Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0B026507.342ON64628710741e-137
Smik_12.2647.342ON6122936396e-74
TDEL0C020507.342ON5012875907e-68
Skud_4.947.342ON4472875735e-66
Smik_4.757.342ON4602875562e-63
Suva_4.837.342ON4622875449e-62
KAFR0L014607.342ON5501355464e-61
YLR206W (ENT2)7.342ON6131405461e-60
Suva_10.3007.342ON6181405401e-59
Skud_12.2707.342ON6261405391e-59
NCAS0H006707.342ON4831405135e-57
TBLA0E004807.342ON5991445197e-57
NDAI0D006107.342ON4861404961e-54
TPHA0D045607.342ON4871354961e-54
CAGL0A03872g7.342ON5101404944e-54
YDL161W (ENT1)7.342ON4541404887e-54
Kpol_2001.707.342ON5331404885e-53
ZYRO0F11550g7.342ON5381404832e-52
SAKL0F10934g7.342ON4982874802e-52
Kwal_56.246107.342ON5081404724e-51
KLTH0H01430g7.342ON5021354653e-50
KNAG0C038007.342ON4471364456e-48
Ecym_47317.342ON5141404436e-47
KAFR0B008907.342ON4141364323e-46
KLLA0C16731g7.342ON4781404363e-46
ACL157C7.342ON5151314215e-44
TBLA0E020407.342ON7011404261e-43
KLLA0B04587g4.346ON4001402132e-17
NDAI0D032004.346ON4351352123e-17
KNAG0M003804.346ON4031352105e-17
Kpol_1001.24.346ON4181402105e-17
TBLA0E047604.346ON4261402089e-17
SAKL0G17952g4.346ON4151402071e-16
TDEL0D007104.346ON3751402015e-16
NCAS0A062104.346ON4231352026e-16
AER155C4.346ON3641401981e-15
KLTH0D16896g4.346ON4011341981e-15
ZYRO0B14784g4.346ON4241341982e-15
Skud_10.3494.346ON4101341972e-15
Kwal_47.168574.346ON3821341962e-15
Suva_12.2164.346ON4101341963e-15
YJR125C (ENT3)4.346ON4081341954e-15
TPHA0B004004.346ON3991351936e-15
KAFR0B067404.346ON3991341936e-15
Smik_10.4184.346ON4091341911e-14
Ecym_11334.346ON3921401865e-14
CAGL0H04323g4.346ON4121241794e-13
SAKL0H25762g4.17ON2621411471e-09
TBLA0B062204.346ON3391341402e-08
Kpol_388.54.17ON2681461329e-08
Kwal_55.206114.17ON2541121311e-07
Ecym_84074.17ON2541161292e-07
ZYRO0G07876g4.17ON259991293e-07
TBLA0G006504.17ON4231331279e-07
TPHA0F002304.17ON2801331222e-06
KLTH0E05874g4.17ON2551021203e-06
TDEL0G017404.17ON2571301194e-06
Skud_12.304.17ON2471261186e-06
Suva_10.354.17ON2471311177e-06
KLLA0D03949g4.17ON2251211132e-05
ACL061C4.17ON2341291132e-05
NCAS0C058404.17ON2671331043e-04
NDAI0H002804.17ON3101281010.001
SAKL0H02530g5.84ON669861000.002
YLL038C (ENT4)4.17ON247103970.002
Smik_12.194.17ON247103940.005
YHR161C (YAP1801)5.84ON63791960.006
TBLA0H012108.335ON491164950.007
CAGL0E03806g4.17ON260109930.009
Skud_8.2255.84ON62190930.015
TBLA0B057705.84ON680112910.025
Smik_8.2455.84ON62791900.029
KAFR0B058008.335ON382161870.065
KLLA0A05522g5.84ON56771850.13
TDEL0B003208.863ON63747850.14
KAFR0I014604.17ON275104820.19
NDAI0J009308.335ON418160830.21
KAFR0L020508.863ON65749810.43
AFL176C6.295ON60462780.87
ZYRO0F13684g8.335ON407101751.5
KNAG0J028704.17ON329134742.3
TDEL0G010805.84ON51541698.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0B02650
         (646 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.3...   418   e-137
Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206...   250   6e-74
TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.3...   231   7e-68
Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W (...   225   5e-66
Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W (...   218   2e-63
Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W (...   214   9e-62
KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {...   214   4e-61
YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}  ENT2Epsin...   214   1e-60
Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206...   212   1e-59
Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206...   212   1e-59
NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342    202   5e-57
TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}...   204   7e-57
NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.3...   195   1e-54
TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {O...   195   1e-54
CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {...   194   4e-54
YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}  ENT1Epsin-...   192   7e-54
Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa] ...   192   5e-53
ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {...   190   2e-52
SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some s...   189   2e-52
Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]...   186   4e-51
KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some s...   183   3e-50
KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.3...   176   6e-48
Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar...   175   6e-47
KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.3...   171   3e-46
KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]...   172   3e-46
ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON} Syn...   166   5e-44
TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {O...   168   1e-43
KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} simila...    87   2e-17
NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {O...    86   3e-17
KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.34...    86   5e-17
Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..931...    86   5e-17
TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa] ...    85   9e-17
SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]...    84   1e-16
TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.3...    82   5e-16
NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa] ...    82   6e-16
AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON} S...    81   1e-15
KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]...    81   1e-15
ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]...    81   2e-15
Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {...    80   2e-15
Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125...    80   2e-15
Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {...    80   3e-15
YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON} ...    80   4e-15
TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346...    79   6e-15
KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON} Anc_4...    79   6e-15
Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {...    78   1e-14
Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar t...    76   5e-14
CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} simila...    74   4e-13
SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some ...    61   1e-09
TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON} Anc_4...    59   2e-08
Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON} c...    55   9e-08
Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {O...    55   1e-07
Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to...    54   2e-07
ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {O...    54   3e-07
TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.1...    54   9e-07
TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON} ...    52   2e-06
KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {O...    51   3e-06
TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17...    50   4e-06
Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON} ...    50   6e-06
Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON} ...    50   7e-06
KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar...    48   2e-05
ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON} Sy...    48   2e-05
NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4....    45   3e-04
NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON} ...    44   0.001
SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly...    43   0.002
YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}  EN...    42   0.002
Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON} ...    41   0.005
YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}  ...    42   0.006
TBLA0H01210 Chr8 (269471..270946) [1476 bp, 491 aa] {ON} Anc_8.3...    41   0.007
CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar...    40   0.009
Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON...    40   0.015
TBLA0B05770 Chr2 complement(1364772..1366814) [2043 bp, 680 aa] ...    40   0.025
Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON...    39   0.029
KAFR0B05800 Chr2 complement(1200666..1201814) [1149 bp, 382 aa] ...    38   0.065
KLLA0A05522g Chr1 (507778..509481) [1704 bp, 567 aa] {ON} simila...    37   0.13 
TDEL0B00320 Chr2 complement(59154..61067) [1914 bp, 637 aa] {ON}...    37   0.14 
KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17...    36   0.19 
NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8....    37   0.21 
KAFR0L02050 Chr12 complement(386478..388451) [1974 bp, 657 aa] {...    36   0.43 
AFL176C Chr6 complement(106401..108215) [1815 bp, 604 aa] {ON} S...    35   0.87 
ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]...    33   1.5  
KNAG0J02870 Chr10 (549107..550096) [990 bp, 329 aa] {ON} Anc_4.1...    33   2.3  
TDEL0G01080 Chr7 (220997..222544) [1548 bp, 515 aa] {ON} Anc_5.8...    31   8.7  

>KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.342
           YLR206W
          Length = 646

 Score =  418 bits (1074), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 216/287 (75%), Positives = 216/287 (75%)

Query: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60
           MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE
Sbjct: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60

Query: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG
Sbjct: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120

Query: 121 QIVRVKARDLVELLQSGEQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPEDEX 180
           QIVRVKARDLVELLQSGEQL                                   PEDE 
Sbjct: 121 QIVRVKARDLVELLQSGEQLGGRKAKRARGASRRDRGRRRGGDRGGGEYRQRGDDPEDEY 180

Query: 181 XXXXXXXXXXXXXXXESGGARGNDDDDLQRAIEESKRTVQEDEERRRQLSMYDEEDPEFQ 240
                          ESGGARGNDDDDLQRAIEESKRTVQEDEERRRQLSMYDEEDPEFQ
Sbjct: 181 YPRPAGGPPPQRQGYESGGARGNDDDDLQRAIEESKRTVQEDEERRRQLSMYDEEDPEFQ 240

Query: 241 AALQLSREEEELKNXXXXXXXXXXXXXXXXXXXXNTAYLDVFGNPVS 287
           AALQLSREEEELKN                    NTAYLDVFGNPVS
Sbjct: 241 AALQLSREEEELKNLQHLQRLQQQQQQQQQQQQLNTAYLDVFGNPVS 287

 Score =  325 bits (833), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 163/202 (80%), Positives = 163/202 (80%)

Query: 392 PMTTGSNNPFAVNAAPIQQPNYTQSPNNYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 451
           PMTTGSNNPFAVNAAPIQQPNYTQSPNNYV                              
Sbjct: 392 PMTTGSNNPFAVNAAPIQQPNYTQSPNNYVSPQQNYAPPQPPRPSQPSQQQSPQQSPQQA 451

Query: 452 XXXXXXXXXVPNAQFSGNVPTGSPGQEAHGRAPAPVPQPMPRMNTGNQEVTNKYSELNNL 511
                    VPNAQFSGNVPTGSPGQEAHGRAPAPVPQPMPRMNTGNQEVTNKYSELNNL
Sbjct: 452 YNPYSSPQQVPNAQFSGNVPTGSPGQEAHGRAPAPVPQPMPRMNTGNQEVTNKYSELNNL 511

Query: 512 LAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFKQVNSEGKDPNSNPFLNSQYTGLP 571
           LAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFKQVNSEGKDPNSNPFLNSQYTGLP
Sbjct: 512 LAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFKQVNSEGKDPNSNPFLNSQYTGLP 571

Query: 572 STGIVPAYTGYGFGNQSDQQNA 593
           STGIVPAYTGYGFGNQSDQQNA
Sbjct: 572 STGIVPAYTGYGFGNQSDQQNA 593

>Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206W
           (REAL)
          Length = 612

 Score =  250 bits (639), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 140/293 (47%), Positives = 178/293 (60%), Gaps = 34/293 (11%)

Query: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60
           MS+QFVRSAKN+MKGYSSTQVLVRDATAND RTP +DTL+D+A  S+DSVDFFEIMD+L+
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           KRLND GKYWRH+ KSLTVLDYLVRFGSE+C  W R++ +++K LR FR  ++  GFD+G
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENES-GFDEG 119

Query: 121 QIVRVKARDLVELLQSGEQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPEDEX 180
           QI+RVKA++LV LL   E+L                                   P D  
Sbjct: 120 QIIRVKAKELVSLLNDDERL------REERSMNTRNRRDRSAARPRPRRQRTRSNPHD-- 171

Query: 181 XXXXXXXXXXXXXXXESGGARGNDDDDLQRAIEESKRTVQEDEERRRQLSMYDEEDPEFQ 240
                           S  +  ND   L++A+EES+ T QEDE+RRR+L+ YD+EDP+FQ
Sbjct: 172 ----------------SSPSYQND---LEKALEESRITAQEDEQRRRELAQYDDEDPDFQ 212

