P++L W+GA VLAQIKL+E
Sbjct: 784 KEKVQEVIKKELERYHELIESQNNADHTLPVSVLPPPRDLDPAILIWKGASVLAQIKLVE 843

Query: 910 ELFVTNIDWDVHGSRVLQHKCIFTY 934
           EL++T  DWD+HGSR+LQ+KCIFTY
Sbjct: 844 ELYLTGADWDIHGSRILQYKCIFTY 868

>NCAS0H02290 Chr8 complement(450017..452608) [2592 bp, 863 aa] {ON}
           Anc_5.477 YOR141C
          Length = 863

 Score =  726 bits (1873), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/842 (47%), Positives = 533/842 (63%), Gaps = 94/842 (11%)

Query: 122 SATASPTPSVVMNGAADEKQEKD------------SKSAAGKKVPLHLLEKRRLGRIKAA 169
           S TA+PT ++   G+A+ K  K+            +K   GKKVPLHLLEKRRLGRIKAA
Sbjct: 87  SGTATPTRTLTPMGSANGKTTKEEGPQKKVQKVEPNKVPLGKKVPLHLLEKRRLGRIKAA 146

Query: 170 EEFAKKLKQIGIEKVDSTTLPSTGGLKPLIVINQKNYSSDYIRKDDQIFALRERKFLRXX 229
           +EFAKKLK+IGIEKV+S  +P TG  +PL++INQKNYSSDY+RKD+QIFALRERK LR  
Sbjct: 147 KEFAKKLKEIGIEKVESVPVPMTGMFQPLLLINQKNYSSDYLRKDEQIFALRERKTLRSN 206

Query: 230 XXXXXXXXXXXXXXXXXXXXXXXHTPEVATSTIPNE---FTLKSXXXXXXXXX---XXXX 283
                                  +TPEV       E   FT  +                
Sbjct: 207 TTQNISSS---------------NTPEVTDLQSVRETSNFTTANGNNDEILLNDPNTTIV 251

Query: 284 XQPGSESIKIGFATDETPLVIPNCVAVPHS--GETPI--GNAANLTRDQPDQFLQFKEEL 339
             PGS  +K+GFA DE P +IPNCVA+P +    T I      ++  +  ++F   K E+
Sbjct: 252 IHPGSSFLKVGFALDEVPELIPNCVALPKTDFNNTNIIKSKQTSVNIEDNEKFESLKAEM 311

Query: 340 QTSFKERMRHYKRRVQLSSYDQVNTFNETTKPEIIEDQNDPAKIAWRGQPDPQEGKTIYV 399
           + SF+ERMR+YKRR+Q + +DQV +FN  +KPE +  QNDPA I W       +G   + 
Sbjct: 312 EESFEERMRYYKRRIQPNGHDQVVSFNRLSKPESLPVQNDPAHIDW-----ITDGTKRFY 366

Query: 400 GDEALLCLREHYMHRRPF--GCSEGKYLFNLDEKRYTSLAALLCDVSRLLEHAIDKLLKK 457
           GD+AL C  E+++ R PF  G S     FN     Y SL  LL DV  L+E  +     K
Sbjct: 367 GDDALRCTDENFIKRYPFKKGGS-----FNTSSNSYKSLQDLLSDVVGLIEGTLSS--DK 419

Query: 458 RDKDTEKDIKYKAVLVIPDLFEKSHVETMIRLLLSELPFNAVAIVQESLATCYGSGISTS 517
            +  + +  +YK VLVIPD FEKSHVE  IRLL++EL F AVAI+QESL+ CYGSG+  S
Sbjct: 420 FNIKSSQFSQYKVVLVIPDSFEKSHVELFIRLLVTELQFQAVAIIQESLSVCYGSGLGGS 479

Query: 518 TCVVNVGATGTKVACVDEGIVVENSIINLNYGGDDISKLFAVLLLMSNFPYQEWDIDSIP 577
           TCVVNVG+  T VACVDEGIV++NS+I L+YG +D++KLFA  LL  +FPY+ WD++S  
Sbjct: 480 TCVVNVGSKETTVACVDEGIVLDNSLITLDYGSNDVTKLFAKFLLDCDFPYKNWDLNSTE 539

Query: 578 GRMIAEHLKKECLTFQDADITTQLFNFIKRVP-GLPTEKIEFKTFDEVILAPLALFYPKI 636
           G  +AE L K+C+TFQDADIT QL NFIKR P G   EK++FK F+EV+LAPLALFYP+I
Sbjct: 540 GWRLAEELMKQCVTFQDADITVQLSNFIKRTPRGNTVEKLDFKVFEEVMLAPLALFYPEI 599

Query: 637 FSLLKPNKGKNLTNPKLKYQLPDSRDLFTNKANNWKSLSEMDCATNTLYSDMVQESVLLD 696
           F LL+  + +   N +L+YQLP SRD+FT+K N+W+SLS+ DC  +  + D+  E  LL 
Sbjct: 600 FKLLRSKESEE-QNAELEYQLPPSRDIFTDKINDWRSLSQNDCINHQTFCDIHDEYELLK 658

Query: 697 NLLG----INSRREGPPKDSGVGSETTELNLTALDKSVIQSITNATLSLEPGKMASFYSN 752
             +     + +  + PP++     + +  N T LDK++++SIT A+L L+  KMA+FYSN
Sbjct: 659 KAVDCPNTLETFMDNPPEE-----KKSTFNFTPLDKAIVESITTASLGLDVSKMATFYSN 713

Query: 753 ILIVGGSSNIPGFDTILKDRINMWRPKLIALASFPNFYNELVKEIKDLETSAKXXXXXXX 812
           IL+VGG S IPGFD +L DR+N+WRP+L++L +F +FY EL K++K+L++          
Sbjct: 714 ILVVGGGSKIPGFDLMLMDRVNIWRPRLLSLRAFTHFYRELTKQLKELQS---------- 763

Query: 813 XXXXXXXXXXXXLNDDDAPKEVPEVKETSSDAKEYELNEKIQKLIEERLEKYLSAIERQN 872
                       L   D  +E+          KE ELNEKI +LI+  L KYL  IE+Q+
Sbjct: 764 ------------LKTGDGEEEI----------KEDELNEKISELIKTELTKYLEVIEQQS 801

Query: 873 GNEHFMPVSVTPAPHNMNPSLLPWRGAGVLAQIKLIEELFVTNIDWDVHGSRVLQHKCIF 932
           GNEHF+PV V P+P+ ++P  + W+GA VLAQIKL+EELF+TN DWDVHG+R+LQ+K I 
Sbjct: 802 GNEHFLPVEVIPSPNEIDPGSIAWKGASVLAQIKLVEELFITNGDWDVHGNRILQYKSIL 861

Query: 933 TY 934
           TY
Sbjct: 862 TY 863

>Kpol_543.10 s543 complement(25137..27767) [2631 bp, 876 aa] {ON}
           complement(25137..27767) [2631 nt, 877 aa]
          Length = 876

 Score =  707 bits (1824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/807 (46%), Positives = 522/807 (64%), Gaps = 88/807 (10%)

Query: 147 SAAGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKVDSTTLPSTGGLKPLIVINQKNY 206
           +   KKVP HLLEKRRLGR+KAAE FA KLK+ GIE+VD++ L  TG    ++++NQKN 
Sbjct: 139 TTENKKVPRHLLEKRRLGRLKAAEAFAAKLKKTGIERVDNSHLQQTGLFGQMLLVNQKNC 198

Query: 207 SSDYIRKDDQIFALRERKFLRXXXXXXXXXXXXXXXXXXXXXXXXXHTPEV--------- 257
           SSDY++KDDQ+FALRERK LR                         +TP+V         
Sbjct: 199 SSDYLKKDDQVFALRERKTLRNNTTVSTTA----------------NTPDVVDLKALNNG 242

Query: 258 ATSTIPNEFTLKSXXXXXXXX-XXXXXXQPGSESIKIGFATDETPLVIPNCVAVPHSGET 316
           +++++ +E   K+                PGS  +KIGFA DETPLV+P+CVA+P +   
Sbjct: 243 SSASLVDEVLNKNDDDIDFNDPTTTIVIHPGSRYLKIGFAKDETPLVVPSCVAIPKNSLY 302

Query: 317 PIGNAANLTRDQ---PDQFLQFKEELQTSFKERMRHYKRRVQLSSYDQVNTFNETTKPEI 373
              N   L+ D+    ++ +  K +LQ SF+ERMR+YKR++Q +S+++V TFNE  KPEI
Sbjct: 303 S-ENVRELSIDKIEDSERLVGMKAQLQQSFRERMRYYKRKIQPNSHERVRTFNEQAKPEI 361

Query: 374 IEDQNDPAKIAWRGQPDPQEGKTIYVGDEALLCLREHYMHRRPFGCSEGKYLFNLDEKRY 433
           +ED+ND  +I W    D      IY G+EA  C +E+++ R PF  ++G  L NLD   Y
Sbjct: 362 VEDKNDHGRIEWINNSDK-----IYFGEEAERCNKENFIIRYPF--NKGGSL-NLDSPYY 413

Query: 434 TSLAALLCDVSRLLEHAIDKLLKKRDKD-TEKDIKY-KAVLVIPDLFEKSHVETMIRLLL 491
           +SL  LL DV+RL E+A    L KRD+  T+  I+  K +LVIPDLFEKSH+ET+ R+LL
Sbjct: 414 SSLPELLSDVTRLFEYA----LTKRDESITQAQIQQCKVILVIPDLFEKSHIETLYRILL 469

Query: 492 SELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIVVENSIINLNYGGD 551
            E+ F AVAI+QESLA CYG+GIST++C+VN+GAT T +ACVDEG V+ENS+I L+YGGD
Sbjct: 470 KEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQTTIACVDEGTVLENSLIKLDYGGD 529

Query: 552 DISKLFAVLLLMSNFPYQEWDIDSIPGRMIAEHLKKECLTFQDADITTQLFNFIKRVPGL 611
           DI++LF + LL +NFP+Q+ D+DS  G  +AE LKK   TF+DA++T QL+NF+KR+PG 
Sbjct: 530 DITRLFTLFLLENNFPFQDLDLDSTHGWTLAEQLKKNYATFEDANMTVQLYNFVKRIPGK 589

Query: 612 PTEKIEFKTFDEVILAPLALFYPKIFSLLKPNKGKNLTNPKLKYQLPDSRDLFTNKANNW 671
            +EK EFK FDEVILAPLALFYP IF  LK    KN  N  L+ QLP SRDL+T+  N+W
Sbjct: 590 VSEKYEFKVFDEVILAPLALFYPDIFQELKKLDSKNKFN--LEDQLPVSRDLYTDSINDW 647

Query: 672 KSLSEMDCATNTLYSDMVQESVLLDNLLGINSRREGPPKDSGVGSETTEL----NLTALD 727
           +S+S++ C    LY+    E  ++  +L INS  E        G ETTE+    N   L+
Sbjct: 648 RSVSQLQCLDGDLYAGNTNELDIITKVLNINSSTEEYE-----GLETTEVDGRENYVPLE 702

Query: 728 KSVIQSITNATLSLEPGKMASFYSNILIVGGSSNIPGFDTILKDRINMWRPKLIALASFP 787
           K++IQSITNA +S++  KM  FY+NI++VGG+SNIP  D +L DRIN+WRPK +   +FP
Sbjct: 703 KAIIQSITNACVSMDVSKMNQFYANIMVVGGTSNIPQLDFVLTDRINIWRPKALCNTTFP 762

Query: 788 NFYNELVKEIKDLETSAKXXXXXXXXXXXXXXXXXXXLNDDDAPKEVPEVKETSSDAKEY 847
           +F+  + K++K++++++K                         P+E  ++K++       
Sbjct: 763 HFFKNISKQVKEIQSTSKAST---------------------TPEEEEKIKQS------- 794

Query: 848 ELNEKIQKLIEERLEKYLSAIERQNGNEHFMPVSVTPAPHNMNPSLLPWRGAGVLAQIKL 907
                I++LIE  L KYL++IE Q   +H  PV+V P P +MNP +L W+GA VLAQIKL
Sbjct: 795 -----IKELIETELRKYLNSIESQGNGDHSYPVAVLPPPRDMNPEVLNWKGASVLAQIKL 849

Query: 908 IEELFVTNIDWDVHGSRVLQHKCIFTY 934
           IEELFVTN DWD+ GSR+LQ+KC+FTY
Sbjct: 850 IEELFVTNTDWDMLGSRILQYKCLFTY 876

>CAGL0I07161g Chr9 (686948..689461) [2514 bp, 837 aa] {ON} similar
           to uniprot|Q12386 Saccharomyces cerevisiae YOR141c ARP8
           Actin-related protein
          Length = 837

 Score =  686 bits (1771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/800 (44%), Positives = 509/800 (63%), Gaps = 60/800 (7%)

Query: 146 KSAAGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKVDSTTLPSTGGLKPLIVINQKN 205
           K+  GKKVPLHLLEKRRLGR+KAAEEFA+KLK +GIE+V++  LP +G   P+ +INQKN
Sbjct: 87  KAPPGKKVPLHLLEKRRLGRLKAAEEFARKLKVVGIERVENLNLPQSGLFSPVPLINQKN 146

Query: 206 YSSDYIRKDDQIFALRERKFLRXXXXXXXXXXXXXXXXXXXXXXXXXHTPEVATSTIPNE 265
           YSSDY+RKD+  FA+RERK +R                          +     + +  +
Sbjct: 147 YSSDYLRKDENAFAVRERKQMRNSNANNSAHAKTSELGSGAQSASMASS-ASLDALVDTD 205

Query: 266 FTLKSXXXXXXXX-XXXXXXQPGSESIKIGFATDETPLVIPNCVAVPHS------GETPI 318
             L+S                PGS+SIKIG ATDE P+ IPN VAVP S       ETP+
Sbjct: 206 TKLQSVEDIDFNDPRLTIVIHPGSDSIKIGLATDEEPVSIPNLVAVPRSQVVNPVDETPV 265

Query: 319 GNAANLTRDQPDQFLQFKEELQTSFKERMRHYKRRVQLSSYDQVNTFNETTKPEIIEDQN 378
            N  N+  D  DQF +   +L+ +FKERM++YKR++Q ++++QV +FN  +KPE + D+N
Sbjct: 266 -NVLNIELD--DQFHELTNQLKYNFKERMKYYKRKMQSNAHEQVTSFNSNSKPEEVSDKN 322

Query: 379 DPAKIAWRGQPDPQEGKTIYVGDEALLCLREHYMHRRPFGCSEGKYLFNLDEKRYTSLAA 438
           D  KI W    D +     Y G++A  C+ + ++ RRPF C  G  +FNL+   Y+S+  
Sbjct: 323 DQGKIDWIYNADKK-----YYGEDAQRCIGDEFILRRPF-CKSG--IFNLESNNYSSIQD 374

