Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0B036905.527ON32632616860.0
KLTH0G03762g5.527ON7091711496e-10
KNAG0C032305.527ON5611091488e-10
Kpol_1023.985.527ON6671071471e-09
CAGL0F03047g5.527ON7441321471e-09
ZYRO0D12562g5.527ON818991452e-09
ADR194C5.527ON637991425e-09
TPHA0K005305.527ON6461051408e-09
KAFR0E033005.527ON466921372e-08
Kwal_47.186425.527ON309561334e-08
SAKL0G04928g5.527ON892981345e-08
NCAS0F010905.527ON7871061311e-07
NDAI0H016005.527ON8421051212e-06
Smik_4.6975.527ON817931212e-06
YDR422C (SIP1)5.527ON8151121203e-06
Suva_2.5995.527ON8271101177e-06
Kpol_1004.215.527ON755501132e-05
TBLA0D016505.527ON10161501122e-05
ZYRO0E08404g3.517ON3482431103e-05
TDEL0A039105.527ON7491031113e-05
Skud_4.6965.527ON811481105e-05
Ecym_40655.527ON7211131071e-04
CAGL0A03696g3.517ON415245970.001
NCAS0F037303.517ON432262960.002
KAFR0F041403.517ON348218940.003
KNAG0B006003.517ON389211910.008
NCAS0E006203.517ON500239890.013
Smik_5.1503.517ON417226890.014
Suva_5.1233.517ON423228880.016
Suva_7.533.517ON414286880.019
Skud_5.1363.517ON418222880.019
TBLA0I032703.517ON433282880.020
YER027C (GAL83)3.517ON417222870.022
KNAG0E015903.517ON423249870.023
TDEL0D058503.517ON404229870.024
YGL208W (SIP2)3.517ON415296830.079
KAFR0I023803.517ON40942810.13
Ecym_12103.517ON450243810.14
Smik_7.553.517ON41565800.18
Kpol_195.23.517ON435145790.21
SAKL0F02002g3.517ON50342780.33
Skud_7.603.517ON441212770.36
NDAI0B060103.517ON50343770.37
KLLA0B00583g3.517ON48642770.46
AER361C3.517ON475249760.57
TPHA0A058103.517ON42442750.63
Kwal_47.190403.517ON42942750.73
NDAI0I028903.517ON58241712.1
YOR346W (REV1)7.46ON98535712.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0B03690
         (326 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0B03690 Chr2 (708946..709926) [981 bp, 326 aa] {ON} Anc_5.52...   654   0.0  
KLTH0G03762g Chr7 complement(297935..300064) [2130 bp, 709 aa] {...    62   6e-10
KNAG0C03230 Chr3 (632659..634344) [1686 bp, 561 aa] {ON} Anc_5.5...    62   8e-10
Kpol_1023.98 s1023 (229891..231894) [2004 bp, 667 aa] {ON} (2298...    61   1e-09
CAGL0F03047g Chr6 complement(298906..301140) [2235 bp, 744 aa] {...    61   1e-09
ZYRO0D12562g Chr4 complement(1061702..1064158) [2457 bp, 818 aa]...    60   2e-09
ADR194C Chr4 complement(1039625..1041538) [1914 bp, 637 aa] {ON}...    59   5e-09
TPHA0K00530 Chr11 (105141..107081) [1941 bp, 646 aa] {ON} Anc_5....    59   8e-09
KAFR0E03300 Chr5 (654349..655749) [1401 bp, 466 aa] {ON} Anc_5.5...    57   2e-08
Kwal_47.18642 s47 (908641..909570) [930 bp, 309 aa] {ON} YDR422C...    56   4e-08
SAKL0G04928g Chr7 complement(405798..408476) [2679 bp, 892 aa] {...    56   5e-08
NCAS0F01090 Chr6 complement(215542..217905) [2364 bp, 787 aa] {O...    55   1e-07
NDAI0H01600 Chr8 complement(387297..389825) [2529 bp, 842 aa] {O...    51   2e-06
Smik_4.697 Chr4 complement(1236081..1238534) [2454 bp, 817 aa] {...    51   2e-06
YDR422C Chr4 complement(1315326..1317773) [2448 bp, 815 aa] {ON}...    51   3e-06
Suva_2.599 Chr2 complement(1068063..1070546) [2484 bp, 827 aa] {...    50   7e-06
Kpol_1004.21 s1004 complement(41725..43992) [2268 bp, 755 aa] {O...    48   2e-05
TBLA0D01650 Chr4 (406397..409447) [3051 bp, 1016 aa] {ON} Anc_5....    48   2e-05
ZYRO0E08404g Chr5 complement(672301..673347) [1047 bp, 348 aa] {...    47   3e-05
TDEL0A03910 Chr1 complement(701073..703322) [2250 bp, 749 aa] {O...    47   3e-05
Skud_4.696 Chr4 complement(1236293..1238728) [2436 bp, 811 aa] {...    47   5e-05
Ecym_4065 Chr4 (144003..146168) [2166 bp, 721 aa] {ON} similar t...    46   1e-04
CAGL0A03696g Chr1 (377255..378502) [1248 bp, 415 aa] {ON} simila...    42   0.001
NCAS0F03730 Chr6 complement(750798..752096) [1299 bp, 432 aa] {O...    42   0.002
KAFR0F04140 Chr6 complement(814903..815949) [1047 bp, 348 aa] {O...    41   0.003
KNAG0B00600 Chr2 (97910..99079) [1170 bp, 389 aa] {ON} Anc_3.517...    40   0.008
NCAS0E00620 Chr5 (106661..108163) [1503 bp, 500 aa] {ON} Anc_3.517     39   0.013
Smik_5.150 Chr5 complement(213879..215132) [1254 bp, 417 aa] {ON...    39   0.014
Suva_5.123 Chr5 complement(184865..186136) [1272 bp, 423 aa] {ON...    39   0.016
Suva_7.53 Chr7 (93895..95139) [1245 bp, 414 aa] {ON} YGL208W (REAL)    39   0.019
Skud_5.136 Chr5 complement(206871..208127) [1257 bp, 418 aa] {ON...    39   0.019
TBLA0I03270 Chr9 complement(793849..795150) [1302 bp, 433 aa] {O...    39   0.020
YER027C Chr5 complement(208979..210232) [1254 bp, 417 aa] {ON}  ...    38   0.022
KNAG0E01590 Chr5 complement(317054..318325) [1272 bp, 423 aa] {O...    38   0.023
TDEL0D05850 Chr4 complement(1062927..1064141) [1215 bp, 404 aa] ...    38   0.024
YGL208W Chr7 (97338..98585) [1248 bp, 415 aa] {ON}  SIP2One of t...    37   0.079
KAFR0I02380 Chr9 (482219..483448) [1230 bp, 409 aa] {ON} Anc_3.5...    36   0.13 
Ecym_1210 Chr1 (423627..424979) [1353 bp, 450 aa] {ON} similar t...    36   0.14 
Smik_7.55 Chr7 (92235..93482) [1248 bp, 415 aa] {ON} YGL208W (REAL)    35   0.18 
Kpol_195.2 s195 complement(4330..5637) [1308 bp, 435 aa] {ON} co...    35   0.21 
SAKL0F02002g Chr6 (167591..169102) [1512 bp, 503 aa] {ON} simila...    35   0.33 
Skud_7.60 Chr7 (102699..104024) [1326 bp, 441 aa] {ON} YGL208W (...    34   0.36 
NDAI0B06010 Chr2 complement(1460221..1461732) [1512 bp, 503 aa] ...    34   0.37 
KLLA0B00583g Chr2 complement(44819..46279) [1461 bp, 486 aa] {ON...    34   0.46 
AER361C Chr5 complement(1307677..1309104) [1428 bp, 475 aa] {ON}...    34   0.57 
TPHA0A05810 Chr1 complement(1317530..1318804) [1275 bp, 424 aa] ...    33   0.63 
Kwal_47.19040 s47 complement(1073036..1074325) [1290 bp, 429 aa]...    33   0.73 
NDAI0I02890 Chr9 complement(682274..684022) [1749 bp, 582 aa] {O...    32   2.1  
YOR346W Chr15 (981828..984785) [2958 bp, 985 aa] {ON}  REV1Deoxy...    32   2.7  

>KNAG0B03690 Chr2 (708946..709926) [981 bp, 326 aa] {ON} Anc_5.527
           YDR422C
          Length = 326

 Score =  654 bits (1686), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/326 (96%), Positives = 313/326 (96%)

Query: 1   MGAGQSTLVALSADTVNKFKPSAKRDKRDEHHDGAKYTRENYDNFYNYNLLELVRGQRVP 60
           MGAGQSTLVALSADTVNKFKPSAKRDKRDEHHDGAKYTRENYDNFYNYNLLELVRGQRVP
Sbjct: 1   MGAGQSTLVALSADTVNKFKPSAKRDKRDEHHDGAKYTRENYDNFYNYNLLELVRGQRVP 60

Query: 61  HFYRQPRRRTKVKLRFRDSHTIPFRVHSVAIQGTDITSKLQRTGKMGGLQQIPLQFEGDS 120
           HFYRQPRRRTKVKLRFRDSHTIPFRVHSVAIQGTDITSKLQRTGKMGGLQQIPLQFEGDS
Sbjct: 61  HFYRQPRRRTKVKLRFRDSHTIPFRVHSVAIQGTDITSKLQRTGKMGGLQQIPLQFEGDS 120

Query: 121 SEWVAPDLYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVIENXXXXXXXXX 180
           SEWVAPDLYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVIEN         
Sbjct: 121 SEWVAPDLYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVIENDEVVEPAVA 180

Query: 181 XXXXMGQDSPLGARVEYTNEILPLFEGYCDSQQIDHTAQYKPKTHMNQKTFFYYAFQEQD 240
               MGQDSPLGARVEYTNEILPLFEGYCDSQQIDHTAQYKPKTHMNQKTFFYYAFQEQD
Sbjct: 181 ADAPMGQDSPLGARVEYTNEILPLFEGYCDSQQIDHTAQYKPKTHMNQKTFFYYAFQEQD 240

Query: 241 AASGDYDAQFCERYTVPIIPPYFYSIDITPQDNTLKVPLPIQLANLNRTIFPSPEDICND 300
           AASGDYDAQFCERYTVPIIPPYFYSIDITPQDNTLKVPLPIQLANLNRTIFPSPEDICND
Sbjct: 241 AASGDYDAQFCERYTVPIIPPYFYSIDITPQDNTLKVPLPIQLANLNRTIFPSPEDICND 300

Query: 301 YLCIGCVISYRGKYMAHLFYRPSPWE 326
           YLCIGCVISYRGKYMAHLFYRPSPWE
Sbjct: 301 YLCIGCVISYRGKYMAHLFYRPSPWE 326

>KLTH0G03762g Chr7 complement(297935..300064) [2130 bp, 709 aa] {ON}
           similar to uniprot|P32578 Saccharomyces cerevisiae
           YDR422C SIP1 Alternate beta-subunit of the Snf1p kinase
           complex may confer substrate specificity vacuolar
           protein containing KIS (Kinase-Interacting Sequence) and
           ASC (Association with Snf1 kinase Complex) domains
           involved in protein interactions
          Length = 709