Query: 241 AALQLS------REEEELKNXXXXXXXXXXXXXXXXXXXXNTAYLDVFGNPVS 287
           AALQLS      ++ +EL+                       AY D+FGNP+S
Sbjct: 213 AALQLSKEEEELKQLQELQRLQNQQQSLSQMQVPVQQQQEQPAYYDIFGNPIS 265

 Score =  141 bits (355), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 80/98 (81%), Gaps = 3/98 (3%)

Query: 490 PMPRMNTGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFKQ 549
           P+ +  TGNQ +++KY++LN LLA GTG DTFGN G  RIPAQHT+TGTFINSQGTG+KQ
Sbjct: 425 PLKQTRTGNQSISDKYNDLNTLLATGTGTDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 484

Query: 550 VNSEGKDPNSNPFLNSQYTGLPSTGIVPAYTGYGFGNQ 587
           V +E   P +NPFL++QYTGLPST IVP  TGYGFGNQ
Sbjct: 485 VINE---PKNNPFLSNQYTGLPSTNIVPTQTGYGFGNQ 519

>TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.342
           YLR206W
          Length = 501

 Score =  231 bits (590), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 131/287 (45%), Positives = 168/287 (58%), Gaps = 45/287 (15%)

Query: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60
           MS+QFVRSAKNV+KGYSS QVLVR+ATAN+   P +D L+++A  ++DSV+FFEIMD+++
Sbjct: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60

Query: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           KRLND GKYWRHI KSLTVLDYLVRFGSE+C  W R++L+++K L  FR  DDG G DQG
Sbjct: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNDDDG-GVDQG 119

Query: 121 QIVRVKARDLVELLQSGEQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPEDEX 180
           QI+RVKA++L  LL   E+L                                     +E 
Sbjct: 120 QIIRVKAKELTNLLSDDERL------------------------------------REER 143

Query: 181 XXXXXXXXXXXXXXXESGGARGNDDDDLQRAIEESKRTVQEDEERRRQLSMYDEEDPEFQ 240
                           + G +   DDDLQRA++ES+ T +EDE RR+ L     ED + Q
Sbjct: 144 EMNRKGRKNGTRRRRRTTGEQDGFDDDLQRALDESRLTAEEDERRRKMLG---SEDDDLQ 200

Query: 241 AALQLSREEEELKNXXXXXXXXXXXXXXXXXXXXNTAYLDVFGNPVS 287
           AALQLS+EEEELK                      + Y D+FGNP+S
Sbjct: 201 AALQLSKEEEELKR-----LQEMQKLQQQQTQQQPSQYYDIFGNPIS 242

 Score =  137 bits (344), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 64/93 (68%), Positives = 74/93 (79%), Gaps = 3/93 (3%)

Query: 494 MNTGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFKQVNSE 553
           + TG+  +T KY ELN LLA GTG+DTFGN G  RIPAQHT+TGTFINSQGTG++QV  E
Sbjct: 389 VRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQVTGE 448

Query: 554 GKDPNSNPFLNSQYTGLPSTGIVPAYTGYGFGN 586
              P  NPFL SQYTG+PS+ IVPA+TGYGFGN
Sbjct: 449 ---PKKNPFLQSQYTGIPSSNIVPAHTGYGFGN 478

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 17/25 (68%)

Query: 392 PMTTGSNNPFAVNAAPIQQPNYTQS 416
           PM TGSNNPFA+N   +QQ    QS
Sbjct: 325 PMATGSNNPFALNNLQLQQARPAQS 349

>Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W
           (REAL)
          Length = 447

 Score =  225 bits (573), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 126/287 (43%), Positives = 162/287 (56%), Gaps = 48/287 (16%)

Query: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60
           MS+QFVRSAKN++KGYSSTQVLVR+AT+ND      D+L ++A  S+DS DFFEIMD+L+
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           KRLND GKYWRHI K+LTVLDYL+RFGSE+C  W +++L+++K L+ FR  DD  G DQG
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDE-GVDQG 119