Query: 439 LLCDVSRLLEHAIDKLLKKRDKDTEKDIK-YKAVLVIPDLFEKSHVETMIRLLLSELPFN 497
           LL DVS L++ A   L   +   T+ + K YKAV+VIPDLF+KSH+ET IRLLL+E+ F 
Sbjct: 375 LLGDVSELVDSA---LSSDKFNITKSEYKHYKAVIVIPDLFKKSHLETFIRLLLNEMDFR 431

Query: 498 AVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIVVENSIINLNYGGDDISKLF 557
           +VA++QESLATCYG+GIST TCVVN+GA   ++ACVD+G ++++S + L+YGG+D++ L 
Sbjct: 432 SVALMQESLATCYGAGISTPTCVVNIGAEQIRIACVDDGTIIQDSAVTLDYGGNDVTNLL 491

Query: 558 AVLLLMSNFPYQEWDIDSIPGRMIAEHLKKECLTFQDADITTQLFNFIKRVPGLPTEKIE 617
           A+LL  S FPY+ W++ ++ G   AE  KK+ +TFQDADI  QLFNFIKRVPG+P+EK +
Sbjct: 492 AILLQQSKFPYKNWNLSTLYGWKTAEDFKKKFVTFQDADIAVQLFNFIKRVPGIPSEKYD 551

Query: 618 FKTFDEVILAPLALFYPKIFSLLKPNK---GKNLTNPKLKYQLPDSRDLFTNKANNWKSL 674
           FK FDEVILAPL LFYP+IF  ++  +    K      LK Q+  SRD++TN  N+W+S+
Sbjct: 552 FKVFDEVILAPLGLFYPEIFKYIQERQRPTAKEYETTLLK-QIEPSRDIYTNSLNDWRSI 610

Query: 675 SEMDCATNTLYSDMVQESVLLDNLLGINSRREGPPKDSGVGSETTELNLTALDKSVIQSI 734
           ++ DC  N +Y D   +  ++ + L +N+  E   +   +   T +     LDK+++QSI
Sbjct: 611 TQRDCEENMIYCDAKDDLEIIQHALDLNTHIED-LQSKHIEENTDKKCFVPLDKAIVQSI 669

Query: 735 TNATLSLEPGKMASFYSNILIVGGSSNIPGFDTILKDRINMWRPKLIALASFPNFYNELV 794
           TNA ++++  K++ FYSNI+IVGG +NIP  D IL DRIN+WRP ++ ++SFPNFY  L 
Sbjct: 670 TNAAINVDISKISQFYSNIIIVGGGANIPALDFILSDRINIWRPAVLGISSFPNFYKSLT 729

Query: 795 KEIKDLETSAKXXXXXXXXXXXXXXXXXXXLNDDDAPKEVPEVKETSSDAKEYELNEKIQ 854
           K++KD++TS K                                  T   ++E E+ E+  
Sbjct: 730 KQLKDIQTSNKS--------------------------------NTGDKSQEQEVAERSI 757

Query: 855 KLIEERLEKYLSAIERQNGNEHFMPVSVTPAPHNMNPSLLPWRGAGVLAQIKLIEELFVT 914
            L++  L+K ++++E  N  +HF  V V PAP N++PSLL W+GA VLAQIKLIEEL+++
Sbjct: 758 ALVKVELDKLVASLEIPNSGDHFFTVGVLPAPRNLDPSLLDWKGASVLAQIKLIEELYIS 817

Query: 915 NIDWDVHGSRVLQHKCIFTY 934
             DWDVHG+RVLQ+KCIF Y
Sbjct: 818 RNDWDVHGNRVLQYKCIFAY 837

>NDAI0C01370 Chr3 (283773..286697) [2925 bp, 974 aa] {ON} Anc_5.477
           YOR141C
          Length = 974

 Score =  684 bits (1764), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/838 (45%), Positives = 517/838 (61%), Gaps = 77/838 (9%)

Query: 146 KSAAGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKVDSTTLPSTGGLKPLIVINQKN 205
           K   GKKVPLHLLEKRRLGRIKAAEEFAKKLK+ GIEKV+S T+P TG  +PL +INQKN
Sbjct: 165 KVPPGKKVPLHLLEKRRLGRIKAAEEFAKKLKEAGIEKVESVTVPPTGLFQPLNLINQKN 224

Query: 206 YSSDYIRKDDQIFALRERKFLRXXXXXXXXXXXXXXXXXXXXXXXXXHTPEVATSTIPNE 265
           YSS Y++ DDQIF LR+ K L+                          TP+    ++   
Sbjct: 225 YSSIYLKNDDQIFCLRDDKSLKNTSPNQTSTA----------------TPDNIVESVATG 268

Query: 266 FTLKSXXXXXXXX--XXXXXXQPGSESIKIGFATDETPLVIPNCVAVPH----------- 312
              KS                  GS S+KIG A DE P+++PNCVA+P            
Sbjct: 269 INNKSTGDQLNLNDPTKTIIIHTGSHSLKIGKALDENPIIVPNCVAIPKQEYEGMTRNIN 328

Query: 313 ---SGETPIGNAANLTRDQPDQFLQFKEELQTSFKERMRHYKRRVQLSSYDQVNTFNETT 369
              S  TP  N    +  Q D+F   K E++T+FKERM++YKRR+Q +S +QV +FN+ +
Sbjct: 329 TKDSIPTPPENNIFDSIAQSDEFNDLKLEIETNFKERMKYYKRRIQPNSCEQVKSFNKIS 388

Query: 370 KPEIIEDQNDPAKIAWRGQPDPQEGKTIYVGDEALLCLREHYMHRRPFGCSEGKYLFNLD 429
           KPEI+   NDP +I W  +   +     Y G  A  C   H+  R+PF  +     FN+ 
Sbjct: 389 KPEILPISNDPQRIQWINESTNKR----YYGSNAERCTDLHFKTRKPFSNNGS---FNIA 441

Query: 430 EKRYTSLAALLCDVSRLLEHAIDKLLKKRDKDTEKDIKYKAVLVIPDLFEKSHVETMIRL 489
              Y SL  LL DV+ L+EH++       D    +  ++K VL+IPD F KSHVE  I L
Sbjct: 442 STDYISLQDLLSDVTNLIEHSLTS--SPFDLKPSQFKEHKVVLIIPDSFGKSHVELFITL 499

Query: 490 LLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIVVENSIINLNYG 549
           LL+ L F AVAI+QESLATCYG+G S  TCVVN+GA+ T VACVDEG V+ENS+++LNYG
Sbjct: 500 LLTHLKFQAVAIIQESLATCYGAGNSVPTCVVNLGASQTTVACVDEGTVLENSMVSLNYG 559

Query: 550 GDDISKLFAVLLLMSNFPYQEWDIDSIPGRMIAEHLKKECLTFQDADITTQLFNFIKRVP 609
           G+DI+ +FA  LL ++FPY  W+++SI G  +AE LK++ +TFQD D+T QLFNFIKR+P
Sbjct: 560 GNDITNIFATFLLQNDFPYHNWNLNSIEGWKLAEELKEKYITFQDMDVTVQLFNFIKRLP 619

Query: 610 GLPT-EKIEFKTFDEVILAPLALFYPKIFSLLKPNKGKNLTNPKLKYQLPDSRDLFTNKA 668
           G+ T EK +FK FD+V+LAPL LF+PKI  L+K  + +N  N  L+ QLPDSRD++T K 
Sbjct: 620 GMDTIEKYDFKVFDDVMLAPLTLFFPKILKLMKEQQPQN-RNKFLQSQLPDSRDIYTTKI 678

Query: 669 NNWKSLSEMDCATNTLYSDMVQESVLLDNLLGINSRREGPPKDSGVGSETTELNLTALDK 728
           N+W+S+++ +C  + L+S +  E  LL   L +    E    +S   ++  +LN T LD 
Sbjct: 679 NDWRSITQEECLESKLFSYIDNELELLKRTLEVPILLENFQNNSP-DNKNDKLNYTPLDV 737

Query: 729 SVIQSITNATLSLEPGKMASFYSNILIVGGSSNIPGFDTILKDRINMWRPKLIALASFPN 788
           ++IQSI NA+ +++  KM+SFYSNIL+VGG S IP  D IL DRIN+WRP+L++L SFPN
Sbjct: 738 AIIQSIMNASTNIDMSKMSSFYSNILVVGGGSKIPALDFILTDRINIWRPRLLSLTSFPN 797

Query: 789 FYNELVKEIKDLET---------------------------SAKXXXXXXXXXXXXXXXX 821
           FY EL K+IKDL+                            ++                 
Sbjct: 798 FYKELSKDIKDLQNHYLKLISTATAATTQTTATATTNNNTTNSTSNSTPAITQVPSGTNI 857

Query: 822 XXXLND---DDAP-KEVPEVKETSSDAKEYELNEKIQKLIEERLEKYLSAIER-QNGNEH 876
              LN    D+ P  E  EV+E  +  K  E+++KI +L++E+LE+YL  +E+ QNGN+H
Sbjct: 858 SNNLNSTKIDNTPGAETNEVEEAVNKLKR-EMDDKINELLKEKLEEYLETVEKAQNGNDH 916

Query: 877 FMPVSVTPAPHNMNPSLLPWRGAGVLAQIKLIEELFVTNIDWDVHGSRVLQHKCIFTY 934
           ++PVSV PAP +++P+L+ W+GA VLAQ+K+IEEL++TN DWDVHGSR+LQ+K IF Y
Sbjct: 917 YLPVSVVPAPRDIDPALILWKGASVLAQLKIIEELYMTNADWDVHGSRILQYKSIFPY 974

>TBLA0A02530 Chr1 (610524..613088) [2565 bp, 854 aa] {ON} Anc_5.477
           YOR141C
          Length = 854

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/798 (45%), Positives = 505/798 (63%), Gaps = 73/798 (9%)

Query: 147 SAAGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKVDSTTLPSTGGLKPLIVINQKNY 206
           S+  KK  LHLLEKRRLGR+KAAEEFAKKLKQ GIEK+++ T+  TG  +P ++INQKNY
Sbjct: 120 SSKNKKFHLHLLEKRRLGRLKAAEEFAKKLKQSGIEKIETLTVNPTGLFQPAMLINQKNY 179

Query: 207 SSDYIRKDDQIFALRERKFLRXXXXXXXXXXXXXXXXXXXXXXXXXHTPEVATSTIPNEF 266
           SSDY++KD QIFA+R RK +R                         +TP+          
Sbjct: 180 SSDYLKKDSQIFAMRNRKEIRENAQTTTSLN---------------NTPDFQEGRGEANQ 224

Query: 267 TLKSXXXXXXXXXXXXXXQPGSESIKIGFATDETPLVIPNCVAVPHS----GETPIGNAA 322
             +                PGS+ +KIG+A D  P++IP+CVAVP +      + + +  
Sbjct: 225 AAQDEDINLGDPSTTIVIHPGSKFLKIGYAQDPNPILIPSCVAVPKNQFLDTVSELNDNF 284

Query: 323 NLTRDQPDQFLQFKEELQTSFKERMRHYKRRVQLSSYDQVNTFNETTKPEIIEDQNDPAK 382
           N ++DQ ++F ++K EL  SFKERMR YKR+VQ + ++QV +FN+ +KPE + ++ND   
Sbjct: 285 NYSKDQSEKFDEYKNELLKSFKERMRFYKRKVQTNGHEQVLSFNKNSKPEDVTEKNDIED 344

Query: 383 IAWRGQPDPQEGKTIYVGDEALLCLREHYMHRRPF--GCSEGKYLFNLDEKRYTSLAALL 440
           +  R   DPQ+    Y G +A+ C +E+++ R PF  G S     FN++   Y +L+ LL
Sbjct: 345 VN-RWINDPQKK---YFGSDAIRCSKENFIIRYPFINGGS-----FNIEAPYYRTLSELL 395

Query: 441 CDVSRLLEHAIDK---LLKKRDKDTEKDIKYKAVLVIPDLFEKSHVETMIRLLLSELPFN 497
            +V   L H +      LK  D  +     YK VLVI D+FEKSH+E M RLLL+E+ FN
Sbjct: 396 SEVCEFLVHILTSDTFQLKTSDFSS-----YKIVLVISDIFEKSHLEVMFRLLLNEMQFN 450

Query: 498 AVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIVVENSIINLNYGGDDISKLF 557
           AVAI+QESLATCYG+G+ +STCVVNVGAT T++ACVDEG +VE+SI++L+YGGDDI+KLF
Sbjct: 451 AVAIIQESLATCYGAGVGSSTCVVNVGATQTRIACVDEGSIVEDSIVSLDYGGDDITKLF 510

Query: 558 AVLLLMSNFPYQEWDIDSIPGRMIAEHLKKECLTFQDADITTQLFNFIKRVPGLPTEKIE 617
           ++LLL S FPY + +I++    ++AE LKK+ +TF DA++T QL+NFIKRVPG   +K E
Sbjct: 511 SILLLQSGFPYTDLNINAAHDWILAEKLKKDFVTFHDANVTVQLYNFIKRVPGQIPQKYE 570

Query: 618 FKTFDEVILAPLALFYPKIFSLLKPNKGKNLTNPKLKYQLPDSRDLFTNKANNWKSLSEM 677
           F+TF+EV+LAPL+LFYP++  LLK  +     N ++K QLP SRD+FT++ N+WKS+++ 
Sbjct: 571 FETFEEVMLAPLSLFYPQVLKLLKSEQLAKYKNEQVKKQLPASRDIFTSELNDWKSIAQA 630

Query: 678 DCATNTLYSDMVQESVLLDNLLGINSRREGPPKDSGVGSETTELNLTALDKSVIQSITNA 737
           DC    LYS+   E  +L   L I+   E    +     E    N T+L+K++IQSI NA
Sbjct: 631 DCLNKNLYSETSDEISMLKRTLNIHLNLEEIRDEIDKEHEIPNSNYTSLEKAIIQSIANA 690

Query: 738 TLSLEPGKMASFYSNILIVGGSSNIPGFDTILKDRINMWRPKLIALASFPNFYNELVKEI 797
           + SL+  K+ SFYSNIL+VGG + IP  D IL+DRI +WRP+L+++ SFP FY +L K I
Sbjct: 691 SASLDISKINSFYSNILLVGGGAKIPSLDFILEDRIKIWRPRLLSVNSFPTFYKKLTKLI 750

Query: 798 KDLETSAKXXXXXXXXXXXXXXXXXXXLNDDDAPKEVPEVKETSSDAKEYE-LNEKIQKL 856
                                             KE+P   +T+  ++E E L + I +L
Sbjct: 751 ----------------------------------KELPNYGKTNKTSEEEESLKKAIDEL 776