 Score = 62.0 bits (149), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 82/171 (47%), Gaps = 15/171 (8%)

Query: 1   MGAGQSTLVALSADTVNKFKPSAKRDKRDEHHDGAKYTRENYDNFYNYNLLEL-VRGQRV 59
           +G   + +  L  D++N+     K     EH++GA     N   F + NL    +R    
Sbjct: 300 VGPDSAAIPRLITDSLNRIDSFEKGTV--EHYEGA-----NESGFSSQNLTSSDMRDSDD 352

Query: 60  PHFYRQPRRRTKVKLRFRDSHTIPFRVHSVAIQGTDITSKLQRTGKMGGLQQIPLQFEGD 119
               R P   T V L ++D+   P +   ++I   DI+S L    K     +IP+ F+ +
Sbjct: 353 ADEDRGPG--THVILNWKDNIVDP-KTCKMSIVSKDISSTLNPHKK---FSKIPMVFDME 406

Query: 120 SSEWVAPDLYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVIE 170
            + W A DLYLP G YKF+F+IN     HS+YLP  T   G   N+F V+E
Sbjct: 407 RNCWTAHDLYLPSGVYKFQFLINGEL-RHSDYLPTATDSFGNCVNWFEVVE 456

 Score = 38.5 bits (88), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 59/152 (38%), Gaps = 26/152 (17%)

Query: 194 RVEYTNEILPLFEGYCDS---------QQIDHTAQYKPKTHM------NQKTFFYYAFQE 238
           + EYT+EI  LF+   D          +++      KP + +      NQ   F    Q 
Sbjct: 551 KYEYTDEIPELFKANFDGSLVPPPYEERELTKDGSQKPPSFLHRVQDCNQDVLFADLQQN 610

Query: 239 QDAASGDYDAQFCERYTVPIIPPYFYSIDITP--------QDNTLKVPLPIQLANLNRTI 290
               S   +  F ++Y  P +P Y  S  +           D+  +V   +   NLN  +
Sbjct: 611 GQIDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFSGFQDKTDSKTRVNHIVPHVNLNHLL 670

Query: 291 FPSPEDICNDYLCIGCVISYRGKYMAHLFYRP 322
             S   I ++ + +GC   Y GK++  + Y P
Sbjct: 671 TSS---IRDEIISVGCTTRYEGKFITQIIYTP 699

>KNAG0C03230 Chr3 (632659..634344) [1686 bp, 561 aa] {ON} Anc_5.527
           YDR422C
          Length = 561

 Score = 61.6 bits (148), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 54/109 (49%), Gaps = 14/109 (12%)

Query: 71  KVKLRFRDSHTIPFRVHSVAIQGTDITSKL----------QRTGKMGGLQQIPLQFEGDS 120
           +V L++RD    P++    AI+  DI S L          +R  K   L    L ++   
Sbjct: 216 RVILKWRDPQLQPYQGTGAAIKSHDIYSTLRAIKSELITPERENKEDLLY---LDYDAKK 272

Query: 121 SEWVAPDLYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVI 169
            +W  PDLYLPPG Y+ +F+IN    +HS +LP  T   G   N+F V+
Sbjct: 273 KDWFVPDLYLPPGIYRLKFLINGML-LHSNFLPTATDAAGTIVNWFEVL 320

 Score = 33.9 bits (76), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 43/100 (43%), Gaps = 4/100 (4%)

Query: 227 NQKTFFYYAFQEQDAASGDYDAQFCERYTVPIIPPYFYSIDITPQDNTLKVPLPIQLANL 286
           NQ   F    +     + + +  F  ++ V  +P Y  S  +  ++ + +V   I   NL
Sbjct: 464 NQDALFASIQKIGKMTTEEAEEYFLTKFKVSDLPIYLNSTYLN-KNFSGEVNHIIPHVNL 522

Query: 287 NRTIFPSPEDICNDYLCIGCVISYRGKYMAHLFYRPSPWE 326
              +  S   I  D +C+GC   Y GK++  + Y P  ++
Sbjct: 523 RHLLTTS---IKEDIICVGCTTRYAGKFITQVIYAPCSYD 559

>Kpol_1023.98 s1023 (229891..231894) [2004 bp, 667 aa] {ON}
           (229891..231894) [2004 nt, 668 aa]
          Length = 667

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 56/107 (52%), Gaps = 1/107 (0%)

Query: 64  RQPRRRTKVKLRFRDSHTIPFRVHSVAIQGTDITSKLQ-RTGKMGGLQQIPLQFEGDSSE 122
           R+   R  V LR+RDS+       SV+I   DI + +Q +   +  +    + ++ + + 
Sbjct: 304 RRYHSRVNVVLRWRDSYIQNETCKSVSIISEDILTSVQAQNSGVLLISNFSMTYDKNENN 363

Query: 123 WVAPDLYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVI 169
           WV PDL+LPPG+Y+ RF+I+     +S YLP+     G   N   ++
Sbjct: 364 WVLPDLFLPPGKYRLRFLIDHHDFRYSNYLPVTEDELGTIINEIEIL 410

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 59/171 (34%), Gaps = 45/171 (26%)

Query: 190 PLGARVEYTNEILPLFE---------------GYCDSQQIDHTAQYKPKTHMNQKTFFYY 234
           P  + V YTNEI  LF+               G+ +                NQ   F  
Sbjct: 498 PCISEVTYTNEIPQLFKITDNNCIVNENYERYGFVEPPSYGEPGLENRVIDCNQDILFA- 556

Query: 235 AFQEQDAASGDYDAQ-FCERYTVPIIPPYFYS---------------------IDITPQD 272
            FQ+  A   +   Q F E+Y VP +P +  S                      DI  ++
Sbjct: 557 TFQQNGAVDVELAEQLFLEKYPVPDLPVFLDSHFSEKLFDNNDSSKNLNDMNGEDIQIKN 616

Query: 273 NTLKVPLPIQLANLNRTIFPSPEDICNDYLCIGCVISYRGKYMAHLFYRPS 323
           N   +P      NLN  +      I N  + + C   Y+ K++ H+ Y PS
Sbjct: 617 NGQDIPH----VNLNHVL---TNKISNGMISVACTTRYKRKFVTHILYSPS 660

>CAGL0F03047g Chr6 complement(298906..301140) [2235 bp, 744 aa] {ON}
           similar to uniprot|P32578 Saccharomyces cerevisiae
           YDR422c SIP1 multicopy suppressor of SNF1
          Length = 744

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 63/132 (47%), Gaps = 19/132 (14%)

Query: 56  GQRVP------HFYRQPRRRTKVKLRFRDSHTIPFRVH-SVAIQGTDITSKLQRTGKM-- 106
           GQR P      H       RT V L++RDS          V +   +I + L+   K+  
Sbjct: 330 GQRTPNNSAHVHSESPSPDRTNVILKWRDSQNQSNNKELKVYLVSNEICASLKNDDKLFA 389

Query: 107 -GGL--------QQIPLQFEGDSSEWVAPDLYLPPGEYKFRFVINDTCSMHSEYLPILTV 157
            G L         +IPL ++  ++EW  PDLYLP G Y+ +F++N    +HS++LP  T 
Sbjct: 390 EGKLLATDNSQFNKIPLSYDSHNNEWYVPDLYLPQGIYRLQFLVNGNL-VHSDFLPTATD 448

Query: 158 GDGIAYNYFVVI 169
             G   N+F V+
Sbjct: 449 DQGNIMNWFEVL 460

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 40/161 (24%), Positives = 68/161 (42%), Gaps = 33/161 (20%)

Query: 190 PLGARV-EYTNEILPLFEGYCDSQQI--DHTAQYKPKTHMNQKTFFYYAFQ-EQDAASGD 245
           P+  +V EY+N I  LF   CD + +  D+  +  P+   ++ +F        QDA  GD
Sbjct: 579 PIKPKVYEYSNNIPALFRISCDMEDVDDDNGTENNPRAFYDRPSFTNRVVDCNQDALFGD 638

Query: 246 ------YDAQ-----FCERYTVPIIPPYFYSIDI-------------TPQDNTLKVPLPI 281
                  DA+     F ++Y VP +P Y  S  +             + QD+++   +P 
Sbjct: 639 LQKGGKMDAEEAENLFLKKYQVPDLPVYLNSTYLNKIFHEFHQVAGPSTQDSSINHIIP- 697

Query: 282 QLANLNRTIFPSPEDICNDYLCIGCVISYRGKYMAHLFYRP 322
              NL   +  S   I +  + + C   Y GK++  + Y P
Sbjct: 698 -HVNLKHLLTSS---IRDGIVSVACTTRYAGKFITQVIYAP 734

>ZYRO0D12562g Chr4 complement(1061702..1064158) [2457 bp, 818 aa]
           {ON} some similarities with uniprot|P32578 Saccharomyces
           cerevisiae YDR422C SIP1 Alternate beta-subunit of the
           Snf1p kinase complex may confer substrate specificity
           vacuolar protein containing KIS (Kinase-Interacting
           Sequence) and ASC (Association with Snf1 kinase Complex)
           domains involved in protein interactions
          Length = 818

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 53/99 (53%), Gaps = 3/99 (3%)

Query: 72  VKLRFRDSHTIPFRVHSVAIQGTDITSKLQ-RTGKMGGLQQIPLQFEGDSSEWVAPDLYL 130
           V +++RD H      + +++   DI S L     K G     P+++E ++ EWV PDL L
Sbjct: 441 VAIKWRD-HLPVDGTNRMSMVSEDIASTLSFERQKHGARNTFPMRYEEETKEWVVPDLVL 499

Query: 131 PPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVI 169
           P G Y+ +F+IN   + HS YLP  T   G   N+F VI
Sbjct: 500 PVGVYRLQFLINGELT-HSNYLPTATDSVGNFVNWFEVI 537

 Score = 33.5 bits (75), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 37/88 (42%), Gaps = 14/88 (15%)

Query: 250 FCERYTVPIIPPYFYSIDIT-----------PQDNTLKVPLPIQLANLNRTIFPSPEDIC 298
           F E+Y VP +P Y  S  +            P   +  +   I   NLN  +  S   I 
Sbjct: 728 FLEKYPVPDLPIYLNSYYLNRIISEFQKNNYPGGGSGGINHIIPHVNLNHLLTSS---IR 784

Query: 299 NDYLCIGCVISYRGKYMAHLFYRPSPWE 326
           ++ + +GC   Y GK++  + Y P  +E
Sbjct: 785 DEMISVGCTTRYEGKFITQVIYAPCYYE 812

>ADR194C Chr4 complement(1039625..1041538) [1914 bp, 637 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR422C
           (SIP1)
          Length = 637

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 52/99 (52%), Gaps = 6/99 (6%)

Query: 71  KVKLRFRDSHTIPFRVHSVAIQGTDITSKLQRTGKMGGLQQIPLQFEGDSSEWVAPDLYL 130
           +V +++RD    P R   ++I   DI S + +  K    +++ + F  D   WVAPDL L
Sbjct: 307 EVIIKWRDCLLDPQRTK-LSIVSPDIASVIHKNSK----RKVAMVFSKDEQFWVAPDLRL 361