Query: 121 QIVRVKARDLVELLQSGEQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPEDEX 180
           QIVRVKA++L  LL   E+L                                     +E 
Sbjct: 120 QIVRVKAKELTTLLSDDERL-------------------------------------NEE 142

Query: 181 XXXXXXXXXXXXXXXESGGARGNDDDDLQRAIEESKRTVQEDEERRRQLSMYDEEDPEFQ 240
                             G    DDDDLQRAI+ S+ T +EDE RR+Q       D +++
Sbjct: 143 RNMNIKGRSRKGRKRRGTGRNDEDDDDLQRAIDASRMTAEEDERRRKQ-------DEDYE 195

Query: 241 AALQLSREEEELKNXXXXXXXXXXXXXXXXXXXXNTAYLDVFGNPVS 287
            ALQLS+EEEELK                        Y D+FGNP++
Sbjct: 196 TALQLSKEEEELKR---LQDLQRMQQVHAQQQQQQPMYYDIFGNPIT 239

 Score =  142 bits (359), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 66/96 (68%), Positives = 78/96 (81%), Gaps = 3/96 (3%)

Query: 490 PMPRMNTGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFKQ 549
           P+ +  TGNQ +T+KY +LN LLA GTG+DTFGN G  R+PAQHT+TGTFINSQGTG++Q
Sbjct: 333 PLTQTRTGNQSMTDKYGKLNELLATGTGIDTFGNVGDSRVPAQHTKTGTFINSQGTGYRQ 392

Query: 550 VNSEGKDPNSNPFLNSQYTGLPSTGIVPAYTGYGFG 585
           V++   DP  NPFLNSQYTGLPST IVP  TGYGFG
Sbjct: 393 VSN---DPKQNPFLNSQYTGLPSTNIVPTQTGYGFG 425

>Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W
           (REAL)
          Length = 460

 Score =  218 bits (556), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 121/287 (42%), Positives = 165/287 (57%), Gaps = 48/287 (16%)

Query: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60
           MS+QFVRSAKN++KGYSSTQVLVR+AT+ND      D+L ++A  S+DS DFFEIMD+L+
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           KRLND GKYWRHI K+LTVLDYL+RFGSE+C  W +++L+++K L+ FR  DD  G DQG
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDE-GIDQG 119

Query: 121 QIVRVKARDLVELLQSGEQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPEDEX 180
           QIVRVK+++L  LL   E+L                                     +E 
Sbjct: 120 QIVRVKSKELTALLSDDERLN------------------------------------EER 143

Query: 181 XXXXXXXXXXXXXXXESGGARGNDDDDLQRAIEESKRTVQEDEERRRQLSMYDEEDPEFQ 240
                           +G +  ++D+DLQRA++ S+ T +EDE+RR+        D +++
Sbjct: 144 NMNIKGRNRKGRSRRGTGRSSNDNDNDLQRALDASRMTAEEDEKRRKM-------DEDYE 196

Query: 241 AALQLSREEEELKNXXXXXXXXXXXXXXXXXXXXNTAYLDVFGNPVS 287
            ALQLS+EEEELK                        Y D+FGNP++
Sbjct: 197 TALQLSKEEEELKR----LQDLQRMQQLQTQQQQQPMYYDIFGNPIT 239

 Score =  139 bits (350), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 64/97 (65%), Positives = 79/97 (81%), Gaps = 3/97 (3%)

Query: 489 QPMPRMNTGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFK 548
           +P+ +  TGNQ +T+KY++LN LLA GTG+DTFGN G  R+PAQHT+TGTFINSQGTG+K
Sbjct: 345 EPLTQTRTGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYK 404

Query: 549 QVNSEGKDPNSNPFLNSQYTGLPSTGIVPAYTGYGFG 585
           QV++   DP  NPFL+ QYTGLPST +VP  TGYGFG
Sbjct: 405 QVSN---DPKYNPFLSGQYTGLPSTNVVPTQTGYGFG 438

>Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W
           (REAL)
          Length = 462

 Score =  214 bits (544), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 123/287 (42%), Positives = 161/287 (56%), Gaps = 48/287 (16%)

Query: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60
           MS+Q VRSAKN++KGYSSTQVLVR+AT+ND      D+L ++A  S+DS DFFEIMD+L+
Sbjct: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           KRLND GKYWRHI K+LTVLDYL+RFGSE+C  W +++L+++K L+ FR  DD  G DQG
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRH-DDDEGTDQG 119

Query: 121 QIVRVKARDLVELLQSGEQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPEDEX 180
           QIVRVKA++L  LL   E+L                                     +E 
Sbjct: 120 QIVRVKAKELTSLLSDEERLN------------------------------------EER 143

Query: 181 XXXXXXXXXXXXXXXESGGARGNDDDDLQRAIEESKRTVQEDEERRRQLSMYDEEDPEFQ 240
                           +  +  +DD DLQRAI+ S+ T  EDE RR+Q       D +++
Sbjct: 144 NMNIKGRNRGGRRRRRTNRSSEDDD-DLQRAIDASRMTADEDERRRKQ-------DEDYE 195

Query: 241 AALQLSREEEELKNXXXXXXXXXXXXXXXXXXXXNTAYLDVFGNPVS 287
            ALQLS+EEEELK                        Y D+FGNP++
Sbjct: 196 TALQLSKEEEELKR---LQDLQRIQAQQQQQQQQQPMYCDIFGNPIT 239

 Score =  149 bits (376), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 85/104 (81%), Gaps = 3/104 (2%)

Query: 489 QPMPRMNTGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFK 548
           +P+ +  TGNQ +T+KYS+LN LL  GTG+DTFGN G  R+PAQHT+TGTFINSQGTG++
Sbjct: 347 EPLTQTRTGNQSMTDKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYR 406

Query: 549 QVNSEGKDPNSNPFLNSQYTGLPSTGIVPAYTGYGFGNQSDQQN 592
           QV++   DP  NPFLNSQYTGLPST +VPA TGYGFGNQ  QQ+
Sbjct: 407 QVSN---DPKHNPFLNSQYTGLPSTNVVPAQTGYGFGNQPQQQS 447

>KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {ON}
           Anc_7.342 YLR206W
          Length = 550

 Score =  214 bits (546), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 97/135 (71%), Positives = 117/135 (86%), Gaps = 1/135 (0%)

Query: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60
           MS+QFVRSAKNVMKGYSSTQVLVRDAT+ND R  ++DTL+DIA  S+DSVDFFEIMD+L+
Sbjct: 1   MSKQFVRSAKNVMKGYSSTQVLVRDATSNDNRVTNIDTLDDIASRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           KRLND GKYW+HI KSLTVLDYLVRFGSE+C  W +++L+++K LR FR+ DD  G DQG
Sbjct: 61  KRLNDKGKYWKHIVKSLTVLDYLVRFGSENCVLWCKENLYVIKTLREFRYEDD-TGIDQG 119

Query: 121 QIVRVKARDLVELLQ 135
           QI+RVKA++L  LLQ
Sbjct: 120 QIIRVKAKELTSLLQ 134

 Score =  150 bits (379), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 81/92 (88%), Gaps = 2/92 (2%)

Query: 496 TGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFKQVNSEGK 555
           TGN+E+T KYSELNNLLAQGTGVDTFGN G +RIPAQHT+TGTFINSQGTG+KQV +E  
Sbjct: 390 TGNEEITEKYSELNNLLAQGTGVDTFGNTGQERIPAQHTKTGTFINSQGTGYKQVTNERS 449