Query: 857 IEERLEKYLSAIERQNGNEHFMPVSVTPAPHNMNPSLLPWRGAGVLAQIKLIEELFVTNI 916
           I+   E Y   +E+Q  N+ F PVS+ P+P NM+P+ L W+GA VLAQIKL+EELFVT  
Sbjct: 777 IKTEFEAYGPILEQQASNDSFFPVSILPSPRNMDPAELIWKGASVLAQIKLVEELFVTTA 836

Query: 917 DWDVHGSRVLQHKCIFTY 934
           DWD+HGSR+LQHKCIFTY
Sbjct: 837 DWDMHGSRILQHKCIFTY 854

>Kwal_55.21250 s55 (749673..752000) [2328 bp, 775 aa] {ON} YOR141C
           (ARP8) - actin-related protein [contig 130] FULL
          Length = 775

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/826 (44%), Positives = 500/826 (60%), Gaps = 87/826 (10%)

Query: 118 GDVPSATASP---TPSVVMNGAADEKQEKDSKSAAGKKVPLHLLEKRRLGRIKAAEEFAK 174
           GD  +A  +P   TP++  +  A + ++ D +     KVP HLLEKRRLGR KAAE++A+
Sbjct: 28  GDYSTADQTPMSMTPALSSHSNASKVKKPDPQVKQNTKVPGHLLEKRRLGRQKAAEQYAQ 87

Query: 175 KLKQIGIEKVDSTTLPSTGGLKPLIVINQKNYSSDYIRKDDQIFALRERKFLRXXXXXXX 234
           K+K IGIEK D+  L   G  KPL +INQKNYSSDY+++DDQIFA+RERK LR       
Sbjct: 88  KMKTIGIEKRDNPLLHQLGLFKPLSLINQKNYSSDYLKRDDQIFAMRERKSLRNA----- 142

Query: 235 XXXXXXXXXXXXXXXXXXHTPEVATSTIPNEFTLKSXXXXXXXXXXXXXXQPGSESIKIG 294
                              T   +T  +P++   +S               PGS+S+KIG
Sbjct: 143 -------------------TASQSTPDMPDDDDQESVDGDSELNTIVI--HPGSKSLKIG 181

Query: 295 FATDETPLVIPNCVAVPHSGETPIGNAANLTRDQP---DQFLQFKEELQTSFKERMRHYK 351
           FATD  P  IP+CVAVP   ++  G        QP   +++ + K+ +Q  FKERMR+YK
Sbjct: 182 FATDVLPQSIPSCVAVPKRSQSLQGETK-----QPHDTEEYQETKDSIQQDFKERMRYYK 236

Query: 352 RRVQLSSYDQVNTFNETTKPEIIEDQNDPAKIAWRGQPDPQEGKTIYVGDEALLCLREHY 411
           R++  +S+D V  FN    PEII + ND  +I W  QP        Y G EA  CL  H+
Sbjct: 237 RKIIPNSHDIVVNFNSRVSPEIIPEHNDLHRIDWIDQP-----SRPYYGKEATRCLPSHF 291

Query: 412 MHRRPFGCSEGKYLFNLDEKRYTSLAALLCDVSRLLEHAIDKLLKKRDKDTEKDIKYKAV 471
             R PF     K  FN++   Y+SL  LL DV  LL+ A+ +   K D    +   YK V
Sbjct: 292 TVRHPFW----KGRFNIESPDYSSLQELLNDVCELLKFALSQ--PKIDVKPSQISNYKVV 345

Query: 472 LVIPDLFEKSHVETMIRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVA 531
           +V+PDL++K++VET IRLLL +L F AVAI+QESLA+CYG+GI  STCVV++GAT TK+A
Sbjct: 346 IVVPDLYDKAYVETFIRLLLVDLNFQAVAIIQESLASCYGAGIGESTCVVDIGATTTKIA 405

Query: 532 CVDEGIVVENSIINLNYGGDDISKLFAVLLLMSNFPYQEWDIDSIPGRMIAEHLKKECLT 591
           CVDEG+V ENSIINL+YGGDDI++LFA  LL SNFPYQ+ D+DS  G  + E LK++  T
Sbjct: 406 CVDEGLVNENSIINLDYGGDDITRLFARFLLESNFPYQDLDLDSPQGWSLVEQLKEKYTT 465

Query: 592 FQDADITTQLFNFIKRVPGLP-TEKIEFKTFDEVILAPLALFYPKIFSLLKPNKGKNLTN 650
           FQDAD+T QL+NFIKR+PG P  EK EFK FDEV+ AP+ LF+P +F LLK  +  N TN
Sbjct: 466 FQDADVTIQLYNFIKRIPGKPGAEKFEFKVFDEVMTAPMGLFFPHVFPLLK--EQNNPTN 523

Query: 651 PKLKYQLPDSRDLFTNKANNWKSLSEMDCATNTLYSDMVQESVLLDNLLGINSRREGPPK 710
             +K QLP S+D+FT K NN KS+S++ C     Y DM ++  +L  LL + S  E   +
Sbjct: 524 EYVKSQLPRSKDMFTCKDNNLKSVSQLACQKKNTYCDMGRDLDILQKLLNLPSEIE---E 580

Query: 711 DSGVGSETTELNLTALDKSVIQSITNATLSLE--PGKMASFYSNILIVGGSSNIPGFDTI 768
                S   E   TAL+K++I+SITNA +SL+    K A FYSNIL+VGGSS  P  D I
Sbjct: 581 YQSAASANVEPAYTALEKAIIESITNACVSLDNNHAKAAQFYSNILVVGGSSKFPSLDFI 640

Query: 769 LKDRINMWRPKLIALASFPNFYNELVKEIKDLETSAKXXXXXXXXXXXXXXXXXXXLNDD 828
           L DRIN+WRP+L+++ + P F+N++ K++K+ E + K                       
Sbjct: 641 LTDRINIWRPRLLSVNTLPTFHNQVSKQVKEFEQTNKLS--------------------- 679

Query: 829 DAPKEVPEVKETSSDAKEYELNEKIQKLIEERLEKYLSAIERQNGNEHFMPVSVTPAPHN 888
               E+ E +E  S  K      K+ K I+  L+ Y   ++   GNE   P++V PAP  
Sbjct: 680 ----EIKEEEELLSQKK------KLAKTIKMELQSYWEGVDALGGNESVFPINVLPAPRE 729

Query: 889 MNPSLLPWRGAGVLAQIKLIEELFVTNIDWDVHGSRVLQHKCIFTY 934
           M+P+LL W+G  V A++KLIEEL+V+  DWDV  SR+LQ+KCIF Y
Sbjct: 730 MDPALLTWKGGSVFARLKLIEELYVSANDWDVLNSRILQYKCIFDY 775

>SAKL0G03608g Chr7 complement(299907..302291) [2385 bp, 794 aa] {ON}
           similar to uniprot|Q12386 Saccharomyces cerevisiae
           YOR141C ARP8 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 794

 Score =  630 bits (1626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/835 (42%), Positives = 499/835 (59%), Gaps = 70/835 (8%)

Query: 108 GAVAAMETAVGDVPSATASPTPSVVMNGAADEKQEK-DSKSAAGKKVPLHLLEKRRLGRI 166
           GA+   +  VG       +P     +  A   K +K D+    GKKVP+HLLEKRRLGRI
Sbjct: 22  GALDEYDEEVGVSTGENGTPLSMTPVPPATSGKVKKPDTHIPPGKKVPMHLLEKRRLGRI 81

Query: 167 KAAEEFAKKLKQIGIEKVDSTTLPSTGGLKPLIVINQKNYSSDYIRKDDQIFALRERKFL 226
           KAAEEFAKKLK IGIEK D++ L  TG  KPL++INQKNYSSDY++KDDQIFA+RERK L
Sbjct: 82  KAAEEFAKKLKTIGIEKRDNSALQQTGLFKPLLLINQKNYSSDYLKKDDQIFAMRERKSL 141

Query: 227 RXXXXXXXXXXXXXXXXXXXXXXXXXHTPEVATSTIPNEFTLKSXXXXX-XXXXXXXXXQ 285
           R                          TPEV    IP E                     
Sbjct: 142 RNPNSGNGNGNTGNNAVSNA-------TPEV----IPEEEDNDDNDDAEGTDDLNTIVIH 190

Query: 286 PGSESIKIGFATDETPLVIPNCVAVPHSGETPIGNAANLTRDQPDQFLQFKEELQTSFKE 345
           PGS+ +KIGFATD  P  +P+C+A+P + +  + +       +P +F   K  +Q  FKE
Sbjct: 191 PGSKFLKIGFATDVLPQSVPSCIAIPRATKNSVRSPQ---IREPSEFDGLKSAIQQDFKE 247

Query: 346 RMRHYKRRVQLSSYDQVNTFNETTKPEIIEDQNDPAKIAWRGQPDPQEGKTIYVGDEALL 405
           RMR+YKR+V  +++D V  FN   +PE+I + ND  ++ W      Q G   + G+EA  
Sbjct: 248 RMRYYKRKVIPNAHDAVINFNSKVEPELIHEHNDLHRVEWI-----QNGSNQFYGEEATR 302

Query: 406 CLREHYMHRRPFGCSEGKYLFNLDEKRYTSLAALLCDVSRLLEHAIDKLLKKRDKDTEKD 465
           CL  H+  R PF        FN++   Y S   LL DV  LLE+ + +  +K D   ++ 
Sbjct: 303 CLPSHFTLRYPFARGS----FNVESPYYMSFQELLGDVQSLLEYCLKQ--EKIDVTKQQF 356

Query: 466 IKYKAVLVIPDLFEKSHVETMIRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGA 525
             YK VLVIPDL++K++VET I LLL ++ F AVAI+QESLAT YG+GIS STCVV++GA
Sbjct: 357 ANYKIVLVIPDLYDKNYVETFIHLLLVQMGFQAVAIIQESLATTYGAGISNSTCVVDIGA 416

Query: 526 TGTKVACVDEGIVVENSIINLNYGGDDISKLFAVLLLMSNFPYQEWDIDSIPGRMIAEHL 585
           T TK+ACVDEG V+ NS + L+YGGDDI++LF+  LL S FPY +WD+ +  G M+AE L
Sbjct: 417 TSTKIACVDEGTVLGNSAVTLDYGGDDITRLFSQFLLQSKFPYDDWDLSTPHGWMLAESL 476

Query: 586 KKECLTFQDADITTQLFNFIKRVPG-LPTEKIEFKTFDEVILAPLALFYPKIFSLLKPNK 644
           KKE  TFQDA++  QL+NFIKR PG    +K EFK FDEV+LAP+A+F+PKI SLL P K
Sbjct: 477 KKEFTTFQDANVAVQLYNFIKRTPGEANAQKYEFKVFDEVMLAPMAMFFPKILSLLNPQK 536

Query: 645 GKN---LTNPKLKYQLPDSRDLFTNKANNWKSLSEMDCATNTLYSDMVQESVLLDNLLGI 701
            +    +TN     Q P S+D++T + NN +S+S+ +C  N  Y DM ++  +L  +L +
Sbjct: 537 TQQEHYVTN-----QFPRSKDIYTLRDNNPRSISQRECHENKTYCDMTRDLDILQKILNL 591

Query: 702 NSRREGPPKDSGVGSETTELNLTALDKSVIQSITNATLSLEP--GKMASFYSNILIVGGS 759
               +    +S +  +    N+T L+K++++SITNA++SL+    ++ +FYSN+L+VGG 
Sbjct: 592 PDEID-EYSNSNLSKKHHHDNITPLEKAIVESITNASISLDNNMSRLGNFYSNLLVVGGG 650

Query: 760 SNIPGFDTILKDRINMWRPKLIALASFPNFYNELVKEIKDLETSAKXXXXXXXXXXXXXX 819
           S  P  D IL DRIN+WRP+L+++ +   FY ++ ++IKD E   K              
Sbjct: 651 SKFPSLDFILTDRINIWRPRLLSVNTISTFYKKVTQQIKDFEQENK-------------- 696

Query: 820 XXXXXLNDDDAPKEVPEVKETSSDAKEYELNEKIQKLIEERLEKYLSAIERQNGNEHFMP 879
                            V E +   +   L +K+ K+++  L+ Y  +++   GNE+  P
Sbjct: 697 -----------------VSEVTDPEQLATLKKKLLKMVKLELQSYWESVDALGGNENVFP 739

Query: 880 VSVTPAPHNMNPSLLPWRGAGVLAQIKLIEELFVTNIDWDVHGSRVLQHKCIFTY 934
           ++V P P +M+P++L W+G  VLA+IKL+EEL++T  DWDV GSR+LQ+KCIF Y
Sbjct: 740 INVLPPPRDMDPAVLTWKGGSVLARIKLVEELYITAKDWDVLGSRILQYKCIFDY 794

>TPHA0J02790 Chr10 complement(621474..624122) [2649 bp, 882 aa] {ON}
           Anc_5.477 YOR141C
          Length = 882

 Score =  631 bits (1627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/804 (42%), Positives = 495/804 (61%), Gaps = 62/804 (7%)

Query: 145 SKSAAGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKVDSTTLPSTGGLKPLIVINQK 204
           S      K+   +LE+RRLGR +AA  +A KL++ GIEK ++  + STG  +P+ ++NQK
Sbjct: 127 SNKPVSTKMSTSVLERRRLGRQRAAAAYAIKLQKTGIEKKENDNIQSTGLFRPIPLVNQK 186

Query: 205 NYSSDYIRKDDQIFALRERKFLRXXXXXXXXXXXXXXXXXXXXXXXXXHTPEVA------ 258
           N SSDY++ + QIFALRERK LR                         +TPEV+      
Sbjct: 187 NCSSDYLKTNSQIFALRERKVLRNNTNIININSGNNSNSTSGTTA---NTPEVSDLKNVN 243

Query: 259 ---TSTIPNEFTLKSXXXXXXXX--XXXXXXQPGSESIKIGFATDETPLVIPNCVAVP-H 312
                ++ +E  LK+                 PGS  +KIGFA D++PLVIPNCVA P +
Sbjct: 244 SESNVSLIDETILKNNPDNIVFDDPTTTIVIHPGSRYLKIGFAKDDSPLVIPNCVAFPKN 303

Query: 313 SGETPIGNAANLTRDQPDQFLQFKEELQTSFKERMRHYKRRVQLSSYDQVNTFNETTKPE 372
           S  +       +++++ D F   K ++Q SF++RMR+YKR++Q +S+++V +FN  +KPE
Sbjct: 304 SLYSENVEETIVSKEESDNFKTKKNQIQQSFRDRMRYYKRKIQNNSHERVRSFNIQSKPE 363

Query: 373 IIEDQNDPAKIAWRGQPDPQEGKTIYVGDEALLCLREHYMHRRPF--GCSEGKYLFNLDE 430
            +ED+ +  ++ W   PD      IY G+EA  C ++ ++ R PF  G S     FN+  
Sbjct: 364 KVEDKTEYNRVEWITNPD-----KIYYGEEASRCSKDAFIIRYPFVKGGS-----FNITS 413