Query: 131 PPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVI 169
           PPG YK +F+IN     HS +LP  T       N+F V+
Sbjct: 362 PPGIYKLQFLINGAL-RHSNFLPTATDSHSNIVNWFEVV 399

 Score = 33.9 bits (76), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 25/112 (22%), Positives = 44/112 (39%), Gaps = 23/112 (20%)

Query: 227 NQKTFFYYAFQEQDAASGDYDAQFCERYTVPIIPPYFYSI----------------DITP 270
           NQ   F +  ++   ++ + +    E+Y VP +P Y  S                 D+  
Sbjct: 525 NQDELFRFLQEDWKMSAQEAEEVLVEKYPVPDLPVYLNSSYLNEIFTKLQRSSVTGDVKR 584

Query: 271 QDNTLKVPLPIQLANLNRTIFPSPEDICNDYLCIGCVISYRGKYMAHLFYRP 322
              T  +P      NLN  +  S   I ++ + +GC   Y GK++  + Y P
Sbjct: 585 SSFTHIIPH----VNLNHLLTSS---IRDEIISVGCTTRYEGKFITQIMYAP 629

>TPHA0K00530 Chr11 (105141..107081) [1941 bp, 646 aa] {ON} Anc_5.527
           YDR422C
          Length = 646

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 58/105 (55%), Gaps = 7/105 (6%)

Query: 68  RRTKVKLRFRDSHTIPFRVHSVAIQGTDITSKLQ--RTGKMGGLQQIPLQFEGDSSEWVA 125
           ++T+V LR+ DS   P    SV+I   DI   +   R+     ++++PL+++  + EW  
Sbjct: 310 QKTRVTLRWIDSKFKPNNYQSVSIISEDIIDVINFYRSNN-DKIKRLPLKYDSLTHEWKI 368

Query: 126 PDLYLPPGEYKFRFVINDTCSMHSEYLPILTVGD--GIAYNYFVV 168
            DL+LP G Y+F F+IN+T   HS  L I T  D  G   NYF V
Sbjct: 369 SDLFLPAGYYEFSFLINETDVHHS--LHICTKMDRFGKRVNYFEV 411

>KAFR0E03300 Chr5 (654349..655749) [1401 bp, 466 aa] {ON} Anc_5.527
           YDR422C
          Length = 466

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/92 (36%), Positives = 47/92 (51%), Gaps = 11/92 (11%)

Query: 88  SVAIQGTDITSKLQRTGKMGGLQ----------QIPLQFEGDSSEWVAPDLYLPPGEYKF 137
           +VAI   DI S L    K               +I L ++  ++EW  P+L+LPPG YK 
Sbjct: 169 AVAIVSKDIVSTLLTIAKTHKSSIITFIERKKFKINLLYDIVTNEWYLPNLFLPPGIYKL 228

Query: 138 RFVINDTCSMHSEYLPILTVGDGIAYNYFVVI 169
           +F+IN    +HS YLP  T  +G   N+F VI
Sbjct: 229 QFLINGNL-IHSNYLPTATNANGNIVNWFEVI 259

 Score = 35.4 bits (80), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 56/144 (38%), Gaps = 23/144 (15%)

Query: 194 RVEYTNEILPLFE------GYCDSQQIDHTAQYKPKTHMNQKTFFYYAFQEQDAASGDYD 247
            ++YTNEI  +F+         ++Q  D +        +NQ   F    +     + + +
Sbjct: 326 EIKYTNEIPEIFKFDSTANSNVNNQAFDMS--LSKVIDLNQDHVFASLQKIARMNTDEAE 383

Query: 248 AQFCERYTVPIIPPYFYSI--------DITPQDNTLKVPLPIQLANLNRTIFPSPEDICN 299
             F  R+ +  +P Y  S         D   +     VP      NLN  +  S +D   
Sbjct: 384 NYFLNRFKIHDLPIYLNSNFLNKIFIRDNNNETTNNTVPH----VNLNHLLTTSIKD--- 436

Query: 300 DYLCIGCVISYRGKYMAHLFYRPS 323
           D LC+ C   Y GK++  + Y PS
Sbjct: 437 DTLCVACTTRYVGKFITQIMYAPS 460

>Kwal_47.18642 s47 (908641..909570) [930 bp, 309 aa] {ON} YDR422C
           (SIP1) - SNF1 protein kinase substrate [contig 191]
           PARTIAL
          Length = 309

 Score = 55.8 bits (133), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 1/56 (1%)

Query: 114 LQFEGDSSEWVAPDLYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVI 169
           + F+ +S+ W+APDLYLP G YKF+F+IN     HSE+LP  T   G   N+F V+
Sbjct: 1   MVFDMESNCWIAPDLYLPAGVYKFQFLINGEL-RHSEFLPTATDSFGNCVNWFEVV 55

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 34/150 (22%), Positives = 57/150 (38%), Gaps = 26/150 (17%)

Query: 196 EYTNEILPLFEG----------YCDSQQIDHTAQYKPK-----THMNQKTFFYYAFQEQD 240
           EY+NEI  LF+           Y +S    +  + +P         NQ   F    +  +
Sbjct: 153 EYSNEIPELFKANFEGSSTPPPYQESVPSQNPVKNQPSFLHRVQDCNQDVLFADLQKNGE 212

Query: 241 AASGDYDAQFCERYTVPIIPPYFYSIDITP--------QDNTLKVPLPIQLANLNRTIFP 292
             S   +  F ++Y  P +P Y  S  +           D   K+   +   NLN  +  
Sbjct: 213 IDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFRGFQEKNDTKSKLNHIVPHVNLNHLLTS 272

Query: 293 SPEDICNDYLCIGCVISYRGKYMAHLFYRP 322
           S   I ++ + +GC   Y GK++  + Y P
Sbjct: 273 S---IRDEIISVGCTTRYEGKFITQIIYTP 299

>SAKL0G04928g Chr7 complement(405798..408476) [2679 bp, 892 aa] {ON}
           some similarities with uniprot|P32578 Saccharomyces
           cerevisiae YDR422C SIP1 Alternate beta-subunit of the
           Snf1p kinase complex may confer substrate specificity
           vacuolar protein containing KIS (Kinase-Interacting
           Sequence) and ASC (Association with Snf1 kinase Complex)
           domains involved in protein interactions
          Length = 892

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 53/98 (54%), Gaps = 6/98 (6%)

Query: 72  VKLRFRDSHTIPFRVHSVAIQGTDITSKLQRTGKMGGLQQIPLQFEGDSSEWVAPDLYLP 131
           V L++RD    P +   +++  +DI++ L     +   ++IP+++E     W  P+L LP
Sbjct: 528 VVLKWRDCIVDP-KTCKISVISSDISAVL----ALQSSKKIPMEYETTEKSWFVPNLKLP 582

Query: 132 PGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVI 169
           PG YK +F+IN     HS +LP  T   G   N+F V+
Sbjct: 583 PGVYKLQFLINGEL-RHSNFLPTATDSFGNFVNWFEVL 619

 Score = 34.3 bits (77), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 40/88 (45%), Gaps = 14/88 (15%)

Query: 250 FCERYTVPIIPPYFYS------IDITPQDN----TLKVPLP-IQLANLNRTIFPSPEDIC 298
           F ++Y VP +P Y  S       +   +DN    T  V  P I   NLN  +  S   I 
Sbjct: 799 FLQKYPVPDLPIYLNSSYLNKVFNQLQKDNNAGETKAVVNPVIPHVNLNHLLTSS---IR 855

Query: 299 NDYLCIGCVISYRGKYMAHLFYRPSPWE 326
            + + +GC   Y GK++ H+ Y P  +E
Sbjct: 856 EEIISVGCTTRYEGKFITHVVYAPCYYE 883

>NCAS0F01090 Chr6 complement(215542..217905) [2364 bp, 787 aa] {ON}
           Anc_5.527 YDR422C
          Length = 787

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 51/106 (48%), Gaps = 4/106 (3%)

Query: 64  RQPRRRTKVKLRFRDSHTIPFRVHSVAIQGTDITSKLQRTGKMGGLQQIPLQFEGDSSEW 123
            Q     +V L++RD    P     ++I   DI+S +       G  ++P+ F     EW
Sbjct: 422 EQTNDNVQVVLKWRDQIDNPKHC-KISIVSDDISSAIPAKATKAG--KLPMLFNPMIKEW 478

Query: 124 VAPDLYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVI 169
             P+L LPPG Y+ +F IN   + HS +LP  T   G   N+F V+
Sbjct: 479 YVPNLLLPPGIYRLKFSINGDLT-HSNFLPTATDSMGNIVNWFEVL 523

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 43/102 (42%), Gaps = 25/102 (24%)

Query: 243 SGDYDAQ-----FCERYTVPIIPPYFYSI--------------DITPQDNT---LKVPLP 280
           +G+ DA+     F  +Y VP +P Y  S               D TP  NT   + +   
Sbjct: 678 NGNIDAETAEMLFLNKYQVPDLPIYLNSSYLNKIFLQFQKQHNDPTPSANTASTIGITHI 737

Query: 281 IQLANLNRTIFPSPEDICNDYLCIGCVISYRGKYMAHLFYRP 322
           I   NLN  +  S   I ++ + + C   Y+GK++  + Y P
Sbjct: 738 IPHVNLNHLLTSS---IRDEIISVACTTRYQGKFITQVMYAP 776

>NDAI0H01600 Chr8 complement(387297..389825) [2529 bp, 842 aa] {ON}
           Anc_5.527 YDR422C
          Length = 842

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 50/105 (47%), Gaps = 9/105 (8%)

Query: 72  VKLRFRDSHTIPFRVHSVAIQGTDITSKLQRTGK-------MGGLQQIPLQFEGDSSEWV 124
           V L++RD    P +   +AI   DI + L+ +               +P+ F     EW 
Sbjct: 479 VVLKWRDQIDNPKKC-KIAIISDDIVNALESSSSKRKSNTNNNDNNTLPMVFNPMIKEWY 537

Query: 125 APDLYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVI 169
            P+L LPPG Y+ +F IN+  + HS +LP  T   G   N+F V+
Sbjct: 538 MPNLTLPPGIYRLKFSINNDIT-HSNFLPTATDSMGNIVNWFEVL 581

 Score = 34.3 bits (77), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 44/111 (39%), Gaps = 18/111 (16%)

Query: 227 NQKTFFYYAFQEQDAASGDYDAQFCERYTVPIIPPYFYSIDITP---------QDNTLKV 277
           NQ   F    ++ +  +   +A F  RY +P +P Y  S  +            D TL  
Sbjct: 723 NQDKLFADLQRDGNIDAETAEALFLNRYPIPDLPIYLNSTYLNKIFTQFQKQHNDPTLPA 782

Query: 278 PLPIQLA------NLNRTIFPSPEDICNDYLCIGCVISYRGKYMAHLFYRP 322
              I L       NLN  +  S   I ++ + + C   Y+GK++  + Y P
Sbjct: 783 SSSIGLTHIIPHVNLNHLLTSS---IRDEIISVACTTRYQGKFITQVMYAP 830