Query: 431 KRYTSLAALLCDVSRLLEHAIDKLLKKRDKDTEKDIKYKAVLVIPDLFEKSHVETMIRLL 490
             Y SL  ++ D+S L E+A+ +   + +    +  KYK +LVIPD+FEKSH+ETM R+L
Sbjct: 414 PYYNSLPEIIGDISNLFEYALSQ--DRFNLKPSEYSKYKIILVIPDIFEKSHLETMFRVL 471

Query: 491 LSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIVVENSIINLNYGG 550
           L E+ F AVAI+QESLA  YG+GI  +TC+VN+GAT T+VAC+DEG V E+S+I L+YGG
Sbjct: 472 LKEMKFQAVAIMQESLAASYGAGIGGATCIVNIGATQTRVACIDEGTVSEHSLITLDYGG 531

Query: 551 DDISKLFAVLLLMSNFPYQEWDIDSIPGRMIAEHLKKECLTFQDADITTQLFNFIKRVPG 610
           DDI+KLF  LLL + FPYQ+ DI+S  G    E+LKK+ +TF+DA+IT QL+NFIK  PG
Sbjct: 532 DDITKLFLHLLLQNEFPYQDLDINSSHGWRQIENLKKQFVTFEDANITVQLYNFIKNKPG 591

Query: 611 LPTEKIEFKTFDEVILAPLALFYPKIFSLLKPNKGKNLTNPKLKYQLPDSRDLFTNKANN 670
              EK+EFK FDEVI APL LFYP+IF ++     K   N KL+ QLP S DL+T + ++
Sbjct: 592 AQAEKLEFKVFDEVINAPLGLFYPEIFRIMAEENEKRRVNKKLQDQLPPSTDLYTEERDD 651

Query: 671 WKSLSEMDCATNTLYSDMVQESVLLDNLLGINSRREGPPKDSGVGSETTELNLTALDKSV 730
           W+SLS++ C  N  YS    +  ++  LL  N   +     +   +E  E N T+LDK++
Sbjct: 652 WRSLSQVQCLDNDTYSGNDNDLDVITKLLNANLNLDDMDLINNDQNE-NEKNYTSLDKAI 710

Query: 731 IQSITNATLSLEPGKMASFYSNILIVGGSSNIPGFDTILKDRINMWRPKLIALASFPNFY 790
           IQSITNA ++++  KM  FY+NI++VGGSS+IP  D IL DRIN+WRP++++   FP+F+
Sbjct: 711 IQSITNAVVTMDTSKMTQFYNNIMVVGGSSSIPSLDFILTDRINIWRPRILSSREFPSFF 770

Query: 791 NELVKEIKDLETSAKXXXXXXXXXXXXXXXXXXXLNDDDAPKEVPEVKETSSDAKEYELN 850
             LVK++KD  T+ K                      ++ P+E  E ++           
Sbjct: 771 RNLVKQVKDFNTANKS---------------------NNRPEEGEEEQKKG--------- 800

Query: 851 EKIQKLIEERLEKYLSAIERQNGNEHFMPVSVTPAPHNMNPSLLPWRGAGVLAQIKLIEE 910
             I +LI+  L+KY   +E QN NEH +PVSV P P +M+PS+L W+GA VL Q+KLIEE
Sbjct: 801 --IAELIKTELKKYKDNLESQNANEHLLPVSVLPPPADMDPSVLNWKGASVLGQLKLIEE 858

Query: 911 LFVTNIDWDVHGSRVLQHKCIFTY 934
           L+VTN DWD+ GSR+LQ+KC+F Y
Sbjct: 859 LYVTNADWDMLGSRILQYKCLFPY 882

>KLTH0F14960g Chr6 (1222278..1224605) [2328 bp, 775 aa] {ON} similar
           to uniprot|Q12386 Saccharomyces cerevisiae YOR141C ARP8
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin- remodeling enzyme
           complexes
          Length = 775

 Score =  624 bits (1609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/824 (42%), Positives = 488/824 (59%), Gaps = 83/824 (10%)

Query: 118 GDVPSATASP---TPSVVMNGAADEKQEKDSKSAAGKKVPLHLLEKRRLGRIKAAEEFAK 174
           GD  +A  +P   TP++  N  A + ++ D  +    KVP HLLEKRRLGR KAAE++A+
Sbjct: 28  GDYSTADQTPLSMTPALSSNPNASKVKKPDPHAKQQTKVPGHLLEKRRLGRQKAAEQYAQ 87

Query: 175 KLKQIGIEKVDSTTLPSTGGLKPLIVINQKNYSSDYIRKDDQIFALRERKFLRXXXXXXX 234
           K+K IGIEK D+  L   G  KPL +INQKNYSSDY+++DDQIFA+RERK LR       
Sbjct: 88  KMKTIGIEKRDNPLLHQLGLFKPLSLINQKNYSSDYLKRDDQIFAMRERKSLRNANANQ- 146

Query: 235 XXXXXXXXXXXXXXXXXXHTPEVATSTIPNEFTLKSXXXXXXXXXXXXXXQPGSESIKIG 294
                                  AT  +P +   +S               PGS ++KIG
Sbjct: 147 -----------------------ATPDMPEDDDQESVDGESDAQTIVI--HPGSRNLKIG 181

Query: 295 FATDETPLVIPNCVAVPHSGETPIGNAANLTRDQPDQFLQFKEELQTSFKERMRHYKRRV 354
            AT+  P  IP CVAVP    T   ++    +   ++++  KE +Q  FKERMR+YKR+V
Sbjct: 182 LATEVLPQSIPCCVAVPKRPRT--SDSTPEPQVDEEEYISAKESIQQDFKERMRYYKRKV 239

Query: 355 QLSSYDQVNTFNETTKPEIIEDQNDPAKIAWRGQPDPQEGKTIYVGDEALLCLREHYMHR 414
             +S+D    FN    PE I + ND  ++ W      Q+    Y G +A  CL  H+  R
Sbjct: 240 IPNSHDIAVNFNARVTPEAIPEHNDLHRVDWI-----QDASKCYYGKDATRCLPSHFTVR 294

Query: 415 RPFGCSEGKYLFNLDEKRYTSLAALLCDVSRLLEHAIDKLLKKRDKDTEKDIKYKAVLVI 474
            PF     K  FN++   Y SL  LL DVS LL+ A+ +   K D    +   YK V+V+
Sbjct: 295 HPFW----KGRFNIESPDYGSLQELLVDVSELLKFALSQ--PKIDVRPSQIPNYKVVIVV 348

Query: 475 PDLFEKSHVETMIRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVD 534
           PD F+K++VET IRLL+++L F AVA++QESLA+CYG+GI  STCVV++GAT TK+ACVD
Sbjct: 349 PDAFDKAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVD 408

Query: 535 EGIVVENSIINLNYGGDDISKLFAVLLLMSNFPYQEWDIDSIPGRMIAEHLKKECLTFQD 594
           EG+V++NS+I L+YGGDDI+KLFA  LL SNFPYQ+ D++S  G  + E LK++  TFQD
Sbjct: 409 EGLVIDNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEKYATFQD 468

Query: 595 ADITTQLFNFIKRVPGLP-TEKIEFKTFDEVILAPLALFYPKIFSLLKPNKGKNL-TNPK 652
           AD+T QL+NFIKR+P  P  EK EFK FDEV+ AP+ LF+P I  LL   K KN+  N  
Sbjct: 469 ADVTIQLYNFIKRIPNKPGAEKFEFKVFDEVMTAPMGLFFPHILRLL---KDKNVPVNKY 525

Query: 653 LKYQLPDSRDLFTNKANNWKSLSEMDCATNTLYSDMVQESVLLDNLLGINSRREGPPKDS 712
           +  QLP S+D+FT K NN KS+S++ C   T Y DM ++  +L  LL + S  E     +
Sbjct: 526 VTSQLPRSKDMFTCKDNNPKSVSQLACQKKTTYCDMHRDLDILQKLLNLPSEIEEYQSST 585

Query: 713 GVGSETTELNLTALDKSVIQSITNATLSLE--PGKMASFYSNILIVGGSSNIPGFDTILK 770
               E      T L+K++++SITNA +SL+    K A+FYSNIL+VGGSS     D IL 
Sbjct: 586 CANLEPA---YTPLEKAIVESITNACVSLDNNHSKAANFYSNILVVGGSSKFSSLDFILT 642

Query: 771 DRINMWRPKLIALASFPNFYNELVKEIKDLETSAKXXXXXXXXXXXXXXXXXXXLNDDDA 830
           DRIN+WRP+L+++ + P F N++ K++K+ E + K                         
Sbjct: 643 DRINIWRPRLLSVNTLPTFQNQVSKQVKEFEQTQKLS----------------------- 679

Query: 831 PKEVPEVKETSSDAKEYELNEKIQKLIEERLEKYLSAIERQNGNEHFMPVSVTPAPHNMN 890
             E+ + +E ++  K      K+ K I+  L+ Y   ++   GNE   P +V PAP  M+
Sbjct: 680 --EIKDEEELAAQKK------KLAKTIKVELQSYWEGVDALGGNESVFPANVLPAPREMD 731

Query: 891 PSLLPWRGAGVLAQIKLIEELFVTNIDWDVHGSRVLQHKCIFTY 934
           P+LL W+G  V A++KLIEEL+V+  DWD+ GSR+LQ+KCIF Y
Sbjct: 732 PALLTWKGGSVFARLKLIEELYVSESDWDILGSRILQYKCIFDY 775

>AFR135W Chr6 (680340..682715) [2376 bp, 791 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR141C (ARP8)
          Length = 791

 Score =  612 bits (1578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/821 (41%), Positives = 497/821 (60%), Gaps = 78/821 (9%)

Query: 127 PTPSVVMNGAADEKQEKDSKSAAGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKVDS 186
           P P+    G   + +   + +  GKKVP HLLEKRRLGRIKAAEEFA+KLK+IGIEK D+
Sbjct: 36  PIPTT--EGKVSKPETAGAAAGQGKKVPQHLLEKRRLGRIKAAEEFARKLKKIGIEKQDN 93

Query: 187 TTLPSTGGLKPLIVINQKNYSSDYIRKDDQIFALRERKFLRXXXXXXXXXXXXXXXXXXX 246
             +  TG  +PL +INQKNYSSDY+RKDDQIF++RERK LR                   
Sbjct: 94  LHISQTGLFRPLPLINQKNYSSDYLRKDDQIFSMRERKSLRSGNVNPVNSS--------- 144

Query: 247 XXXXXXHTPEVATSTIPNEFTLKSXX--XXXXXXXXXXXXQPGSESIKIGFATDETPLVI 304
                   P +      ++  L                   PGS S+KIG +TD  PL +
Sbjct: 145 ------QPPTLLAEAGEDDLKLNGDEDGIDDTEDANTIVIHPGSRSLKIGLSTDVFPLSV 198

Query: 305 PNCVAVPHSGETPIGNAANLTRDQPDQFLQFKEELQTSFKERMRHYKRRVQLSSYDQVNT 364
           P+CVAV       +       +D+   F++  +++Q+ FKERMR+YKR++  +S++QV +
Sbjct: 199 PSCVAVARRASQRLEPQQRYDKDE--DFMEHLQQIQSDFKERMRYYKRKIIPNSHEQVLS 256

Query: 365 FNETTKPEIIEDQNDPAKIAWRGQPDPQEGKTIYVGDEALLCLREHYMHRRPFGCSEGKY 424
           +N   +PE I + ND  +I W    D  EG TIY G+ A  CL E+++ R PF  S G  
Sbjct: 257 YNSRAQPEKIPEHNDLHRIEWIK--DAPEG-TIYYGEGAERCLPENFVIRYPF--SNGA- 310

Query: 425 LFNLDEKRYTSLAALLCDVSRLLEHAIDKLLKKRDKDTEKDIKYKAVLVIPDLFEKSHVE 484
            FN++   Y+SL  LL DV++L+  A+ +   K      +   YK +L+IPDLFEK++VE
Sbjct: 311 -FNVECPDYSSLQELLNDVTKLITFALSE--TKLGISRSQFPNYKVILIIPDLFEKNYVE 367

Query: 485 TMIRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIVVENSII 544
            MIRLLLSE+ F AVA++QESLATCYG+G+S STCV+++GA+ TK++CVDEG V++NS I
Sbjct: 368 QMIRLLLSEMNFQAVALIQESLATCYGAGLSNSTCVIDIGASETKISCVDEGQVIQNSCI 427

Query: 545 NLNYGGDDISKLFAVLLLMSNFPYQEWDIDSIPGRMIAEHLKKECLTFQDADITTQLFNF 604
            L+YGGDDI++LF  LLL SNFPY +W++++  G ++AE LKK  +TFQDAD+  QLFNF
Sbjct: 428 RLSYGGDDITRLFVELLLQSNFPYPDWNLNTRQGWILAEQLKKTHITFQDADVAVQLFNF 487

Query: 605 IKRVPGLP-TEKIEFKTFDEVILAPLALFYPKIFSLLKPNKGKNLTNPKLKYQLPDSRDL 663
            KR P +P  EK EFK F+EV+++P+A FYP+I S LKP       N  +  QLP+SRD 
Sbjct: 488 FKREPSVPGAEKFEFKLFNEVMISPMAYFYPQILSFLKPATS---YNKYMAQQLPESRDP 544

Query: 664 FTNKANNWKSLSEMDCATNTLYSDMVQESVLLDNLLGINSRRE----GPPKDSGVGSETT 719
           +T K +N KS+++    T  +Y+D+ ++  ++  L+ +N   E    GP + +   +  T
Sbjct: 545 YTYKPDNPKSIAQESAFTGKVYTDINKDLDIIRKLVSVNDEVEALTSGPSERTSGDTIKT 604

Query: 720 EL----NLTALDKSVIQSITNATLSL--EPGKMASFYSNILIVGGSSNIPGFDTILKDRI 773
                 N T LDK++I+S+T A++ L     K+ +FYSN+L++GGSS +PG D IL DRI
Sbjct: 605 NTRRASNYTPLDKAIIESVTTASVLLGDNMSKLVNFYSNLLVIGGSSKVPGLDLILTDRI 664

Query: 774 NMWRPKLIALASFPNFYNELVKEIKDLETSAKXXXXXXXXXXXXXXXXXXXLNDDDAPKE 833
           N+WRP+L+++++ P  Y ++ + +K +E   K                          K 
Sbjct: 665 NIWRPRLLSVSTLPVVYKKVSEMVKQVENEIK--------------------------KN 698

Query: 834 VPEVKETSSDAKEYELNEKIQKLIEERLEKYLSAIERQNGNEHFMPVSVTPAPHNMNPSL 893
            PE +E  + ++     +K+ K I+  LE Y  +++     EH  P++V P P  M+PS+
Sbjct: 699 NPESEEEIAQSR-----KKLIKSIKIELENYWESVD---PYEHVYPIAVLPPPREMDPSM 750

Query: 894 LPWRGAGVLAQIKLIEELFVTNIDWDVHGSRVLQHKCIFTY 934
           L W+G  V  +IKL EEL++T +DW++ GSR+L++KCIF Y
Sbjct: 751 LTWKGGSVFGRIKLCEELYITAMDWEMLGSRILKYKCIFDY 791

>Ecym_2311 Chr2 (604942..607269) [2328 bp, 775 aa] {ON} similar to
           Ashbya gossypii AFR135W
          Length = 775

 Score =  595 bits (1535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/799 (41%), Positives = 480/799 (60%), Gaps = 70/799 (8%)

Query: 147 SAAGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKVDSTTLPSTGGLKPLIVINQKNY 206
           S   KKVP HLLEKRRLGRIKAAEEFA+KLK+IGIEK D+  +  TG  +   +INQKNY
Sbjct: 36  STQSKKVPQHLLEKRRLGRIKAAEEFARKLKKIGIEKQDNIHISQTGLFRVHSLINQKNY 95

Query: 207 SSDYIRKDDQIFALRERKFLRXXXXXXXXXXXXXXXXXXXXXXXXXHTPEVATSTIPNEF 266
           SSDY+RKDDQIF++RERK LR                           P+V    +    
Sbjct: 96  SSDYLRKDDQIFSMRERKNLRSGNVNSITNSSQPLIA----------LPDVQDDEVKTNG 145

Query: 267 TLKSXXXXXXXXXXXXXXQPGSESIKIGFATDETPLVIPNCVAVPHSGETPIGNAANLTR 326
                              PGS S+KIG +TD  PL IP+CVA+  S +  + +      
Sbjct: 146 --DEDGLDDTADTNTIVIHPGSRSLKIGLSTDVFPLSIPSCVAIARSEQVEVPSQPRYDN 203

Query: 327 DQPDQFLQFKEELQTSFKERMRHYKRRVQLSSYDQVNTFNETTKPEIIEDQNDPAKIAWR 386
           D+  +F+   +++Q+ FKERMR+YKR++  +S++QV ++N   +PE I + ND  +I W 
Sbjct: 204 DE--EFMGNLQQIQSDFKERMRYYKRKIIPNSHEQVLSYNSKCQPEKIPEHNDLHRIEWI 261

Query: 387 GQPDPQEGKTIYVGDEALLCLREHYMHRRPFGCSEGKYLFNLDEKRYTSLAALLCDVSRL 446
            + D      +Y G+ A  CL E ++ R PF        FN+    Y SL  LL DV  L
Sbjct: 262 KKSDA--STKVYYGEYAERCLPEGFLLRYPFANGS----FNVKSPNYNSLQELLNDVVNL 315

Query: 447 LEHAIDKLLKKRDKDTEKDIKYKAVLVIPDLFEKSHVETMIRLLLSELPFNAVAIVQESL 506
           +  A+ +   K +    +   Y  VL+IPDLFEKS+VE MIRLL+SE+ F AVA++QESL
Sbjct: 316 ITFALSE--TKLNISKSQFSSYNVVLIIPDLFEKSYVEQMIRLLISEMDFQAVALIQESL 373

Query: 507 ATCYGSGISTSTCVVNVGATGTKVACVDEGIVVENSIINLNYGGDDISKLFAVLLLMSNF 566
           A+CYG+G+S STCV+++G + TK++CVDEG V++NS I L+YGGDDI+KLFA LLL SNF
Sbjct: 374 ASCYGAGLSNSTCVIDIGGSETKISCVDEGQVIQNSCIKLSYGGDDITKLFAELLLQSNF 433

Query: 567 PYQEWDIDSIPGRMIAEHLKKECLTFQDADITTQLFNFIKRVPGLP-TEKIEFKTFDEVI 625
           PY++W++++  G ++AE LKK  +TFQDAD+  QLFNF KR P +   EK EFK F+EV+
Sbjct: 434 PYEDWNLNTRQGWLLAEQLKKNHITFQDADVAVQLFNFFKRNPNISGAEKYEFKLFNEVM 493

Query: 626 LAPLALFYPKIFSLLKPNKGKNLTNPKLKYQLPDSRDLFTNKANNWKSLSEMDCATNTLY 685
           ++P+A FYP+I +LLKP       N  ++ QLP SRD +T K ++ +S+S +   +   Y
Sbjct: 494 VSPMAYFYPQILALLKPPVE---VNKYVQQQLPPSRDPYTCKPDDPQSVSNLGSLSGKWY 550

Query: 686 SDMVQESVLLDNLLGINSRREGPPKDSGVGS------ETTE--LNLTALDKSVIQSITNA 737
           ++M ++  ++  L+ I  + E    +S  G+      E TE   N   LDK++I+S+TNA
Sbjct: 551 TEMSKDLDIVRKLISITDKVEALSANSSDGTASDTIVENTEEVSNYMPLDKAIIESVTNA 610

Query: 738 TLSL--EPGKMASFYSNILIVGGSSNIPGFDTILKDRINMWRPKLIALASFPNFYNELVK 795
            + L     K+ +FYSN+LIVGGSS +PG D IL DRIN+WRP+L+++++ P  Y ++  
Sbjct: 611 AVLLGDNMSKLTNFYSNLLIVGGSSKVPGLDLILTDRINIWRPRLLSVSTLPVIYKKISD 670

Query: 796 EIKDLETSAKXXXXXXXXXXXXXXXXXXXLNDDDAPKEVPEVKETSSDAKEYELNEKIQK 855
            +K +E+  K                    N+ ++ +E+ + +            +K+ K
Sbjct: 671 MVKQVESEIKK-------------------NNVESEEEIQQSR------------KKLIK 699

Query: 856 LIEERLEKYLSAIERQNGNEHFMPVSVTPAPHNMNPSLLPWRGAGVLAQIKLIEELFVTN 915
            I+  LE Y  +++     EH  P++V P P  M+PS+L W+G  V  +IKL EEL++T 
Sbjct: 700 SIKIELENYWESVDPY---EHVYPITVLPPPREMDPSMLTWKGGSVFGRIKLCEELYITE 756

Query: 916 IDWDVHGSRVLQHKCIFTY 934
           +DW++ GSR+L++KCIF Y
Sbjct: 757 MDWEMLGSRILKYKCIFDY 775

>KLLA0E03213g Chr5 complement(299014..301380) [2367 bp, 788 aa] {ON}
           similar to uniprot|Q12386 Saccharomyces cerevisiae
           YOR141C ARP8 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 788

 Score =  556 bits (1432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/840 (39%), Positives = 480/840 (57%), Gaps = 91/840 (10%)

Query: 121 PSATASPTPSVVMNGAADEKQEKDSKSAAGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIG 180
           PS   S  PS      +D K  KD  S   KKVP HLLEKRRLGRIKAAEEFAKKLK IG
Sbjct: 11  PSKEPSKEPSKEPLLGSDGKISKDIPS---KKVPQHLLEKRRLGRIKAAEEFAKKLKIIG 67

Query: 181 IEKVDSTTLPSTGGLKPLIVINQKNYSSDYIRKDDQIFALRERKFLRXXXXXXXXXXXXX 240
           IE+ ++  +     LKP+ VINQKNYSS+Y++ DDQIF +RERK LR             
Sbjct: 68  IERQENEHIAQPITLKPVSVINQKNYSSNYLKNDDQIFYMRERKHLRQQGQTGGSSSAPA 127

Query: 241 XXXXXXXXXXXXHTPEVATSTIPNEFTLKSXXXXXXXXXXXXXXQPGSESIKIGFATDET 300
                        TP +    + +   ++                PGS  IKIG   D  
Sbjct: 128 AGIG---------TPALDDDNMADSNAIEDDELDSIII------HPGSSFIKIGPNYDIF 172

Query: 301 PLVIPNCVAVPHSGETPIGNAANLTRDQPDQFLQFKEELQTSFKERMRHYKRRVQLSSYD 360
           P  +PN VAVP  G T      +++ ++   F Q K+++Q  FKERMR+YKRR+  +S +
Sbjct: 173 PQQVPNLVAVPTHGGTVPSPQEDISNNE--IFQQLKDDIQFDFKERMRYYKRRIMPNSTE 230

Query: 361 QVNTFNETTKPEIIEDQNDPAKIAWRGQPDPQEGKTIYVGDEALLCLREHYMHRRPFGCS 420
           Q   FN  + PE++ D ND  +I W      ++    Y G +A  CL   +  R PF   
Sbjct: 231 QAAAFNAKSDPELVPDLNDFGRIEWI-----KDRSKSYYGHDATQCLPSDFKLRSPFLNG 285

Query: 421 EGKYLFNLDEKRYTSLAALLCDVSRLLEH--AIDKLLKKRDKDTEKDIKYKAVLVIPDLF 478
                FNL+E  Y S   +L DV +L+    A++K+  +R++ +     Y+ VL++PDLF
Sbjct: 286 S----FNLNEPNYNSFQEILFDVEQLIVQSLAMEKIGIERNQFS----NYRVVLIVPDLF 337

Query: 479 EKSHVETMIRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIV 538
           +K+ VE+MI LLL EL F ++A++QESLA+CYG+G+S STCV+++GA  TK+ACVD+G+V
Sbjct: 338 DKTFVESMIHLLLIELDFQSIALIQESLASCYGAGLSNSTCVIDIGAKQTKIACVDDGVV 397

Query: 539 VENSIINLNYGGDDISKLFAVLLLMSNFPYQEWDIDSIPGRMIAEHLKKECLTFQDADIT 598
           V+NS + LNYGGDDI++LFA +LL + FPY +W+I+   G  +AE LKK+C+TFQDADI 
Sbjct: 398 VKNSALRLNYGGDDITRLFAHMLLQNKFPYADWNINEPNGWTLAETLKKQCITFQDADIA 457

Query: 599 TQLFNFIKRVP----GLPTEKIEFKTFDEVILAPLALFYPKIFSLLKPNKGKNLTNPKLK 654
            QL++FIKR P       + K E+K FDEV+ AP+ +F+P IF ++KP + K   N  + 
Sbjct: 458 IQLYSFIKRDPYARKYTQSHKYEYKLFDEVMCAPMGIFFPDIFEVIKPKQHK--PNEYVI 515

Query: 655 YQLPDSRDLFTNKANNWKSLSEMDCAT--NTLYS------DMVQESVLLDNLLGI---NS 703
            Q P S+D++T K N+ KSL++M C       YS      D+VQ+ + LD        + 
Sbjct: 516 RQCPRSKDIYTLKPNDTKSLTQMLCIQEPTKWYSNLSRDIDIVQKLLNLDTDDLDEQNDD 575

Query: 704 RREGPPKDSGVGSETTELNL-------TALDKSVIQSITNATLSL--EPGKMASFYSNIL 754
              G  +++ +  E  ++NL         L+K++I+SITNA++ L     K+   YSNIL
Sbjct: 576 ESAGSKEETQINDEIEDINLRQYNNLSMPLEKAIIESITNASMLLGDNMSKLNVLYSNIL 635

Query: 755 IVGGSSNIPGFDTILKDRINMWRPKLIALASFPNFYNELVKEIKDLETSAKXXXXXXXXX 814
           IVGGSS IP  D IL DRIN+WRPKL+++++      ++ + IK  ET  K         
Sbjct: 636 IVGGSSKIPALDFILTDRINIWRPKLLSISALSTLMEKIGEVIKSYETDNKLDL------ 689

Query: 815 XXXXXXXXXXLNDDDAPKEVPEVKETSSDAKEYELNEKIQKLIEERLEKYLSAIERQNGN 874
                                   E +         +K+ KLI+  +E Y  +++  + +
Sbjct: 690 ------------------------EPTDPQAAIAYKKKLSKLIKAEIEAYWDSLQTLHSD 725

Query: 875 EHFMPVSVTPAPHNMNPSLLPWRGAGVLAQIKLIEELFVTNIDWDVHGSRVLQHKCIFTY 934
           +  +P+++ P PH+M+PS+L W+G  V ++IKL+EEL +T  DW++ G+R+LQ+KCIF Y
Sbjct: 726 DDLLPINILPPPHDMDPSMLTWKGGSVFSKIKLLEELNITKQDWNMLGNRILQYKCIFEY 785

>TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.448
           YPR034W
          Length = 438

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 42/79 (53%), Gaps = 1/79 (1%)

Query: 483 VETMIRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIVVENS 542
           VE    L L++L   A+ IV E LA     G S S  V++VGA GT V  + +G VV + 
Sbjct: 113 VENYFDLALNKLQVPALQIVVEPLAVALAMGKS-SALVIDVGARGTTVTPIVDGTVVRSG 171

Query: 543 IINLNYGGDDISKLFAVLL 561
           ++   +GGD +    A LL
Sbjct: 172 VMKSRFGGDFLDYQVAKLL 190

>CAGL0K05335g Chr11 (521914..523503) [1590 bp, 529 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034w ARP7
           Actin-like protein
          Length = 529

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 43/85 (50%), Gaps = 5/85 (5%)

Query: 471 VLVIPDL----FEKSHVETMIRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGAT 526
           V+ +P +     E   VE  + L   +L    + IV E L     +G S+S  V++VGAT
Sbjct: 119 VITLPSMTNRELETKIVENYMELAFEKLKVPVLQIVVEPLGIMLSTGKSSS-LVIDVGAT 177

Query: 527 GTKVACVDEGIVVENSIINLNYGGD 551
           G  V  + +G ++ NSI+   + GD
Sbjct: 178 GCTVTPIIDGTILRNSIVKSRFAGD 202

>Suva_16.364 Chr16 (646188..647630) [1443 bp, 480 aa] {ON} YPR034W
           (REAL)
          Length = 480

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 41/77 (53%), Gaps = 4/77 (5%)

Query: 475 PDLFEKSHVETMIRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVD 534
           PD+   S +E    L   +L      IV E LA     G S S  V+++GA+G  V  + 
Sbjct: 115 PDM---SILERYYELAFDKLKVPVFQIVIEPLAIALSMGKS-SAFVIDMGASGCNVTPII 170

Query: 535 EGIVVENSIINLNYGGD 551
           +GIVV+N+++   +GGD
Sbjct: 171 DGIVVKNAVVRSKFGGD 187

>ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [1128
           bp, 375 aa] {ON} uniprot|Q2HWE7 Zygosaccharomyces rouxii
           ACT1 Actin
          Length = 375

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 81/187 (43%), Gaps = 3/187 (1%)

Query: 480 KSHVETMIRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIVV 539
           KS+ E M +++       A  +  +++ + Y SG  T+  V++ G   T V  +  G  +
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSG-RTTGIVLDSGDGVTHVVPIYAGFSM 171

Query: 540 ENSIINLNYGGDDISKLFAVLLLMSNFPYQEWDIDSIPGRMIAEHLKKECLTFQDADITT 599
            ++I+ ++  G D++     +L    + +       I  R I E L    L F+    T 
Sbjct: 172 PHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIV-RDIKEKLCYVALDFEQEMQTA 230