>Smik_4.697 Chr4 complement(1236081..1238534) [2454 bp, 817 aa] {ON}
           YDR422C (REAL)
          Length = 817

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 43/93 (46%), Gaps = 13/93 (13%)

Query: 89  VAIQGTDITSKLQRTGKMGGLQQIPLQFEGD------------SSEWVAPDLYLPPGEYK 136
           V+I   DI S L+   ++   +   L  E                EW  PDL+LPPG Y+
Sbjct: 470 VSIVSNDIASALKEQREVDADESASLDSEKQLNPRIRMVYDNVHKEWFFPDLFLPPGIYR 529

Query: 137 FRFVINDTCSMHSEYLPILTVGDGIAYNYFVVI 169
            +F IN   + HS YLP  T  +G   N+F V+
Sbjct: 530 LQFSINGLLT-HSNYLPTATDSEGNFVNWFEVL 561

 Score = 36.6 bits (83), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 59/152 (38%), Gaps = 26/152 (17%)

Query: 194 RVEYTNEILPLF---EGYCDS---QQIDHTAQYKPK-----THMNQKTFFYYAFQEQDAA 242
           ++EY+NEI  LF   +G   S   +  D + Q +P         NQ   F    Q  +  
Sbjct: 655 KLEYSNEIPNLFNIADGGTTSVIRESRDSSPQEQPSFTYKVVDCNQDDLFATLQQGGNID 714

Query: 243 SGDYDAQFCERYTVPIIPPYFYSI---DITPQDNTLKVPLP---------IQLANLNRTI 290
           +   +  F  RY +P +P Y  S     I  Q N    P           I   NLN  +
Sbjct: 715 AETAETVFLSRYPIPDLPIYLNSSYLNKILNQSNPNSEPHDRDEGAINHIIPHVNLNHLL 774

Query: 291 FPSPEDICNDYLCIGCVISYRGKYMAHLFYRP 322
             S   I ++ + + C   Y GK++  + Y P
Sbjct: 775 TSS---IRDEIISVACTTRYEGKFITQVIYAP 803

>YDR422C Chr4 complement(1315326..1317773) [2448 bp, 815 aa] {ON}
           SIP1Alternate beta-subunit of the Snf1p kinase complex,
           may confer substrate specificity; vacuolar protein
           containing KIS (Kinase-Interacting Sequence) and ASC
           (Association with Snf1 kinase Complex) domains involved
           in protein interactions
          Length = 815

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 51/112 (45%), Gaps = 14/112 (12%)

Query: 70  TKVKLRFRDSHTIPFRVHSVAIQGTDITSKLQRTGKMGGLQQIPLQFEGD---------- 119
           T V L+++D  T+      V I  TDI S L+   ++   +   L  E            
Sbjct: 452 TLVVLKWKDDGTVAATTE-VFIVSTDIASALKEQRELTLDENASLDSEKQLNPRIRMVYD 510

Query: 120 --SSEWVAPDLYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVI 169
               EW  PDL+LP G Y+ +F IN   + HS +LP  T  +G   N+F V+
Sbjct: 511 DVHKEWFVPDLFLPAGIYRLQFSINGILT-HSNFLPTATDSEGNFVNWFEVL 561

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 59/152 (38%), Gaps = 26/152 (17%)

Query: 194 RVEYTNEILPLF---EGYCDSQQID----HTAQYKPKTHM----NQKTFFYYAFQEQDAA 242
           R+ Y+NEI  LF   +G   S + D    H  +    TH     NQ   F    Q  +  
Sbjct: 655 RLVYSNEIPNLFNIGDGSTISVKGDSDDVHPQEPPSFTHRVVDCNQDDLFATLQQGGNID 714

Query: 243 SGDYDAQFCERYTVPIIPPYFYSI---DITPQDNTLK---------VPLPIQLANLNRTI 290
           +   +A F  RY VP +P Y  S     I  Q N            +   I   NLN  +
Sbjct: 715 AETAEAVFLSRYPVPDLPIYLNSSYLNRILNQSNQNSESHERDEGAINHIIPHVNLNHLL 774

Query: 291 FPSPEDICNDYLCIGCVISYRGKYMAHLFYRP 322
             S   I ++ + + C   Y GK++  + Y P
Sbjct: 775 TSS---IRDEIISVACTTRYEGKFITQVVYAP 803

>Suva_2.599 Chr2 complement(1068063..1070546) [2484 bp, 827 aa] {ON}
           YDR422C (REAL)
          Length = 827

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 54/110 (49%), Gaps = 14/110 (12%)

Query: 72  VKLRFRDSHTIPFRVHSVAIQGTDITSKLQRT--------GKMGGLQQ----IPLQFEGD 119
           V L+++++  +P     V+I   DI S L+            +   +Q    I + ++  
Sbjct: 469 VILKWKNNSNMPATTE-VSIISHDIASTLKEQLEVNLDEDASLDSEKQLNPRIRMIYDAV 527

Query: 120 SSEWVAPDLYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVI 169
             EW  P+L+LPPG Y+ +F IN   + HS +LP  T  +G   N+F V+
Sbjct: 528 HKEWFVPELFLPPGIYRLQFSINGILT-HSNFLPTATDSEGKFVNWFEVL 576

 Score = 34.7 bits (78), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 57/148 (38%), Gaps = 23/148 (15%)

Query: 195 VEYTNEILPLF---EGYCDSQQIDHTAQYKPK-THM----NQKTFFYYAFQEQDAASGDY 246
           +EY+NEI  LF    G     Q D  +Q  P  TH     NQ   F    Q  +  +   
Sbjct: 671 LEYSNEIPSLFTIGNGSATPIQEDLPSQDLPSFTHKVVDCNQDDLFATLQQGGNIDAETA 730

Query: 247 DAQFCERYTVPIIPPYFYSI---DITPQDN---------TLKVPLPIQLANLNRTIFPSP 294
           +  F  RY +P +P Y  S     I  Q N            +   I   NLN  +  S 
Sbjct: 731 EIVFLSRYPIPDLPIYLNSSYLNKILNQGNPNSESGDKDEGAINHIIPHVNLNHLLTSS- 789

Query: 295 EDICNDYLCIGCVISYRGKYMAHLFYRP 322
             I ++ + + C   Y GK++  + Y P
Sbjct: 790 --IRDEIISVACTTRYEGKFITQVIYAP 815

>Kpol_1004.21 s1004 complement(41725..43992) [2268 bp, 755 aa] {ON}
           complement(41725..43992) [2268 nt, 756 aa]
          Length = 755

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 119 DSSEWVAPDLYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVV 168
           D+SEWV   L+LPPG YK +F +N +   HS+YLP  T   G   N+F V
Sbjct: 443 DTSEWVTKYLFLPPGIYKLQFNVNGSL-RHSDYLPTATDNLGNIVNWFEV 491

>TBLA0D01650 Chr4 (406397..409447) [3051 bp, 1016 aa] {ON} Anc_5.527
           YDR422C
          Length = 1016

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 66/150 (44%), Gaps = 26/150 (17%)

Query: 25  RDKRDEHHDGAKYTRENYDNFYNYNLLELVRGQRVPHFYRQPRRR-----TKVKLRFRDS 79
           +D+ D   D +K T     ++++ +       Q V   YR P        TK++L  +D 
Sbjct: 635 KDQLDSPSDLSKVT-----SYFSTDTESAAELQNVIIKYRDPMEESEIPETKIQLISKDI 689

Query: 80  HTIPFRVHSVAIQGTDITSKLQRTGKMGGLQQIPLQFEGDSSEWVAPDLYLPPGEYKFRF 139
           +T    +H       D T  L    KM       L +  D   W+ P+L LPPG Y+ +F
Sbjct: 690 NTT---LH------YDTTDLLTENNKM------ELVYNKDEKAWILPNLMLPPGIYQVQF 734

Query: 140 VINDTCSMHSEYLPILTVGDGIAYNYFVVI 169
           ++N     HS++LP  T   G   N+F V+
Sbjct: 735 LVNSDLK-HSDFLPTATDDFGNIVNWFEVL 763

 Score = 34.3 bits (77), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 60/156 (38%), Gaps = 24/156 (15%)

Query: 194  RVEYTNEILPLFEGYCDSQQIDHTAQYKPK----------THMNQKTFFYYAFQEQDAAS 243
            +VEY+ EI  +F+   ++   +   QY P+             +Q+  F     +    +
Sbjct: 851  KVEYSTEIPEIFKNTTENNTSNAPMQYHPERKRPGLLHNVVDCSQEELFGDLLADGLMDT 910

Query: 244  GDYDAQFCERYTVPIIPPYFYSIDITPQDNTLKVPL----PIQLAN--LNRTIFPS---- 293
               +  F ++Y VP +P Y  S  +T     +  P     P  L N  LN  I P     
Sbjct: 911  ETAEQMFLDKYPVPELPIYLNSKYMTQIVGEINQPSGSGPPSSLNNNDLNH-IIPHVNLQ 969

Query: 294  ---PEDICNDYLCIGCVISYRGKYMAHLFYRPSPWE 326
                  I  + + + C   Y GK++  + Y P  +E
Sbjct: 970  HLLTSSIREEMISVACTTRYEGKFLTQILYTPCFYE 1005

>ZYRO0E08404g Chr5 complement(672301..673347) [1047 bp, 348 aa] {ON}
           some similarities with uniprot|Q04739 Saccharomyces
           cerevisiae YER027C GAL83 One of three possible beta-
           subunits of the Snf1 kinase complex allows nuclear
           localization of the Snf1 kinase complex in the presence
           of a nonfermentable carbon source contains
           glycogen-binding domain and some similarities with
           YGL208W uniprot|P34164 Saccharomyces cerevisiae YGL208W
           SIP2 Member of a family of proteins including Sip1p and
           Gal83p that interact with Snf1p and Snf4p and are
           involved in the response to glucose starvation component
           of Snf1 protein complex involved in response to glucose
           starvation
          Length = 348

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 53/243 (21%), Positives = 91/243 (37%), Gaps = 58/243 (23%)

Query: 105 KMGGLQQIPLQFEGDSSEWVAPDLYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYN 164
           KM GL  +P     D    +   L LP G ++FRF++++     S+YLP  T   G   N
Sbjct: 137 KMIGLVPVP-----DQPGLLHAKLQLPIGTHRFRFIVDNELRF-SDYLPTATDQMGNFVN 190

Query: 165 YF---------------VVIENXXXXXXXXXXXXXMGQDSPLGARVEYTNEILPLFEGYC 209
           Y                + +E                ++ PL  +VEYT +I  +F    
Sbjct: 191 YLEIGRGQKDTLSARSRIAMEIENEPDDIGNGFTRFKEEIPLKPQVEYTQDIPAVFTDPS 250

Query: 210 DSQQIDHTAQYKPKTHMNQKTFFYYAFQEQDAASGDYDAQFCERYTVPIIPPYFYSI--- 266
             +Q                  +Y    +Q      ++ Q     T P +PP+   +   
Sbjct: 251 VMEQ------------------YYLTLDQQQ-----HNHQNMAWLTPPTLPPHLEDVPLN 287