Query: 600 QLFNFIKRVPGLPTEKIEFKTFDEVILAPLALFYPKIFSLLKPNKGKNLTNPKLKYQLPD 659
              + +++   LP  ++     +E   AP ALF+P + SL      +   N  +K  +  
Sbjct: 231 AQSSSVEKSYELPDGQV-ITIGNERFRAPEALFHPSVLSLESSGVDQTTYNSIMKCDVDV 289

Query: 660 SRDLFTN 666
            +DL+ N
Sbjct: 290 RKDLYGN 296

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/75 (22%), Positives = 36/75 (48%), Gaps = 8/75 (10%)

Query: 857 IEERLEKYLSAIERQNGNEHFMPVSVTPAPHNMNPSLLPWRGAGVLAQIKLIEELFVTNI 916
           I ER++K ++A+   +     M V +   P         W G  +LA +   ++++++  
Sbjct: 309 IAERMQKEITALAPSS-----MKVKIIAPPERKYSV---WIGGSILASLTTFQQMWISKQ 360

Query: 917 DWDVHGSRVLQHKCI 931
           ++D  G  ++ HKC 
Sbjct: 361 EYDESGPSIVHHKCF 375

>NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 43/187 (22%), Positives = 81/187 (43%), Gaps = 3/187 (1%)

Query: 480 KSHVETMIRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIVV 539
           KS+ E M +++       A  +  +++ + Y SG  T+  V++ G   T V  +  G  +
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSG-RTTGIVLDSGDGVTHVVPIYAGFSL 171

Query: 540 ENSIINLNYGGDDISKLFAVLLLMSNFPYQEWDIDSIPGRMIAEHLKKECLTFQDADITT 599
            ++I+ ++  G D++     +L    + +       I  R I E L    L F+    T 
Sbjct: 172 PHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIV-RDIKEKLCYVALDFEQEMQTA 230

Query: 600 QLFNFIKRVPGLPTEKIEFKTFDEVILAPLALFYPKIFSLLKPNKGKNLTNPKLKYQLPD 659
              + I++   LP  ++     +E   AP ALF+P I SL      +   N  +K  +  
Sbjct: 231 AQSSSIEKSYELPDGQV-ITIGNERFRAPEALFHPSILSLESAGIDQTTYNSIMKCDVDV 289

Query: 660 SRDLFTN 666
            ++L+ N
Sbjct: 290 RKELYGN 296

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/75 (22%), Positives = 36/75 (48%), Gaps = 8/75 (10%)

Query: 857 IEERLEKYLSAIERQNGNEHFMPVSVTPAPHNMNPSLLPWRGAGVLAQIKLIEELFVTNI 916
           I ER++K ++A+   +     M V +   P         W G  +LA +   ++++++  
Sbjct: 309 IAERMQKEITALAPSS-----MKVKIIAPPERKYSV---WIGGSILASLTTFQQMWISKQ 360

Query: 917 DWDVHGSRVLQHKCI 931
           ++D  G  ++ HKC 
Sbjct: 361 EYDESGPSIVHHKCF 375

>YPR034W Chr16 (639525..640958) [1434 bp, 477 aa] {ON}
           ARP7Component of both the SWI/SNF and RSC chromatin
           remodeling complexes; actin-related protein involved in
           transcriptional regulation
          Length = 477

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 41/77 (53%), Gaps = 4/77 (5%)

Query: 475 PDLFEKSHVETMIRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVD 534
           PD+   + +E    L   +L      IV E LA     G S S  V+++GA+G  V  + 
Sbjct: 115 PDM---AILERYYELAFDKLNVPVFQIVIEPLAIALSMGKS-SAFVIDIGASGCNVTPII 170

Query: 535 EGIVVENSIINLNYGGD 551
           +GIVV+N+++   +GGD
Sbjct: 171 DGIVVKNAVVRSKFGGD 187

>Smik_16.278 Chr16 (516276..517706) [1431 bp, 476 aa] {ON} YPR034W
           (REAL)
          Length = 476

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 37/69 (53%), Gaps = 1/69 (1%)

Query: 483 VETMIRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIVVENS 542
           +E    L   +L      IV E LA     G S S  V+++GA+G  V  + +GIVV+N+
Sbjct: 120 LERYYELAFDKLKVPVFQIVIEPLAIALSMGKS-SAFVIDMGASGCNVTPIIDGIVVKNA 178

Query: 543 IINLNYGGD 551
           ++   +GGD
Sbjct: 179 VVRSKFGGD 187

>Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}
           complement(26673..28139) [1467 nt, 489 aa]
          Length = 488

 Score = 41.2 bits (95), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 39/74 (52%), Gaps = 1/74 (1%)

Query: 478 FEKSHVETMIRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGI 537
            E   +E   ++   +     + IV ESL+   G G  TS  V+++  +G+ V  + +G+
Sbjct: 116 IENKVIEQYCKIAFEKFKIPYLQIVNESLSISLGLGKKTS-LVIDISGSGSSVTPIVDGV 174

Query: 538 VVENSIINLNYGGD 551
           +++N I+   YGGD
Sbjct: 175 IIKNGIVKSKYGGD 188

>Skud_16.321 Chr16 (604148..605587) [1440 bp, 479 aa] {ON} YPR034W
           (REAL)
          Length = 479

 Score = 40.4 bits (93), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 40/77 (51%), Gaps = 4/77 (5%)

Query: 475 PDLFEKSHVETMIRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVD 534
           PD+   S +     L   +L      IV E LA     G S S  V+++GA+G  V  + 
Sbjct: 115 PDM---SILRRYYELAFDKLNVPVFQIVIEPLAIALSMGKS-SAFVIDMGASGCNVTPII 170

Query: 535 EGIVVENSIINLNYGGD 551
           +GIVV+N+++   +GGD
Sbjct: 171 DGIVVKNAVVRSKFGGD 187

>NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 40.4 bits (93), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 52/114 (45%), Gaps = 6/114 (5%)

Query: 442 DVSRLLEHAIDKLLKKRDKDTEKDIKYKAVLVIPDLFEKSHVETMIRLLLSELPFNAVAI 501
           D+  L  H  + +LK  D D     ++  ++    L  + + + M  +   +  F AV I
Sbjct: 87  DMETLWSHTFNDILKINDFD-----EHPLLITEAPLNPEKNRDKMCEVFFEKFDFAAVYI 141

Query: 502 VQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIVVENSIINLNYGGDDISK 555
              S  + Y SG  T+ CV++ G        + EG  + +SI  ++ GG D+++
Sbjct: 142 ANPSTLSLYASG-RTTGCVLDCGDGYCSSVPIYEGFALPSSIRRIDVGGRDVTE 194

>KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]
           {ON} similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 380

 Score = 39.7 bits (91), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query: 480 KSHVETMIRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIVV 539
           K + E M  LL       AV +  +++ + Y SG  T+ CV++ G   +    V +G  +
Sbjct: 119 KKNREQMCELLFETFSVPAVYVSIQAVLSLYASG-RTTGCVLDSGDGCSHAVPVYDGYTL 177

Query: 540 ENSIINLNYGGDDISKLFAVLL 561
            ++I  ++  G DIS+L  VL+
Sbjct: 178 PSAIRRIDIAGRDISELLQVLI 199

>Kpol_181.2 s181 complement(1914..3305) [1392 bp, 463 aa] {ON}
           complement(1914..3305) [1392 nt, 464 aa]
          Length = 463

 Score = 39.3 bits (90), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 59/118 (50%), Gaps = 5/118 (4%)

Query: 482 HVETMIRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIVVEN 541
           H+E +   +   L  N+   +  SLA+ Y      ++C++++G T T +  V + + +++
Sbjct: 123 HIEKITHFVFEALQLNSFITLPVSLASNYAMISLQNSCIIDIGETHTDIVPVIDYLQMDH 182

Query: 542 SIINLNYGGDDIS-KLFAVLLLMSNFPYQEWDI-DSIPGRMIAEHLKKE-CLTFQDAD 596
              ++ YGG  I+  L  +L  +S  P Q  D+  S    +++E  KKE    FQ +D
Sbjct: 183 IASSIKYGGQTINDSLSKILTDLS--PEQIEDLKKSAIFEVLSEDAKKESAFKFQSSD 238

>NCAS0A14720 Chr1 (2903450..2904907) [1458 bp, 485 aa] {ON}
           Anc_7.448 YPR034W
          Length = 485

 Score = 39.3 bits (90), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 46/90 (51%), Gaps = 8/90 (8%)

Query: 467 KYKAVLVIPDLFEKSHVETMIRLLLSELPFN-----AVAIVQESLATCYGSGISTSTCVV 521
           +Y  V+ IP       V+ +I     EL F       + I+ E LA     G S+S  VV
Sbjct: 105 EYPLVITIPS--ANKDVDEIILKKYFELAFETFNVPVLQIIIEPLAVALSLGKSSS-LVV 161

Query: 522 NVGATGTKVACVDEGIVVENSIINLNYGGD 551
           N+GA+G  V  + +G V++++++   YGGD
Sbjct: 162 NLGASGCNVTPIVDGTVIKHAVMKSKYGGD 191

>KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {ON}
           Anc_2.117 YHR129C
          Length = 387

 Score = 38.9 bits (89), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 38/72 (52%), Gaps = 1/72 (1%)

Query: 484 ETMIRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIVVENSI 543
           ETM  +L     F+A+ +   ++ + Y +G  T+ CV+  G   +    V +G  + +SI
Sbjct: 128 ETMCEILYETFNFDALYVAHPAVLSLYATG-QTTGCVLECGEGYSASTPVYQGFALPSSI 186

Query: 544 INLNYGGDDISK 555
             ++ GG DI++
Sbjct: 187 RRIDIGGRDITQ 198

>AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR129C (ARP1)
          Length = 405

 Score = 38.9 bits (89), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 38/78 (48%), Gaps = 1/78 (1%)

Query: 484 ETMIRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIVVENSI 543
           E M  LL       A+ +  +++ + Y SG  T+ CVV+ G        V +G  V +SI
Sbjct: 148 EKMCELLFESFNVPALYVSVQAVLSLYASG-RTTGCVVDCGDGCCHAVPVFDGFSVPSSI 206

Query: 544 INLNYGGDDISKLFAVLL 561
             ++  G DI++   +LL
Sbjct: 207 RRIDIAGRDITEFLQLLL 224

>TBLA0H02800 Chr8 (655357..656811) [1455 bp, 484 aa] {ON} Anc_2.593
           YMR033W
          Length = 484

 Score = 38.9 bits (89), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 26/122 (21%), Positives = 54/122 (44%), Gaps = 7/122 (5%)

Query: 446 LLEHAIDKLLKKRDKDTEKDIKYKAVLVIPDLFEKSH------VETMIRLLLSELPFNAV 499
            L++    LLK++  +     +Y +   IP L   +H      +E++   +  +L  N +
Sbjct: 81  FLKYIYISLLKQKHDENADSFEY-SFTNIPLLLLNNHKWSQFQMESITNFVFEKLKLNGL 139

Query: 500 AIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIVVENSIINLNYGGDDISKLFAV 559
            ++  SL   Y      + C++++G   T +  + +   + +    LNYGG  I+ +   
Sbjct: 140 MLLPISLGASYSMVSLQNCCIIDIGLNHTDIVPIVDYTTINHLSNTLNYGGSYINTILQK 199

Query: 560 LL 561
           LL
Sbjct: 200 LL 201

>ABR084W Chr2 (540620..540649,540708..542072) [1395 bp, 464 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR033W
           (ARP9); 1-intron
          Length = 464

 Score = 38.5 bits (88), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 39/78 (50%)

Query: 484 ETMIRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIVVENSI 543
           E + + +  E+  N   +V  +L+  Y  G   +  V+++GAT T +  + + + ++   
Sbjct: 118 ELITQYVFEEMRLNHFMVVPAALSISYAFGSIQNCLVIDIGATHTDIVPIVDYVPLDYMA 177

Query: 544 INLNYGGDDISKLFAVLL 561
            +   GGDDI+   A LL
Sbjct: 178 YSAPIGGDDINAKLATLL 195

>TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.117
           YHR129C
          Length = 373

 Score = 37.4 bits (85), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 37/76 (48%), Gaps = 1/76 (1%)

Query: 480 KSHVETMIRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIVV 539
           +S+ E M+ +        A+ +    + + Y SG  T+ CVV+ G        V EG  +
Sbjct: 118 ESNKEKMLEVFFETFNIPAICVSIPGVLSLYASG-RTTGCVVDCGEGYCSSVPVCEGYTL 176

Query: 540 ENSIINLNYGGDDISK 555
            +SI  +N GG D++K
Sbjct: 177 ASSIKRINLGGIDVTK 192

>Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}
           similar to Ashbya gossypii AFR051W
          Length = 377

 Score = 37.4 bits (85), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 41/82 (50%), Gaps = 1/82 (1%)

Query: 480 KSHVETMIRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIVV 539
           +++ E M  LL       A+ +  +++ + Y SG  T+ CVV+ G        V +G  +
Sbjct: 116 RNNRERMCELLFESFNVPALYVSIQAVLSLYASG-RTTGCVVDCGDGCCHAVPVFDGFSI 174

Query: 540 ENSIINLNYGGDDISKLFAVLL 561
            +SI  ++  G DI++   +LL
Sbjct: 175 PSSIRRIDIAGRDITEFLQLLL 196

>CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129c ACT5
          Length = 387

 Score = 36.2 bits (82), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 69/168 (41%), Gaps = 16/168 (9%)

Query: 480 KSHVETMIRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIVV 539
           K   E M  +L  +    A+   ++ + + YG G  T+ C V+ G  G  +  V +G++V
Sbjct: 119 KKEEEKMCEVLFEKFSIPAIYCSRDPIMSLYGLG-RTTGCSVSCGHRGIGITTVIDGMIV 177

Query: 540 ENSIINLNYGGDDISKLFAVLLLMSNFPYQEWDIDSIPGRMIAEHLKKECLTFQD----- 594
             S    N GG  ++    + LL  N P  E   +   G  +   +K+ C          
Sbjct: 178 GGSSQISNTGGSAVTNTM-LDLLRHNHPKLE---NGQNGIELIRSIKERCCVLSKDFYNE 233

Query: 595 ----ADITTQLFNFIKRVPGLPTEKIEFKTFD--EVILAPLALFYPKI 636
                 IT++  N   R+P     +I  + F+  E+I  P A  Y +I
Sbjct: 234 IRAYELITSKTSNNKYRLPDGNIIEIGSERFEAPEIIFNPQAYGYSEI 281

>KLTH0D08624g Chr4 (722066..723364) [1299 bp, 432 aa] {ON} similar
           to uniprot|Q05123 Saccharomyces cerevisiae YMR033W ARP9
           Actin-related protein
          Length = 432

 Score = 36.2 bits (82), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 39/79 (49%)