Query: 267 -------DITPQDNTLKVPLPIQLANLNRTIFPSPEDICNDYLCIGCVISYRGKYMAHLF 319
                  D   ++N+  +P+P  +  LN     S   I ++ LC+  ++ Y+ KY+  + 
Sbjct: 288 SYNGIQGDSNNENNSGALPIPNHVV-LNHLATSS---IKHNTLCVASIVRYKRKYVTQIL 343

Query: 320 YRP 322
           Y P
Sbjct: 344 YAP 346

>TDEL0A03910 Chr1 complement(701073..703322) [2250 bp, 749 aa] {ON}
           Anc_5.527 YDR422C
          Length = 749

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 48/103 (46%), Gaps = 3/103 (2%)

Query: 68  RRTKVKLRFRDSHTIPFRVHSVAIQGTDITSKLQRTGKMGGLQ-QIPLQFEGDSSEWVAP 126
            +  V L++RD    P +   + I  TDI S L              ++++   + +  P
Sbjct: 372 EKVHVILKWRDQIEDPSKC-KITIISTDIASALNFDPSDKSFHGTFSMKYDEKENNFYVP 430

Query: 127 DLYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVI 169
           +L LPPG YKF+FVIN     HS  LP  T   G   N+F VI
Sbjct: 431 NLSLPPGIYKFQFVINGEI-RHSNLLPSATDSVGNIVNWFEVI 472

 Score = 36.6 bits (83), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 58/158 (36%), Gaps = 32/158 (20%)

Query: 194 RVEYTNEILPLFE-----GYCDSQQI-------------DHTAQYKPKTHMNQKTFFYYA 235
           + EY+NEI  LF+     G  D  Q              D  +  +     NQ   F   
Sbjct: 582 KYEYSNEIPELFKAGNVLGQSDENQFPTPPPPPMNPPSYDQPSFLENVVDCNQDNLFVSL 641

Query: 236 FQEQDAASGDYDAQFCERYTVPIIPPYFYSIDITP-----------QDNTLKVPLPIQLA 284
            Q     +   +  F E+YTVP +P Y  S  +               N+  +   I   
Sbjct: 642 QQGGLLDAETAEQLFLEKYTVPDLPVYLNSTYLNKIFNEFQKHNSLGSNSSGLNHIIPHV 701

Query: 285 NLNRTIFPSPEDICNDYLCIGCVISYRGKYMAHLFYRP 322
           NLN  +  S   I ++ + +GC   Y GK++  + Y P
Sbjct: 702 NLNHLLTSS---IRDEMISVGCTTRYEGKFITQVVYAP 736

>Skud_4.696 Chr4 complement(1236293..1238728) [2436 bp, 811 aa] {ON}
           YDR422C (REAL)
          Length = 811

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 122 EWVAPDLYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVI 169
           EW  PDL+LP G Y+ +F IN   + HS +LP  T  +G   N+F V+
Sbjct: 512 EWFVPDLFLPAGIYRLQFSINGLLT-HSNFLPTATDSEGNFVNWFEVL 558

 Score = 36.6 bits (83), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 59/152 (38%), Gaps = 26/152 (17%)

Query: 194 RVEYTNEILPLFE--GYCDSQQIDHTAQYKPK-----THM----NQKTFFYYAFQEQDAA 242
           ++EY+NEI  LF       +   DH  +  P+     TH     NQ   F    Q  +  
Sbjct: 651 KLEYSNEIPNLFNIGEASTTTSKDHFERLSPQDRPSFTHKVVDCNQDDLFATLQQGGNID 710

Query: 243 SGDYDAQFCERYTVPIIPPYFYSI---DITPQDNTLK---------VPLPIQLANLNRTI 290
           +   +A F  RY +P +P Y  S     I  Q N            +   I   NLN  +
Sbjct: 711 AETAEAVFLSRYPIPDLPIYLNSSYLNRILNQSNPNSEFHDGDEGGINHIIPHVNLNHLL 770

Query: 291 FPSPEDICNDYLCIGCVISYRGKYMAHLFYRP 322
             S   I ++ + + C   Y GK++  + Y P
Sbjct: 771 TSS---IRDEIISVACTTRYEGKFITQVIYAP 799

>Ecym_4065 Chr4 (144003..146168) [2166 bp, 721 aa] {ON} similar to
           Ashbya gossypii ADR194C
          Length = 721

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 51/113 (45%), Gaps = 16/113 (14%)

Query: 227 NQKTFFYYAFQEQDAASGDYDAQFCERYTVPIIPPYFYSIDITP-----QDNTLKVPLP- 280
           NQ   F+Y  ++ +  + + +  F E+Y+VP +P Y  S  +       Q N+    LP 
Sbjct: 609 NQDELFHYLQEKWNMNAQEAEEVFLEKYSVPDLPIYLNSTSLNEIFNKLQQNSAMGDLPK 668

Query: 281 -------IQLANLNRTIFPSPEDICNDYLCIGCVISYRGKYMAHLFYRPSPWE 326
                  I   NLN  +     +I ++ + +GC   Y GK++  + Y P  +E
Sbjct: 669 RKSLTHIIPHVNLNHLLT---SNIRDEIISVGCTTRYEGKFITQIMYAPCYYE 718

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 52/101 (51%), Gaps = 5/101 (4%)

Query: 69  RTKVKLRFRDSHTIPFRVHSVAIQGTDITSKLQRTGKMGGLQQIPLQFEGDSSEWVAPDL 128
           R +V +++RD++  P R   ++I  +DI S +Q T K    ++IP+ +      W A DL
Sbjct: 361 RVQVIIKWRDTNVDP-RTSKISIISSDIASVVQPTRKR---KKIPMVYLEQEQCWAAEDL 416

Query: 129 YLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVI 169
            LP G YK  F IN     HS YLP  T       N+F V+
Sbjct: 417 KLPAGIYKLMFFINGQV-RHSNYLPTATDSLSNIVNWFEVV 456

>CAGL0A03696g Chr1 (377255..378502) [1248 bp, 415 aa] {ON} similar
           to uniprot|Q04739 Saccharomyces cerevisiae YER027c GAL83
           glucose repression protein
          Length = 415

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 55/245 (22%), Positives = 96/245 (39%), Gaps = 42/245 (17%)

Query: 105 KMGGLQQIPLQFEGDSSEWVAPDLYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYN 164
           KM GL  +P     D    +   L LPPG ++FRF++++     S++LP  T   G   N
Sbjct: 184 KMIGLVPMP-----DQPNVLHVKLQLPPGTHRFRFIVDNELRF-SDFLPTATDQMGNFVN 237

Query: 165 YFVVI------ENXXXXXXXXXXXXXMGQDSPLGAR----VEYTNEILPLFEGYC---DS 211
           Y  +       E                +  P+ AR    +E   E   L  GY    D+
Sbjct: 238 YLEIAPVAGTDEKPPPLTPQVSGKSGDERKEPMSARSRIALEIEREPDDLGNGYSRFHDT 297

Query: 212 QQIDHTAQYKPK-----THMNQKTFFYYAFQEQDAASGDYDAQFCERYTVPIIPPYFYSI 266
             ++   +Y        T  N    +Y    +Q       + Q     T P +PP+  ++
Sbjct: 298 SPLETKYEYTQDIPAVFTDPNVMEQYYLTLDQQ-----KNNHQNMAWLTPPQLPPHLENV 352

Query: 267 DI---------TPQDNTLKVPLPIQLANLNRTIFPSPEDICNDYLCIGCVISYRGKYMAH 317
            +         + ++N+  +P+P  +  LN     S   I ++ LC+  ++ Y+ KY+  
Sbjct: 353 ILNSYSNAQGESNENNSGALPIPNHVI-LNHLATSS---IKHNTLCVASIVRYKRKYVTQ 408

Query: 318 LFYRP 322
           + Y P
Sbjct: 409 ILYAP 413

>NCAS0F03730 Chr6 complement(750798..752096) [1299 bp, 432 aa] {ON}
           Anc_3.517 YER027C
          Length = 432

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 58/262 (22%), Positives = 95/262 (36%), Gaps = 64/262 (24%)

Query: 105 KMGGLQQIPLQFEGDSSEWVAPDLYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYN 164
           KM GL  +P     D    +   L LPPG ++FRF++++     S+YLP  T   G   N
Sbjct: 189 KMIGLVPMP-----DQPNILHVKLQLPPGTHRFRFIVDNELRF-SDYLPTATDQMGNFVN 242

Query: 165 YFVVIENXXXXXXXXXXXXXMG------------------QDSPLGARVEYTNEI----- 201
           Y  + E                                  +D P+ AR     EI     
Sbjct: 243 YLEINEPPSSNTAPTTNTQQQPVIQQQEQFTQSLNDDNKLRDKPISARSRIALEIEREPD 302

Query: 202 ------------LPLFEGYCDSQQIDHTAQYKPKTHMNQKTFFYYAFQEQDAASGDYDAQ 249
                        PL +    +Q I   A +   T M Q   +Y    +Q       + Q
Sbjct: 303 DIGNGFTRFRGETPLLKNIEYTQDI--PAVFTDPTVMEQ---YYLTLDQQQN-----NHQ 352

Query: 250 FCERYTVPIIPPYFYSIDITP---------QDNTLKVPLPIQLANLNRTIFPSPEDICND 300
                T P +PP+  ++ +           ++N+  +P+P  +  LN     S   I ++
Sbjct: 353 NMAWLTPPQLPPHLENVILNSYSNSQGTNNENNSGALPIPNHVI-LNHLATSS---IKHN 408

Query: 301 YLCIGCVISYRGKYMAHLFYRP 322
            LC+  ++ Y+ KY+  + Y P
Sbjct: 409 TLCVASIVRYKRKYVTQILYAP 430

>KAFR0F04140 Chr6 complement(814903..815949) [1047 bp, 348 aa] {ON}
           Anc_3.517 YER027C
          Length = 348

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 50/218 (22%), Positives = 89/218 (40%), Gaps = 30/218 (13%)

Query: 122 EWVAPDLYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVIENXXXXXXXXXX 181
           +W    L LPPG ++FRFV+++     S+ +P  T   G   NY  V             
Sbjct: 142 DWARVRLKLPPGNHRFRFVVDNELRF-SDDVPSATDSMGNLVNYIEV----KPSKRQYES 196

Query: 182 XXXMGQDSPLGARVEYTNEILPLFEGYC-------DSQQIDHTAQYKPKTHMNQKTFF-Y 233
              + Q S +  +++  NE   + +G+        + +Q +++ Q  P    + K    Y
Sbjct: 197 DTKLSQASRIALKIK--NEPDDIGDGFVRYYSSAPEEKQYEYS-QKVPALSTDPKVMEQY 253

Query: 234 YAFQEQDAASGDYDAQFCERYTVPIIPPYFYSIDITPQDNTLK---------VPLPIQLA 284
           Y   +     G  D+        P IPP+F  + +  Q N+L+         +P+P  + 
Sbjct: 254 YIILDVQKRRGRRDSNGISWLMPPQIPPHFDVVILNDQ-NSLQHTDDSNAGFLPIPNHVV 312