Query: 483 VETMIRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIVVENS 542
           +ET+ + +  +L  N    +  +LA+ Y  G   +  V+++   GT V  + + I + + 
Sbjct: 97  LETIAQFVFEQLQINNFMFLPSALASSYALGSLQNCVVIDIHTNGTDVIPILDYIQLGHL 156

Query: 543 IINLNYGGDDISKLFAVLL 561
            + + +GG  I +  A LL
Sbjct: 157 AVKVEHGGSQIDQELAKLL 175

>KAFR0L00240 Chr12 complement(32708..42109) [9402 bp, 3133 aa] {ON}
           Anc_4.14 YLL040C
          Length = 3133

 Score = 36.2 bits (82), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 834 VPEVKETSSDAKEYELNEKIQKLIEERLEKY-LSAIERQNGNEHFMPVSVTPAPHNM 889
           VP     ++D KE EL  K+QKL E  L KY L ++   + NE FM   +T    N+
Sbjct: 90  VPRNLSNTTDNKERELRLKLQKLAEWELNKYTLDSVNEDSKNETFMQSVITKVIDNL 146

>Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 35.8 bits (81), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 1/72 (1%)

Query: 484 ETMIRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIVVENSI 543
           E M ++L       A+ I   ++ + Y SG  T+ CVV+ G        + +G  +  SI
Sbjct: 125 EVMAQVLFETFNLPALYISNPAVLSLYASG-RTTGCVVDCGEGYCSTVPIYDGFALPASI 183

Query: 544 INLNYGGDDISK 555
           + ++ GG DI++
Sbjct: 184 MRMDIGGRDITE 195

>ACR184C Chr3 complement(669411..670616) [1206 bp, 401 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR034W
           (ARP7)
          Length = 401

 Score = 35.8 bits (81), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 34/63 (53%), Gaps = 1/63 (1%)

Query: 489 LLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIVVENSIINLNY 548
           L+L +L    + ++ E LA     G ST+  VV+VGA+   V  + +G VV+  I+   Y
Sbjct: 113 LVLCKLRAPVLQLISEPLAVTLSLGRSTA-LVVDVGASKVTVTPIVDGSVVKTGILRSRY 171

Query: 549 GGD 551
            GD
Sbjct: 172 AGD 174

>Ecym_2306 Chr2 complement(594433..595656) [1224 bp, 407 aa] {ON}
           similar to Ashbya gossypii ABR084W
          Length = 407

 Score = 35.4 bits (80), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 27/138 (19%), Positives = 60/138 (43%), Gaps = 1/138 (0%)

Query: 425 LFNLDEKRYTSLAALLCDVSRLLEHAIDKLLKKRDKDTEKDIKYKAVLVIPDL-FEKSHV 483
           ++ ++    T+L A L  +  + +  + + +K+  +  E  +    + +I    + +S  
Sbjct: 2   IYPINNGSITNLDAFLYFLKAIYKSVLQQRIKENPEGWEAQVSNIPMFLITHYSWSQSEQ 61

Query: 484 ETMIRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIVVENSI 543
           E + + +   +  N   I+  SLAT Y  G   +  V+++G   T +  + +   +E   
Sbjct: 62  EILTQFVFESMKLNNFMIMPNSLATSYAFGSLQNCVVIDIGGAHTDIIPIVDYTPLEYLA 121

Query: 544 INLNYGGDDISKLFAVLL 561
            +   GGD I+   A  L
Sbjct: 122 YSAPVGGDAINAKLASFL 139

>TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.117
           YHR129C
          Length = 383

 Score = 35.0 bits (79), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 62/150 (41%), Gaps = 20/150 (13%)

Query: 418 GCSEGKYLFNLDEKRYTSLAALLCDVSRLLEHAIDKLLKKRDKDTEKDIKYKAVLVIPDL 477
           G  +GK++ NL ++ Y  L  L       ++H I  +      +T  D  +K  L + +L
Sbjct: 53  GVEKGKFVGNLAQE-YRGLLKL----RYPMDHGI--IENWEHMETVWDHIFKDCLKVSNL 105

Query: 478 FE------------KSHVETMIRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGA 525
            E            K + E M   L       A+ I   ++ + Y SG  T+ CVV  G 
Sbjct: 106 GEHPLVVTEAPLNPKPNREKMCETLFESFNIPALYIANPAVLSLYASG-RTTGCVVEAGD 164

Query: 526 TGTKVACVDEGIVVENSIINLNYGGDDISK 555
                  + EG  +  SI  ++ GG DI+K
Sbjct: 165 GYCSSVPIYEGFALTPSIRRIDIGGRDITK 194

>Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 35.0 bits (79), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 36/72 (50%), Gaps = 1/72 (1%)

Query: 484 ETMIRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIVVENSI 543
           E M ++L       A+ +   ++ + Y SG  T+ CV++ G        + +G  +  S+
Sbjct: 125 EVMAQVLFETFNLPALYVSNPAVLSLYASG-RTTGCVIDCGEGYCSTVPIYDGFALPASM 183

Query: 544 INLNYGGDDISK 555
           + ++ GG DI+K
Sbjct: 184 MRMDIGGRDITK 195

>Suva_13.202 Chr13 (328209..328238,328325..329698) [1404 bp, 467 aa]
           {ON} YMR033W (REAL)
          Length = 467

 Score = 35.0 bits (79), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 59/134 (44%), Gaps = 13/134 (9%)

Query: 471 VLVIPDLFEKSHVETMIRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKV 530
           +L+    + +S +ET+ + +   L  N +  +  SLA  Y      + C+++VG   T +
Sbjct: 112 LLITHHSWSQSDLETITQYIFESLEINNLIQLPASLAATYSMISLQNCCIIDVGTYHTDI 171

Query: 531 ACVDEGIVVENSIINLNYGGDDISKLFAVLLLMSNFPYQEWDIDSIPGRMIAEHLKKECL 590
             + +   +++ + +L  GG  I+     LL        +WD D I      E LKK  +
Sbjct: 172 IPIVDYAQLDHLVSSLPVGGQSINDSLKKLL-------PQWDDDQI------ESLKKSPI 218

Query: 591 TFQDADITTQLFNF 604
               +D   +L NF
Sbjct: 219 FEVLSDDAKKLSNF 232

>ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129C ARP1
           Actin-related protein of the dynactin complex required
           for spindle orientation and nuclear migration putative
           ortholog of mammalian centractin
          Length = 381

 Score = 34.7 bits (78), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 64/148 (43%), Gaps = 5/148 (3%)

Query: 458 RDKDTEKDIKYKAVLVI-PDLFEKSHVETMIRLLLSELPFNAVAIVQESLATCYGSGIST 516
           +DK   KD+    VL+    L   S+ + M  LL       A+ +   ++ + Y SG   
Sbjct: 95  KDKLKLKDVDEHPVLITEAPLNPVSNRDEMCDLLFESFGVQALYVANPAVLSLYASG-KI 153

Query: 517 STCVVNVGATGTKVACVDEGIVVENSIINLNYGGDDISKLFAVLLLMSNFPYQEWDIDSI 576
           S CV++ G   +    V +G  ++++I  ++ GG D+++   + L  S         +  
Sbjct: 154 SGCVLDCGDGYSCSVPVYQGYTLKSAIKRIDLGGRDLTEQLQLQLRKSTGLSLTTSGEME 213

Query: 577 PGRMIAEHLKKECLTFQDADITTQLFNF 604
             RMI E   K C    D DI  +  N+
Sbjct: 214 LVRMIKE---KSCYVAVDLDIEEEKCNY 238

>KAFR0K02150 Chr11 (441832..443304) [1473 bp, 490 aa] {ON} Anc_7.448
           YPR034W
          Length = 490

 Score = 35.0 bits (79), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 42/86 (48%), Gaps = 8/86 (9%)

Query: 471 VLVIPDLFEKSHVETMIRLLLSELPFN-----AVAIVQESLATCYGSGISTSTCVVNVGA 525
           V+ +P + +   +  M R    +L FN      + ++ E LA     G S S  VV++G+
Sbjct: 102 VITVPIMKDAVALRVMERYF--DLAFNKFNVPVLQVIIEPLAIALSMGKS-SALVVDLGS 158

Query: 526 TGTKVACVDEGIVVENSIINLNYGGD 551
           +   V  V +G V +NS++   Y GD
Sbjct: 159 SSCNVTPVIDGTVAKNSVLKSKYAGD 184

>ZYRO0F01122g Chr6 complement(88017..89375,89479..89508) [1389 bp,
           462 aa] {ON} similar to uniprot|Q05123 Saccharomyces
           cerevisiae YMR033W ARP9 Actin-related protein involved
           in transcriptional regulation; subunit of the chromatin
           remodeling Snf/Swi complex
          Length = 462

 Score = 35.0 bits (79), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/84 (21%), Positives = 42/84 (50%)

Query: 478 FEKSHVETMIRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGI 537
           + +  +E++++ L   L  N   ++  +L++ Y  G   + CV+++G   T +  V +  
Sbjct: 119 WSQFQLESIVQFLFEALRVNGAMLLSTALSSTYAMGSLQNCCVIDIGTAHTDIIPVVDYA 178

Query: 538 VVENSIINLNYGGDDISKLFAVLL 561
            +      + YGG+ I++  A +L
Sbjct: 179 PLVPLTSTIPYGGNTINENLARIL 202

>TPHA0B01460 Chr2 complement(325847..327304) [1458 bp, 485 aa] {ON}
           Anc_7.448 YPR034W
          Length = 485

 Score = 34.7 bits (78), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 39/74 (52%), Gaps = 1/74 (1%)

Query: 478 FEKSHVETMIRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGI 537
            E   +E   ++   +L   ++ +V ESLA     G   ++ ++++  +G  V  + +GI
Sbjct: 114 LETKIIEEYCKIAFLKLGIPSLRVVNESLAISLSLG-KKNSLIIDLSGSGCSVTPILDGI 172

Query: 538 VVENSIINLNYGGD 551
           +++N I+   +GGD
Sbjct: 173 LIKNGILKSKFGGD 186

>TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/75 (22%), Positives = 36/75 (48%), Gaps = 8/75 (10%)

Query: 857 IEERLEKYLSAIERQNGNEHFMPVSVTPAPHNMNPSLLPWRGAGVLAQIKLIEELFVTNI 916
           I ER++K ++A+   +     M V +   P         W G  +LA +   ++++++  
Sbjct: 309 IAERMQKEITALAPSS-----MKVKIIAPPERKYSV---WIGGSILASLTTFQQMWISKQ 360

Query: 917 DWDVHGSRVLQHKCI 931
           ++D  G  ++ HKC 
Sbjct: 361 EYDESGPSIVHHKCF 375

>Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 bp,
           375 aa] {ON} complement(49082..50199,50349..50358) [1128
           nt, 376 aa]
          Length = 375

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/75 (22%), Positives = 36/75 (48%), Gaps = 8/75 (10%)

Query: 857 IEERLEKYLSAIERQNGNEHFMPVSVTPAPHNMNPSLLPWRGAGVLAQIKLIEELFVTNI 916
           I ER++K ++A+   +     M V +   P         W G  +LA +   ++++++  
Sbjct: 309 IAERMQKEITALAPSS-----MKVKIIAPPERKYSV---WIGGSILASLTTFQQMWISKQ 360

Query: 917 DWDVHGSRVLQHKCI 931
           ++D  G  ++ HKC 
Sbjct: 361 EYDESGPSIVHHKCF 375

>KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/75 (22%), Positives = 36/75 (48%), Gaps = 8/75 (10%)

Query: 857 IEERLEKYLSAIERQNGNEHFMPVSVTPAPHNMNPSLLPWRGAGVLAQIKLIEELFVTNI 916
           I ER++K ++A+   +     M V +   P         W G  +LA +   ++++++  
Sbjct: 309 IAERMQKEITALAPSS-----MKVKIIAPPERKYSV---WIGGSILASLTTFQQMWISKQ 360

Query: 917 DWDVHGSRVLQHKCI 931
           ++D  G  ++ HKC 
Sbjct: 361 EYDESGPSIVHHKCF 375

>KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/75 (22%), Positives = 36/75 (48%), Gaps = 8/75 (10%)

Query: 857 IEERLEKYLSAIERQNGNEHFMPVSVTPAPHNMNPSLLPWRGAGVLAQIKLIEELFVTNI 916
           I ER++K ++A+   +     M V +   P         W G  +LA +   ++++++  
Sbjct: 309 IAERMQKEITALAPSS-----MKVKIIAPPERKYSV---WIGGSILASLTTFQQMWISKQ 360

Query: 917 DWDVHGSRVLQHKCI 931
           ++D  G  ++ HKC 
Sbjct: 361 EYDESGPSIVHHKCF 375

>NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/75 (22%), Positives = 36/75 (48%), Gaps = 8/75 (10%)

Query: 857 IEERLEKYLSAIERQNGNEHFMPVSVTPAPHNMNPSLLPWRGAGVLAQIKLIEELFVTNI 916
           I ER++K ++A+   +     M V +   P         W G  +LA +   ++++++  
Sbjct: 309 IAERMQKEITALAPSS-----MKVKIIAPPERKYSV---WIGGSILASLTTFQQMWISKQ 360

Query: 917 DWDVHGSRVLQHKCI 931
           ++D  G  ++ HKC 
Sbjct: 361 EYDESGPSIVHHKCF 375

>TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,
           375 aa] {ON} 
          Length = 375

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/75 (22%), Positives = 36/75 (48%), Gaps = 8/75 (10%)

Query: 857 IEERLEKYLSAIERQNGNEHFMPVSVTPAPHNMNPSLLPWRGAGVLAQIKLIEELFVTNI 916
           I ER++K ++A+   +     M V +   P         W G  +LA +   ++++++  
Sbjct: 309 IAERMQKEITALAPSS-----MKVKIIAPPERKYSV---WIGGSILASLTTFQQMWISKQ 360

Query: 917 DWDVHGSRVLQHKCI 931
           ++D  G  ++ HKC 
Sbjct: 361 EYDESGPSIVHHKCF 375

>CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039c ACT1 actin
          Length = 375

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/75 (22%), Positives = 36/75 (48%), Gaps = 8/75 (10%)

Query: 857 IEERLEKYLSAIERQNGNEHFMPVSVTPAPHNMNPSLLPWRGAGVLAQIKLIEELFVTNI 916
           I ER++K ++A+   +     M V +   P         W G  +LA +   ++++++  
Sbjct: 309 IAERMQKEITALAPSS-----MKVKIIAPPERKYSV---WIGGSILASLTTFQQMWISKQ 360

Query: 917 DWDVHGSRVLQHKCI 931
           ++D  G  ++ HKC 
Sbjct: 361 EYDESGPSIVHHKCF 375

>Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/75 (22%), Positives = 36/75 (48%), Gaps = 8/75 (10%)