Query: 285 NLNRTIFPSPEDICNDYLCIGCVISYRGKYMAHLFYRP 322
            LN  I  S   + ++ L I     Y+ K++  + Y P
Sbjct: 313 -LNHLIVNS---VKSNMLAISTTTRYKEKFITQVCYSP 346

>KNAG0B00600 Chr2 (97910..99079) [1170 bp, 389 aa] {ON} Anc_3.517
           YER027C
          Length = 389

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 85/211 (40%), Gaps = 32/211 (15%)

Query: 128 LYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVIENXXXXXXXXXXXXXMGQ 187
           L LP G +KFRFV+++     S++LP  T   G   NY + ++              M  
Sbjct: 193 LKLPVGTHKFRFVVDNELRF-SDFLPTATDQTGNFVNY-IEVKPSEETLELEKDIKKMSL 250

Query: 188 DSPLGARVEYTNEILPLFEGYCDSQQIDHTAQYKPKTHMNQKTFFY-----YAFQEQDAA 242
            S L  ++   +E   +  GY          +Y   T++  +T+ Y       F++    
Sbjct: 251 RSKLALKIR--SEPDNIDNGY---------TRYHDSTNLALETYKYITKIPVVFRDPKIM 299

Query: 243 SGDY---DAQFCERYTVPIIPPYFYS-----IDITPQDNTLKVPLPIQLAN---LNRTIF 291
              Y   +    + +   ++PP   S     I     ++T   P  +   N   LN  + 
Sbjct: 300 EQYYQTVEQNKNKSHMAWLLPPELPSQLERCILNNKNEDTDNGPCELTTPNYVTLNHLLT 359

Query: 292 PSPEDICNDYLCIGCVISYRGKYMAHLFYRP 322
            S   I N+ LC+GC + YR KY+  ++Y P
Sbjct: 360 SS---IKNNMLCLGCSVRYRQKYVTQVYYTP 387

>NCAS0E00620 Chr5 (106661..108163) [1503 bp, 500 aa] {ON} Anc_3.517
          Length = 500

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 52/239 (21%), Positives = 88/239 (36%), Gaps = 55/239 (23%)

Query: 128 LYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVV------------------- 168
           L LP G ++FRF++++     S++LP  T   G   NY  V                   
Sbjct: 271 LQLPAGTHRFRFIVDNELKF-SDFLPTATDQTGNFVNYLEVKPPPPPVPAGQSSDSKSSS 329

Query: 169 -----IENXXXXXXXXXXXXXMGQDSPLGAR----VEYTNEILPLFEGYCDSQQIDHTAQ 219
                  +              G   P+ AR    +E  N+     +GY    +  H   
Sbjct: 330 ERKRRRSSVSSRKSKASEKDGKGGMEPMSARSRIPMEIRNDPDDFGDGYS---RFVHEES 386

Query: 220 YKPKTHMNQK--TFF--------YYAFQEQDAASGDYDAQFCERYTVPIIPPYFYSI--- 266
             P     Q+  T F        YY   ++   S     Q+    T P +PP+  +I   
Sbjct: 387 STPNFEYTQEIPTVFTDPKVMEEYYLTLDRKKNSNSSSLQWL---TPPQLPPHLENIILN 443

Query: 267 ---DITPQDNTLKVPLPIQLANLNRTIFPSPEDICNDYLCIGCVISYRGKYMAHLFYRP 322
              D + ++ +  +P+P  +  LN  +  S   I ++ LC+  +I Y+ KY+  + Y P
Sbjct: 444 SSQDTSNENTSGALPIPNHVV-LNHLVTTS---IKHNTLCVASIIRYKHKYVTQILYAP 498

>Smik_5.150 Chr5 complement(213879..215132) [1254 bp, 417 aa] {ON}
           YER027C (REAL)
          Length = 417

 Score = 38.9 bits (89), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 53/226 (23%), Positives = 85/226 (37%), Gaps = 45/226 (19%)

Query: 128 LYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVIENXXXXXXXXXXXXXMGQ 187
           L LPPG ++FRF++++     S+YLP  T   G   NY  V                 G 
Sbjct: 204 LQLPPGTHRFRFIVDNELRF-SDYLPTATDQMGNFVNYMEVT----APPDWSSEPQQQGS 258

Query: 188 DS-------------PLGAR----VEYTNEILPLFEGYC---DSQQIDHTAQYKPK---- 223
           D+             P+ AR    +E   E   + +GY    D        +Y       
Sbjct: 259 DNKANYADDDKLNKRPMSARSRIALEIEKEPDDMGDGYTRFHDETPAKPNLEYTQDIPAV 318

Query: 224 -THMNQKTFFYYAFQEQDAASGDYDAQFCERYTVPIIPPYFYSIDITP-----QDNTL-K 276
            T  N    +Y    +Q       + Q     T P +PP+  ++ +        DNT   
Sbjct: 319 FTDPNVMEQYYLTLDQQQN-----NHQNMAWLTPPQLPPHLENVILNSYSNAQTDNTSGA 373

Query: 277 VPLPIQLANLNRTIFPSPEDICNDYLCIGCVISYRGKYMAHLFYRP 322
           +P+P  +  LN     S   I ++ LC+  ++ Y+ KY+  + Y P
Sbjct: 374 LPIPNHVI-LNHLATSS---IKHNTLCVASIVRYKQKYVTQILYTP 415

>Suva_5.123 Chr5 complement(184865..186136) [1272 bp, 423 aa] {ON}
           YER027C (REAL)
          Length = 423

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 49/228 (21%), Positives = 84/228 (36%), Gaps = 46/228 (20%)

Query: 128 LYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVI---------ENXXXXXXX 178
           L LPPG ++FRF++++     S+YLP  T   G   NY  V          +        
Sbjct: 207 LQLPPGTHRFRFIVDNELRF-SDYLPTATDQMGNFVNYMEVTAPPDWSNEPQQQASDNKS 265

Query: 179 XXXXXXMGQDSPLGAR----VEYTNEILPLFEGYCDSQQIDHTAQYKPK----------- 223
                      P+ AR    +E   E   + +GY    +    A  KP            
Sbjct: 266 NHADDSQSAKRPMSARSRIALEIEKEPDDMGDGYT---RFHDEAPPKPDLEYTQDIPAVF 322

Query: 224 THMNQKTFFYYAFQEQDAASGDYDAQFCERYTVPIIPPYFYSIDI---------TPQDNT 274
           T  N    +Y    +Q       + Q     T P +PP+  ++ +           ++ +
Sbjct: 323 TDPNVMEQYYLTLDQQQN-----NHQNMAWLTPPQLPPHLENVILNNYSNAQTDNNENTS 377

Query: 275 LKVPLPIQLANLNRTIFPSPEDICNDYLCIGCVISYRGKYMAHLFYRP 322
             +P+P  +  LN     S   I ++ LC+  ++ Y+ KY+  + Y P
Sbjct: 378 GALPIPNHVI-LNHLATSS---IKHNTLCVASIVRYKQKYVTQILYTP 421

>Suva_7.53 Chr7 (93895..95139) [1245 bp, 414 aa] {ON} YGL208W (REAL)
          Length = 414

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 63/286 (22%), Positives = 107/286 (37%), Gaps = 47/286 (16%)

Query: 64  RQPRRRTKVKLRFRDSHTIPFRVHSVAIQGTDITSKLQRTGKMGGLQQ-IPLQFEGDSSE 122
           ++ + +T+ + R ++S  +P     V I+     SK+  TG     ++ I L  + D S 
Sbjct: 145 KRSKNKTEDESRIKNSLMVP-----VEIRWQQGGSKVYVTGSFTKWRKMIGLVPDSDKSG 199

Query: 123 WVAPDLYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVIE-NXXXXXXXXXX 181
                L L PG ++FRFV+++   + S++LP  T   G   NY  V   +          
Sbjct: 200 SFHVKLRLLPGTHRFRFVVDNELRV-SDFLPTATDQMGNFVNYIEVRHPDKKSIDGTNIS 258

Query: 182 XXXMGQDSPLGARVEYTNEILPLFEGYCDSQQIDHTAQYKPKTHMNQKTFFYYAFQEQDA 241
                   P+  R     +I    + + D     H     PK      T     F     
Sbjct: 259 KTKYSVKPPISDRSSIALQIGKDPDDFGDGYTRFH-EDLSPKPPAEYTTDIPAVF----- 312

Query: 242 ASGDYDAQFCERY----------------TVPIIPPYFYSI---------DITPQDNTLK 276
                D    ERY                T P +PP   ++         D   ++N+  
Sbjct: 313 ----TDPSVMERYYYTLDREKNKNDTSWLTPPQLPPQLENVILNKYCTTQDQVNENNSGA 368

Query: 277 VPLPIQLANLNRTIFPSPEDICNDYLCIGCVISYRGKYMAHLFYRP 322
           +P+P  +  LN  I  S   I ++ LC+  ++ Y+ KY+  + Y P
Sbjct: 369 LPIPNHVV-LNHLITSS---IKHNTLCVSSIVRYKQKYVTQILYTP 410

>Skud_5.136 Chr5 complement(206871..208127) [1257 bp, 418 aa] {ON}
           YER027C (REAL)
          Length = 418

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 51/222 (22%), Positives = 83/222 (37%), Gaps = 37/222 (16%)

Query: 128 LYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVI---------ENXXXXXXX 178
           L LPPG ++FRF++++     S+YLP  T   G   NY  V          +        
Sbjct: 205 LQLPPGTHRFRFIVDNELRF-SDYLPTATDQMGNFVNYMEVSAPPDWTNEPQQQVTDNKA 263

Query: 179 XXXXXXMGQDSPLGAR----VEYTNEILPLFEGYC---DSQQIDHTAQYKPK-----THM 226
                      P+ AR    +E   E   + +GY    D        +Y        T  
Sbjct: 264 YHADDNQSTKRPMSARSRIALEIEKEPDDMGDGYTRFHDETPSKPNLEYTQDIPAVFTDP 323

Query: 227 NQKTFFYYAFQEQDAASGDYDAQFCERYTVPIIPPYFYSIDITP-----QDNTL-KVPLP 280
           N    +Y    +Q       + Q     T P +PP+  ++ +        DNT   +P+P
Sbjct: 324 NVMEQYYLTLDQQQN-----NHQNMAWLTPPQLPPHLENVILNSYSNAQTDNTSGALPIP 378

Query: 281 IQLANLNRTIFPSPEDICNDYLCIGCVISYRGKYMAHLFYRP 322
             +  LN     S   I ++ LC+  ++ Y+ KY+  + Y P
Sbjct: 379 NHVI-LNHLATSS---IKHNTLCVASIVRYKQKYVTQILYTP 416

>TBLA0I03270 Chr9 complement(793849..795150) [1302 bp, 433 aa] {ON}
           Anc_3.517 YER027C
          Length = 433

 Score = 38.5 bits (88), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 69/282 (24%), Positives = 107/282 (37%), Gaps = 69/282 (24%)

Query: 92  QGTD---ITSKLQRTGKMGGLQQIPLQFEGDSSEWVAPDLYLPPGEYKFRFVINDTCSMH 148
           QG D   +T       KM GL  +P     D    +   L LPPG ++FRF++++     
Sbjct: 168 QGGDKVYVTGSFTGWRKMIGLVPVP-----DQPGLLHVKLQLPPGTHRFRFIVDNELRF- 221

Query: 149 SEYLPILTVGDGIAYNYFVVI-------ENX-----XXXXXXXXXXXXMG-------QDS 189
           S++LP  T   G   NY  V+       EN                  MG       QD+
Sbjct: 222 SDFLPTATDQMGNFVNYLEVVAPPTTVDENIGGNLPNQTADSSNYQQDMGAGKPIYKQDN 281

Query: 190 ------PLGARVEYTNEILP----LFEGYCD-------SQQIDHT----AQYKPKTHMNQ 228
                 P+ AR     EI      L +G+          Q +++T    A +   T M Q
Sbjct: 282 QAQTKQPMSARSRIAFEIEKEPDDLGDGFTRFHEEKPLKQDVEYTQDIPAVFTDPTVMEQ 341

Query: 229 KTFFYYAFQEQDAASGDYDAQFCERYTVPIIPPYF-------YSIDITPQDNTL-KVPLP 280
              +Y    +Q       + Q     T P +PP+        YS   +  +NT   +P+P
Sbjct: 342 ---YYLTLDQQQN-----NHQNMAWLTPPQLPPHLENVILNSYSGSGSDNENTSGALPIP 393

Query: 281 IQLANLNRTIFPSPEDICNDYLCIGCVISYRGKYMAHLFYRP 322
             +  LN     S   I ++ LC+  ++ Y+ KY+  + Y P
Sbjct: 394 NHVV-LNHLATSS---IKHNTLCVASIVRYKSKYVTQILYAP 431

>YER027C Chr5 complement(208979..210232) [1254 bp, 417 aa] {ON}
           GAL83One of three possible beta-subunits of the Snf1
           kinase complex, allows nuclear localization of the Snf1
           kinase complex in the presence of a nonfermentable
           carbon source; contains glycogen-binding domain
          Length = 417

 Score = 38.1 bits (87), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 51/222 (22%), Positives = 83/222 (37%), Gaps = 37/222 (16%)

Query: 128 LYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVI---------ENXXXXXXX 178
           L LPPG ++FRF++++     S+YLP  T   G   NY  V          +        
Sbjct: 204 LQLPPGTHRFRFIVDNELRF-SDYLPTATDQMGNFVNYMEVSAPPDWGNEPQQHLAEKKA 262

Query: 179 XXXXXXMGQDSPLGAR----VEYTNEILPLFEGYC---DSQQIDHTAQYKPK-----THM 226
                      P+ AR    +E   E   + +GY    D        +Y        T  
Sbjct: 263 NHVDDSKLSKRPMSARSRIALEIEKEPDDMGDGYTRFHDETPAKPNLEYTQDIPAVFTDP 322

Query: 227 NQKTFFYYAFQEQDAASGDYDAQFCERYTVPIIPPYFYSIDITP-----QDNTL-KVPLP 280
           N    +Y    +Q       + Q     T P +PP+  ++ +        DNT   +P+P
Sbjct: 323 NVMEQYYLTLDQQQN-----NHQNMAWLTPPQLPPHLENVILNSYSNAQTDNTSGALPIP 377

Query: 281 IQLANLNRTIFPSPEDICNDYLCIGCVISYRGKYMAHLFYRP 322
             +  LN     S   I ++ LC+  ++ Y+ KY+  + Y P
Sbjct: 378 NHVI-LNHLATSS---IKHNTLCVASIVRYKQKYVTQILYTP 415

>KNAG0E01590 Chr5 complement(317054..318325) [1272 bp, 423 aa] {ON}
           Anc_3.517 YER027C
          Length = 423

 Score = 38.1 bits (87), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 55/249 (22%), Positives = 91/249 (36%), Gaps = 73/249 (29%)

Query: 128 LYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVIENXXXXXXXXXXXXXMGQ 187
           L LPPG +KFRF++++     S+YLP  T   G   NY  V+               +GQ
Sbjct: 192 LQLPPGTHKFRFIVDNELRF-SDYLPTATDQMGNFVNYLEVV--------APPAAPQLGQ 242

Query: 188 DSPLGARVEYTNEILPLFEGYCDSQQIDHTAQYKP---KTHMNQKTFFYYAF-QEQDAAS 243
                   ++ +E + L        Q   TA Y     KT M+ ++   +   QE D   
Sbjct: 243 TQNEINDQQWNDEQMGL------PAQDRDTATYPSATRKTPMSARSRIAFEIEQEPDDMG 296

Query: 244 GDY------------------------DAQFCERY-----------------TVPIIPPY 262
           G Y                        D    E+Y                 T P +PP+
Sbjct: 297 GGYTRFHDETPSKPSLVFTRDIPAVFTDPAVMEQYYLTLDQQQNNHQNMAWLTPPQLPPH 356

Query: 263 FYSIDI---------TPQDNTLKVPLPIQLANLNRTIFPSPEDICNDYLCIGCVISYRGK 313
             ++ +         + ++N+  +P+P  +  LN     S   I ++ LC+  ++ Y+ K
Sbjct: 357 LENVILNSYSSLQGESNENNSGALPIPNHVI-LNHLATSS---IKHNTLCVASIVRYKQK 412

Query: 314 YMAHLFYRP 322
           Y   + Y P
Sbjct: 413 YATQILYAP 421

>TDEL0D05850 Chr4 complement(1062927..1064141) [1215 bp, 404 aa]
           {ON} Anc_3.517 YER027C
          Length = 404

 Score = 38.1 bits (87), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 49/229 (21%), Positives = 88/229 (38%), Gaps = 47/229 (20%)

Query: 128 LYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVI----------ENXXXXXX 177
           L LP G ++FRF++++     S+YLP  T   G   NY  VI          ++      
Sbjct: 187 LQLPVGTHRFRFIVDNELRF-SDYLPTATDQMGNFVNYLEVIAPPSQEKPQTKDKQRDNE 245

Query: 178 XXXXXXXMGQDSPLGAR----VEYTNEILPLFEGYCDSQQ-----------IDHTAQYKP 222
                       P+ AR    +E   E   +  G+   ++            D  A +  
Sbjct: 246 NKNDVARRKTTDPVSARSRIALEIEKEPDEIGNGFTRFREELTLGPSLEYTQDIPAVFTD 305

Query: 223 KTHMNQKTFFYYAFQEQDAASGDYDAQFCERYTVPIIPPYFYSIDI---------TPQDN 273
            T M Q   +Y    +Q       + Q     T P +PP+  ++ +         + ++N
Sbjct: 306 PTVMEQ---YYLTLDQQQN-----NHQNMAWLTPPQLPPHLENVPLNSYTNSQNDSNENN 357

Query: 274 TLKVPLPIQLANLNRTIFPSPEDICNDYLCIGCVISYRGKYMAHLFYRP 322
           +  +P+P  +  LN     S   I ++ LC+  ++ Y+ KY+  + Y P
Sbjct: 358 SGALPIPNHVV-LNHLATSS---IKHNTLCVASIVRYKRKYVTQILYAP 402

>YGL208W Chr7 (97338..98585) [1248 bp, 415 aa] {ON}  SIP2One of
           three beta subunits of the Snf1 serine/threonine protein
           kinase complex involved in the response to glucose
           starvation; null mutants exhibit accelerated aging;
           N-myristoylprotein localized to the cytoplasm and the
           plasma membrane
          Length = 415

 Score = 36.6 bits (83), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 66/296 (22%), Positives = 116/296 (39%), Gaps = 55/296 (18%)

Query: 63  YRQPRRRTKVKLRFRDSHTIPFRVHS-----VAIQGTDITSKLQRTG------KMGGLQQ 111
           +  PR   + ++R +++   P  + S     V I+     SK+  TG      KM GL  
Sbjct: 135 HSSPREEGQQQIRAKEASGGPSEIKSSLMVPVEIRWQQGGSKVYVTGSFTKWRKMIGL-- 192

Query: 112 IPLQFEGDSSEWVAPDLYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVIE- 170
           IP   + D++      L L PG ++FRF++++   + S++LP  T   G   NY  V + 
Sbjct: 193 IP---DSDNNGSFHVKLRLLPGTHRFRFIVDNELRV-SDFLPTATDQMGNFVNYIEVRQP 248

Query: 171 --NXXXXXXXXXXXXXMGQDSPLGARVEYTNEILPLFEGYCDSQQIDHTAQYKPKTHMNQ 228
             N             M    P   R     +I    + + D     H     P+  +  
Sbjct: 249 EKNPTNEKIRSKEADSMR--PPTSDRSSIALQIGKDPDDFGDGYTRFH-EDLSPRPPLEY 305

Query: 229 KT-------------FFYYAFQEQDAASGDYDAQFCERYTVPIIPP---------YFYSI 266
            T              +YY    Q +   + D  +    T P +PP         Y+ + 
Sbjct: 306 TTDIPAVFTDPSVMERYYYTLDRQQS---NTDTSWL---TPPQLPPQLENVILNKYYATQ 359

Query: 267 DITPQDNTLKVPLPIQLANLNRTIFPSPEDICNDYLCIGCVISYRGKYMAHLFYRP 322
           D   ++N+  +P+P  +  LN  +  S   I ++ LC+  ++ Y+ KY+  + Y P
Sbjct: 360 DQFNENNSGALPIPNHVV-LNHLVTSS---IKHNTLCVASIVRYKQKYVTQILYTP 411

>KAFR0I02380 Chr9 (482219..483448) [1230 bp, 409 aa] {ON} Anc_3.517
           YER027C
          Length = 409

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 128 LYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVI 169
           L LPPG ++FRF++++     S+YLP  T   G   NY  VI
Sbjct: 178 LQLPPGTHRFRFIVDNELRF-SDYLPTATDQMGNFVNYLEVI 218

 Score = 30.0 bits (66), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 35/77 (45%), Gaps = 13/77 (16%)

Query: 255 TVPIIPPYFYSIDITPQDNTL---------KVPLPIQLANLNRTIFPSPEDICNDYLCIG 305
           T P +PP+  ++ +    N+           +P+P  +  LN     S   I ++ LC+ 
Sbjct: 335 TPPQLPPHLENVILNSYSNSQGESNENTSGALPIPNHVI-LNHLATSS---IKHNTLCVA 390

Query: 306 CVISYRGKYMAHLFYRP 322
            ++ YR KY+  + Y P
Sbjct: 391 SIVRYRQKYVTQILYAP 407

>Ecym_1210 Chr1 (423627..424979) [1353 bp, 450 aa] {ON} similar to
           Ashbya gossypii AER361C
          Length = 450

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 49/243 (20%), Positives = 87/243 (35%), Gaps = 59/243 (24%)

Query: 128 LYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVIENXXXXXXXXXXXXX-MG 186
           L LPPG ++FRF++++     S++LP  T   G   NY  ++ +              + 
Sbjct: 217 LQLPPGTHRFRFIVDNELRF-SDFLPTATDQMGNFVNYMEIVASPPSQEQQPASDLQYVS 275