Query: 857 IEERLEKYLSAIERQNGNEHFMPVSVTPAPHNMNPSLLPWRGAGVLAQIKLIEELFVTNI 916
           I ER++K ++A+   +     M V +   P         W G  +LA +   ++++++  
Sbjct: 309 IAERMQKEITALAPSS-----MKVKIIAPPERKYSV---WIGGSILASLTTFQQMWISKQ 360

Query: 917 DWDVHGSRVLQHKCI 931
           ++D  G  ++ HKC 
Sbjct: 361 EYDESGPSIVHHKCF 375

>Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/75 (22%), Positives = 36/75 (48%), Gaps = 8/75 (10%)

Query: 857 IEERLEKYLSAIERQNGNEHFMPVSVTPAPHNMNPSLLPWRGAGVLAQIKLIEELFVTNI 916
           I ER++K ++A+   +     M V +   P         W G  +LA +   ++++++  
Sbjct: 309 IAERMQKEITALAPSS-----MKVKIIAPPERKYSV---WIGGSILASLTTFQQMWISKQ 360

Query: 917 DWDVHGSRVLQHKCI 931
           ++D  G  ++ HKC 
Sbjct: 361 EYDESGPSIVHHKCF 375

>YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375
           aa] {ON}  ACT1Actin, structural protein involved in cell
           polarization, endocytosis, and other cytoskeletal
           functions
          Length = 375

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/75 (22%), Positives = 36/75 (48%), Gaps = 8/75 (10%)

Query: 857 IEERLEKYLSAIERQNGNEHFMPVSVTPAPHNMNPSLLPWRGAGVLAQIKLIEELFVTNI 916
           I ER++K ++A+   +     M V +   P         W G  +LA +   ++++++  
Sbjct: 309 IAERMQKEITALAPSS-----MKVKIIAPPERKYSV---WIGGSILASLTTFQQMWISKQ 360

Query: 917 DWDVHGSRVLQHKCI 931
           ++D  G  ++ HKC 
Sbjct: 361 EYDESGPSIVHHKCF 375

>SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039C ACT1 Actin
          Length = 375

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/75 (22%), Positives = 36/75 (48%), Gaps = 8/75 (10%)

Query: 857 IEERLEKYLSAIERQNGNEHFMPVSVTPAPHNMNPSLLPWRGAGVLAQIKLIEELFVTNI 916
           I ER++K ++A+   +     M V +   P         W G  +LA +   ++++++  
Sbjct: 309 IAERMQKEITALAPSS-----MKVKIIAPPERKYSV---WIGGSILASLTTFQQMWISKQ 360

Query: 917 DWDVHGSRVLQHKCI 931
           ++D  G  ++ HKC 
Sbjct: 361 EYDESGPSIVHHKCF 375

>ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFL039C
           (ACT1); 1-intron
          Length = 376

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/75 (22%), Positives = 36/75 (48%), Gaps = 8/75 (10%)

Query: 857 IEERLEKYLSAIERQNGNEHFMPVSVTPAPHNMNPSLLPWRGAGVLAQIKLIEELFVTNI 916
           I ER++K ++A+   +     M V +   P         W G  +LA +   ++++++  
Sbjct: 310 IAERMQKEITALAPSS-----MKVKIIAPPER---KYSVWIGGSILASLTTFQQMWISKQ 361

Query: 917 DWDVHGSRVLQHKCI 931
           ++D  G  ++ HKC 
Sbjct: 362 EYDESGPSIVHHKCF 376

>Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376
           aa] {ON} similar to Ashbya gossypii ABR222W  1-intron
          Length = 376

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/75 (22%), Positives = 36/75 (48%), Gaps = 8/75 (10%)

Query: 857 IEERLEKYLSAIERQNGNEHFMPVSVTPAPHNMNPSLLPWRGAGVLAQIKLIEELFVTNI 916
           I ER++K ++A+   +     M V +   P         W G  +LA +   ++++++  
Sbjct: 310 IAERMQKEITALAPSS-----MKVKIIAPPERKYSV---WIGGSILASLTTFQQMWISKQ 361

Query: 917 DWDVHGSRVLQHKCI 931
           ++D  G  ++ HKC 
Sbjct: 362 EYDESGPSIVHHKCF 376

>Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON}
           YFL039C (REAL)
          Length = 360

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 39/75 (52%), Gaps = 8/75 (10%)

Query: 857 IEERLEKYLSAIERQNGNEHFMPVSVTPAPHNMNPSLLPWRGAGVLAQIKLIEELFVTNI 916
           I ER++K ++A+   +     M V +  AP     S+  W G  +LA +   ++++++  
Sbjct: 294 IAERMQKEITALAPSS-----MKVKII-APPERKYSV--WIGGSILASLTTFQQMWISKQ 345

Query: 917 DWDVHGSRVLQHKCI 931
           ++D  G  ++ HKC 
Sbjct: 346 EYDESGPSIVHHKCF 360

>TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/75 (22%), Positives = 36/75 (48%), Gaps = 8/75 (10%)

Query: 857 IEERLEKYLSAIERQNGNEHFMPVSVTPAPHNMNPSLLPWRGAGVLAQIKLIEELFVTNI 916
           I ER++K ++A+   +     M V +   P         W G  +LA +   ++++++  
Sbjct: 309 IAERMQKEITALAPSS-----MEVKIIAPPERKYSV---WIGGSILASLTTFQQMWISKQ 360

Query: 917 DWDVHGSRVLQHKCI 931
           ++D  G  ++ HKC 
Sbjct: 361 EYDESGPSIVHHKCF 375

>YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}
           ARP1Actin-related protein of the dynactin complex;
           required for spindle orientation and nuclear migration;
           putative ortholog of mammalian centractin
          Length = 384

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 37/72 (51%), Gaps = 1/72 (1%)

Query: 484 ETMIRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIVVENSI 543
           E M ++L      +A+ +   ++ + Y SG  T+ CVV+ G        + +G  +  S+
Sbjct: 125 EQMAQVLFETFDVSALYVSNPAVLSLYASG-RTTGCVVDCGEGYCSTVPIYDGFALPASM 183

Query: 544 INLNYGGDDISK 555
           + ++ GG DI++
Sbjct: 184 MRMDIGGADITE 195

>Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 17/72 (23%), Positives = 37/72 (51%), Gaps = 1/72 (1%)

Query: 484 ETMIRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIVVENSI 543
           E + +++      +A+ +   ++ + Y SG  T+ CVV+ G        + +G  +  SI
Sbjct: 125 EMIAQVMFETFNLSAIYVSDPAVLSLYASG-RTTGCVVDCGEGYCSSVPIYDGFALPASI 183

Query: 544 INLNYGGDDISK 555
           + ++ GG DI++
Sbjct: 184 MRMDIGGGDITE 195

>ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} highly
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin- remodeling
           enzyme complexes
          Length = 483

 Score = 33.9 bits (76), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 35/65 (53%), Gaps = 6/65 (9%)

Query: 716 SETTELNLTALDKSVIQSITNATLSLEPGKMASFYSNILIVGGSSNIPGFDTILKDRINM 775
           SE++EL    +   V  SIT+A + L     A+   NI++ GGSS++PGF   L + +  
Sbjct: 371 SESSEL--AGISDLVHSSITSADVDLR----ATLAHNIVLTGGSSSVPGFSDRLMNELTK 424

Query: 776 WRPKL 780
             P L
Sbjct: 425 KLPAL 429

>SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} highly
           similar to uniprot|Q74ZV8 Ashbya gossypii AGR091W ARP6
           Actin-like protein ARP6 and similar to uniprot|Q12509
           Saccharomyces cerevisiae YLR085C ARP6 Nuclear actin-
           related protein involved in chromatin remodeling
           component of chromatin-remodeling enzyme complexes
          Length = 419

 Score = 33.5 bits (75), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 61/143 (42%), Gaps = 27/143 (18%)

Query: 520 VVNVGATGTKVACVDEGIVVENSIINLNYGGDDISKLFAVLLLMSNFPYQEWDIDSIPGR 579
           V++ G   T V  + +GI    +I  L+ GG  ++      L   ++       + +   
Sbjct: 173 VIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHY-------NVMDET 225

Query: 580 MIAEHLKKECL---------TFQDADITTQLF---NFIKRVPG--------LPTEKIEFK 619
           ++  ++K++CL         +FQ  + TT  +   +F     G        +P +    K
Sbjct: 226 ILVNNIKEKCLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIK 285

Query: 620 TFDEVILAPLALFYPKIFSLLKP 642
            +DE+   P   F+P+I SLLKP
Sbjct: 286 LYDELFSIPETFFHPEIASLLKP 308

>KNAG0B02110 Chr2 complement(399743..401200) [1458 bp, 485 aa] {ON}
           Anc_7.448 YPR034W
          Length = 485

 Score = 33.5 bits (75), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 35/74 (47%), Gaps = 3/74 (4%)

Query: 479 EKSHVETMIRLLLSELPFNA--VAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEG 536
           E++ +  M  + ++   FN   V  V E LA     G S S  V+++G  G  V  V +G
Sbjct: 112 ERARLVMMRYMDMAFYRFNVPVVQFVIEPLAIALSMGKS-SALVIDIGTNGCTVTPVYDG 170

Query: 537 IVVENSIINLNYGG 550
           +VV    +   YGG
Sbjct: 171 VVVRTGCVRSKYGG 184

>Ecym_2379 Chr2 (736268..736771) [504 bp, 167 aa] {ON} similar to
           Ashbya gossypii AAL098W
          Length = 167

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 37/70 (52%), Gaps = 2/70 (2%)

Query: 674 LSEMDCATNTLYSDMVQESVLLDNLLGINSRREGPPKDSGV--GSETTELNLTALDKSVI 731
           + +MD    TL + + +E+  LDNL  + S R  PP+D  V   S T+EL+  ++ KS +
Sbjct: 98  VDDMDPQPVTLSTKVPKETNALDNLHILKSVRPKPPRDEDVVDSSGTSELSSLSVSKSAL 157

Query: 732 QSITNATLSL 741
           +      L L
Sbjct: 158 EEALMDRLQL 167

>SAKL0B11220g Chr2 (978268..978297,978363..979733) [1401 bp, 466 aa]
           {ON} similar to uniprot|Q05123 Saccharomyces cerevisiae
           YMR033W ARP9 Actin-related protein
          Length = 466

 Score = 32.7 bits (73), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 33/63 (52%)

Query: 471 VLVIPDLFEKSHVETMIRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKV 530
           +LV    + +SH+E + + +   L  N+  I+  +LAT Y  G   ++ V++VG   T +
Sbjct: 111 LLVSHHSWTRSHIEQITQYVFELLEINSFMILPLALATTYAFGSLQNSLVIDVGLEKTDL 170

Query: 531 ACV 533
             +
Sbjct: 171 VPI 173

>CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa]
           {ON} similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081c ACT3 protein Actin-like protein ARP4
          Length = 493

 Score = 32.7 bits (73), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%)

Query: 730 VIQSITNATLSLEPGKMASFYSNILIVGGSSNIPGFDTILKDRINMWRPKL 780
           ++  I+++  S +    AS   N++I GGSS IPG    + + +NM  P L
Sbjct: 389 IVDLISSSISSCDVDIRASLAHNLVITGGSSTIPGLSDRILNELNMKFPAL 439

>KLTH0C05324g Chr3 complement(458911..460110) [1200 bp, 399 aa] {ON}
           similar to uniprot|Q12406 Saccharomyces cerevisiae
           YPR034W ARP7 Actin-related protein involved in
           transcriptional regulation subunit of the chromatin
           remodeling Snf/Swi complex
          Length = 399

 Score = 32.3 bits (72), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query: 474 IPDLFEKSHVETMIRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACV 533
           +PD     ++E    + L  L      +V E LA     G +T+  VV+VGA  + V  +
Sbjct: 98  LPDAVRAQYLE----MALGRLKIPVFQLVVEPLAVALSLGRNTA-LVVDVGAAKSTVTPI 152

Query: 534 DEGIVVENSIINLNYGGD 551
            +G VV+ ++    + GD
Sbjct: 153 IDGTVVQTAVARSKFAGD 170

>Skud_13.189 Chr13 (324460..324489,324579..325952) [1404 bp, 467 aa]
           {ON} YMR033W (REAL)
          Length = 467

 Score = 32.3 bits (72), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 30/134 (22%), Positives = 58/134 (43%), Gaps = 13/134 (9%)

Query: 471 VLVIPDLFEKSHVETMIRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKV 530
           +L+    + +S +E + + +   L  N +  +  SLA  Y      + C+++VG   T V
Sbjct: 112 LLITHHFWSQSDLERITQYIFESLEINNLIQLPASLAATYSMISLQNCCIIDVGTYHTDV 171

Query: 531 ACVDEGIVVENSIINLNYGGDDISKLFAVLLLMSNFPYQEWDIDSIPGRMIAEHLKKECL 590
             + +   +++ + ++  GG  I++    LL        +WD   I      E LKK  +
Sbjct: 172 IPIVDYAQLDHLVSSIPMGGQSINESLKKLL-------PQWDDHQI------ESLKKSSI 218

Query: 591 TFQDADITTQLFNF 604
               +D   +L NF
Sbjct: 219 FEVLSDDAKKLSNF 232

>TDEL0B06860 Chr2 (1214531..1214560,1214657..1216012) [1386 bp, 461
           aa] {ON} Anc_2.593 YMR033W
          Length = 461

 Score = 32.0 bits (71), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 18/78 (23%), Positives = 36/78 (46%), Gaps = 4/78 (5%)

Query: 482 HVETMIRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIVVEN 541
            +E + + +   L  N   ++  SLA+ Y      + C++++G T T +  + +   +E 
Sbjct: 122 QLEVITQFVFEALQINNALLLPASLASSYAMSSLQNCCIIDIGTTHTDIIPIIDYTPLEA 181

Query: 542 SIINLNYGG----DDISK 555
               + YGG    D +SK
Sbjct: 182 LSSKIAYGGQLINDQLSK 199

>TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {ON}
           Anc_1.287 YJL081C
          Length = 480

 Score = 32.0 bits (71), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 1/67 (1%)

Query: 715 GSETTELNLTALDKSVIQSITNAT-LSLEPGKMASFYSNILIVGGSSNIPGFDTILKDRI 773
           G    E ++T  D +    + NA+ L+ +    A+   NI++ GG+S+IPGF   L   +
Sbjct: 360 GKRPLEESVTGSDIAGAADLVNASILASDVDLRATLAHNIVLTGGTSSIPGFSDRLMSEL 419

Query: 774 NMWRPKL 780
           N   P L
Sbjct: 420 NKKLPAL 426

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 90,234,065
Number of extensions: 3832886
Number of successful extensions: 10936
Number of sequences better than 10.0: 102
Number of HSP's gapped: 11110
Number of HSP's successfully gapped: 130
Length of query: 934
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 815
Effective length of database: 39,836,145
Effective search space: 32466458175
Effective search space used: 32466458175
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 71 (32.0 bits)