Query: 187 QDSPLGARVEYTNEILPLFEGYCD--SQQIDHTAQYKPKTHM--------NQKTFFYYAF 236
            + P+   VE       + EG  D  S  +D       ++ +        +     Y  F
Sbjct: 276 DEGPISKHVEN------IREGRSDAASAAVDEERGMSSRSKLALQIEDDPDDMGDGYTRF 329

Query: 237 QEQD-------------------AASGDY---------DAQFCERYTVPIIPP------- 261
           +E+                    +  G Y         + Q     T P +PP       
Sbjct: 330 REESKEIPVYEFTQDIPAVFTDPSVMGQYYLTLDQQKNNQQNLAWLTPPQLPPHLEHVIL 389

Query: 262 --YFYSIDITPQDNTLKVPLPIQLANLNRTIFPSPEDICNDYLCIGCVISYRGKYMAHLF 319
             Y  S D   ++ +  +P+P  +  LN     S   I ++ LC+  ++ Y+ KY   + 
Sbjct: 390 NHYNKSADGASENTSGALPIPNHVV-LNHLATSS---IKHNTLCVASIVRYKSKYATQIL 445

Query: 320 YRP 322
           Y P
Sbjct: 446 YAP 448

>Smik_7.55 Chr7 (92235..93482) [1248 bp, 415 aa] {ON} YGL208W (REAL)
          Length = 415

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 35/65 (53%), Gaps = 4/65 (6%)

Query: 258 IIPPYFYSIDITPQDNTLKVPLPIQLANLNRTIFPSPEDICNDYLCIGCVISYRGKYMAH 317
           I+  Y+ + D   ++N+  +P+P  +  LN  I  S   I ++ LC+  ++ Y+ KY+  
Sbjct: 351 ILNKYYMTQDQFNENNSGALPIPNHVV-LNHLITSS---IKHNTLCVASIVRYKQKYVTQ 406

Query: 318 LFYRP 322
           + Y P
Sbjct: 407 ILYAP 411

>Kpol_195.2 s195 complement(4330..5637) [1308 bp, 435 aa] {ON}
           complement(4330..5637) [1308 nt, 436 aa]
          Length = 435

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 31/145 (21%), Positives = 59/145 (40%), Gaps = 36/145 (24%)

Query: 187 QDSPLGARVEYTNEILPLFEGYCDSQQIDHTAQYKPKTHMNQKTFFYYAFQEQDAASGDY 246
           ++ PL  ++EYT +I  +F      +Q                  +Y    +Q       
Sbjct: 316 EEKPLKPQLEYTQDIPAVFTDPTVMEQ------------------YYLTLDQQQN----- 352

Query: 247 DAQFCERYTVPIIPPYFYSIDI---------TPQDNTLKVPLPIQLANLNRTIFPSPEDI 297
           + Q     T P +PP+  ++ +         T Q+N+  +P+P  +  LN     S   I
Sbjct: 353 NHQNLSWLTPPQLPPHLENVILNSYSSNSPETGQNNSGSLPIPNHVV-LNHLATSS---I 408

Query: 298 CNDYLCIGCVISYRGKYMAHLFYRP 322
            ++ LC+  ++ Y+ KY+  + Y P
Sbjct: 409 KHNTLCVASIVRYKRKYVTQILYAP 433

 Score = 33.9 bits (76), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 128 LYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVI 169
           L LPPG +KFRF++++     S++LP  T   G   NY   +
Sbjct: 178 LQLPPGTHKFRFIVDNELRF-SDFLPTATDQMGNFVNYLEAV 218

>SAKL0F02002g Chr6 (167591..169102) [1512 bp, 503 aa] {ON} similar
           to gnl|GLV|CAGL0A03696g Candida glabrata CAGL0A03696g
           and similar to YER027C uniprot|Q04739 Saccharomyces
           cerevisiae YER027C GAL83 One of three possible
           beta-subunits of the Snf1 kinase complex allows nuclear
           localization of the Snf1 kinase complex in the presence
           of a nonfermentable carbon source contains
           glycogen-binding domain and similar to YGL208W
           uniprot|P34164 Saccharomyces cerevisiae YGL208W SIP2
           Member of a family of proteins including Sip1p and
           Gal83p that interact with Snf1p and Snf4p and are
           involved in the response to glucose starvation component
           of Snf1 protein complex involved in response to glucose
           starvation
          Length = 503

 Score = 34.7 bits (78), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 128 LYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVI 169
           L LPPG ++FRF++++     S+YLP  T   G   NY  ++
Sbjct: 253 LQLPPGTHRFRFIVDNELRF-SDYLPTATDQMGNFVNYMEIV 293

>Skud_7.60 Chr7 (102699..104024) [1326 bp, 441 aa] {ON} YGL208W
           (REAL)
          Length = 441

 Score = 34.3 bits (77), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 46/212 (21%), Positives = 81/212 (38%), Gaps = 23/212 (10%)

Query: 128 LYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVIE-NXXXXXXXXXXXXXMG 186
           L L PG ++FRF++++   + S++LP  T   G   NY  V +                 
Sbjct: 232 LRLLPGTHRFRFIVDNELRV-SDFLPTATDQMGNFVNYIEVRQPQKKLTDDKKRFKKAYL 290

Query: 187 QDSPLGARVEYTNEILPLFEGYCDSQQIDHTAQYKPKTHMNQKTF-------------FY 233
              P   R     +I    + + D     H     PK  +   T              +Y
Sbjct: 291 MQPPTSDRSSIALQIGKDPDDFGDGYTRFH-EDLSPKPSLEYTTNIPAVFTDPSVMERYY 349

Query: 234 YAF---QEQDAASGDYDAQFCERYTVPIIPPYFYSIDITPQDNTLKVPLPIQLANLNRTI 290
           Y     Q Q+  S     Q   +    I+  Y+ + D   ++N+  +P+P  +  LN  +
Sbjct: 350 YTLDREQNQNDTSWLTPPQLPPQLENVILNKYYATQDQFNENNSGALPIPNHVV-LNHLV 408

Query: 291 FPSPEDICNDYLCIGCVISYRGKYMAHLFYRP 322
             S   I ++ LC+  ++ Y+ KY+  + Y P
Sbjct: 409 TSS---IKHNTLCVASIVRYKQKYVTQILYTP 437

>NDAI0B06010 Chr2 complement(1460221..1461732) [1512 bp, 503 aa]
           {ON} Anc_3.517 YER027C
          Length = 503

 Score = 34.3 bits (77), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 128 LYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVIE 170
           L LPPG ++FRF++++     S+YLP  T   G   NY  + E
Sbjct: 251 LQLPPGTHRFRFIVDNELRF-SDYLPTATDQMGNFVNYLEINE 292

>KLLA0B00583g Chr2 complement(44819..46279) [1461 bp, 486 aa] {ON}
           uniprot|Q00995 Kluyveromyces lactis FOG1 protein
          Length = 486

 Score = 34.3 bits (77), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 128 LYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVI 169
           L LPPG ++FRF++++     S++LP  T   G   NY  ++
Sbjct: 241 LQLPPGTHRFRFIVDNELRF-SDFLPTATDQMGNFVNYLEIV 281

>AER361C Chr5 complement(1307677..1309104) [1428 bp, 475 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER027C
           (GAL83) and YGL208W (SIP2)
          Length = 475

 Score = 33.9 bits (76), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 49/249 (19%), Positives = 87/249 (34%), Gaps = 65/249 (26%)

Query: 128 LYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVIENXXXXXXXXXXXXXMGQ 187
           L LPPG ++FRF++++     S++L   T   G   NY  ++                  
Sbjct: 236 LQLPPGTHRFRFIVDNELRF-SDFLLTATDQMGNFVNYLEIVSPQPAGQQHIQAPHAPRL 294

Query: 188 DSPLG-ARVEYTN--EILPLFEGYCDSQQIDHTAQYKPKTHMNQKTFFYYAFQEQDAASG 244
            +P   A+  +TN  ++ P      D  +ID  A  + +  M+ ++      +E+    G
Sbjct: 295 QAPFDQAQSTHTNPSDLRP------DDARIDGDAYSRTEKQMSARSKLALQIEEEPDDMG 348

Query: 245 DYDAQFCER------------------------------------------YTVPIIPP- 261
           D   +F E                                            T P +PP 
Sbjct: 349 DGYTRFHEEIKTKPAYEFTQDIPAVFTDPSVMGQYYLTLDQQQHNQQNLAWLTPPQLPPH 408

Query: 262 --------YFYSIDITPQDNTLKVPLPIQLANLNRTIFPSPEDICNDYLCIGCVISYRGK 313
                   Y  S D   ++ +  +P+P  +  LN     S   I ++ LC+  ++ Y+ K
Sbjct: 409 LEHVILNHYNKSADGVSENTSGALPIPNHVV-LNHLATSS---IKHNTLCVASIVRYKQK 464

Query: 314 YMAHLFYRP 322
           Y   + Y P
Sbjct: 465 YATQILYAP 473

>TPHA0A05810 Chr1 complement(1317530..1318804) [1275 bp, 424 aa]
           {ON} Anc_3.517 YER027C
          Length = 424

 Score = 33.5 bits (75), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 128 LYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVI 169
           L LPPG +KFRF++++     S++LP  T   G   NY   +
Sbjct: 183 LQLPPGTHKFRFIVDNELRF-SDFLPTATDQMGNFVNYLEAV 223

>Kwal_47.19040 s47 complement(1073036..1074325) [1290 bp, 429 aa]
           {ON} YER027C (GAL83) - glucose repression protein, a
           component of the Snf1 complex [contig 188] FULL
          Length = 429

 Score = 33.5 bits (75), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 128 LYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVI 169
           L LPPG ++FRF++++     S++LP  T   G   NY  ++
Sbjct: 168 LQLPPGTHRFRFIVDNELRF-SDFLPTATDQMGNFVNYLEIV 208

>NDAI0I02890 Chr9 complement(682274..684022) [1749 bp, 582 aa] {ON}
           Anc_3.517 YER027C
          Length = 582

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 128 LYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVV 168
           L LP G ++FRF++++     S+YLP  T   G   NY  V
Sbjct: 280 LQLPEGTHRFRFIVDNELRF-SDYLPTATDQTGNFVNYLEV 319

>YOR346W Chr15 (981828..984785) [2958 bp, 985 aa] {ON}
           REV1Deoxycytidyl transferase; involved in repair of
           abasic sites and adducted guanines in damaged DNA by
           translesion synthesis (TLS); forms a complex with the
           subunits of DNA polymerase zeta, Rev3p and Rev7p;
          Length = 985

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 20/35 (57%)

Query: 266 IDITPQDNTLKVPLPIQLANLNRTIFPSPEDICND 300
           +D+ P +N LK+ LP +    NR     PED+ ND
Sbjct: 736 VDVGPDNNQLKLRLPFKTIVTNRAFEALPEDVKND 770

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.139    0.432 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 36,144,374
Number of extensions: 1592650
Number of successful extensions: 3267
Number of sequences better than 10.0: 50
Number of HSP's gapped: 3303
Number of HSP's successfully gapped: 81
Length of query: 326
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 216
Effective length of database: 40,868,139
Effective search space: 8827518024
Effective search space used: 8827518024
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 66 (30.0 bits)