Query: 556 DPNSNPFLNSQYTGLPSTGIVPAYTGYGFGNQ 587
              +NPFLN+QYTGLPS+ IVP+ TGYGFGNQ
Sbjct: 450 --KNNPFLNTQYTGLPSSNIVPSSTGYGFGNQ 479

 Score =  100 bits (249), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 57/86 (66%)

Query: 202 GNDDDDLQRAIEESKRTVQEDEERRRQLSMYDEEDPEFQAALQLSREEEELKNXXXXXXX 261
           G DDDDLQR IEESK+T +EDE RR++L+ YDEEDPEFQAALQLS+EEEELKN       
Sbjct: 171 GPDDDDLQRVIEESKKTAEEDERRRKELARYDEEDPEFQAALQLSKEEEELKNLQDLQRQ 230

Query: 262 XXXXXXXXXXXXXNTAYLDVFGNPVS 287
                           Y DVFGNP+S
Sbjct: 231 QQQLQMLQQQQTSANVYYDVFGNPIS 256

>YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}
           ENT2Epsin-like protein required for endocytosis and
           actin patch assembly and functionally redundant with
           Ent1p; contains clathrin-binding motif at C-terminus
          Length = 613

 Score =  214 bits (546), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 120/140 (85%), Gaps = 1/140 (0%)

Query: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60
           MS+QFVRSAKN+MKGYSSTQVLVRDATAND RTP +DTL+D+A  S+DSVDFFEIMD+L+
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           KRLND GKYWRH+ KSLTVLDYLVRFGSE+C  W R++ +++K LR FR  ++  GFD+G
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENES-GFDEG 119

Query: 121 QIVRVKARDLVELLQSGEQL 140
           QI+RVKA++LV LL   E+L
Sbjct: 120 QIIRVKAKELVSLLNDEERL 139

 Score =  145 bits (366), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 81/98 (82%), Gaps = 3/98 (3%)

Query: 490 PMPRMNTGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFKQ 549
           P+ +  TGNQ +++KYS+LN LLA GTG+DTFGN G  RIPAQHT+TGTFINSQGTG+KQ
Sbjct: 424 PLKQTRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 483

Query: 550 VNSEGKDPNSNPFLNSQYTGLPSTGIVPAYTGYGFGNQ 587
           V +E   P +NPFL++QYTGLPST IVP  TGYGFGNQ
Sbjct: 484 VTNE---PKNNPFLSNQYTGLPSTNIVPTQTGYGFGNQ 518

 Score = 67.4 bits (163), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 43/90 (47%), Positives = 55/90 (61%), Gaps = 8/90 (8%)

Query: 206 DDLQRAIEESKRTVQEDEERRRQLSMYDEEDPEFQAALQLSREEEELKNXXXXXX----- 260
           DDL++A+EES+ T QEDE+RRR+L+ YD+EDP+FQAALQLS+EEEELK            
Sbjct: 178 DDLEKALEESRITAQEDEQRRRELAQYDDEDPDFQAALQLSKEEEELKQLQELQRLQKQQ 237

Query: 261 ---XXXXXXXXXXXXXXNTAYLDVFGNPVS 287
                              AY D+FGNP+S
Sbjct: 238 QSLSQFQAPLQQQQPQQQPAYYDIFGNPIS 267

>Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206W
           (REAL)
          Length = 618

 Score =  212 bits (540), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 120/140 (85%), Gaps = 1/140 (0%)

Query: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60
           MS+QFVRSAKN++KGYSSTQVLVRDATAND RTP +DTL+D+A  S+DSVDFFEIMD+L+
Sbjct: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           KRLND GKYWRH+ KSLTVLDYLVRFGSE+C  W R++ +++K LR FR  ++  GFD+G
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENES-GFDEG 119

Query: 121 QIVRVKARDLVELLQSGEQL 140
           QI+RVKA++LV LL   E+L
Sbjct: 120 QIIRVKAKELVSLLNDDERL 139

 Score =  143 bits (361), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 80/98 (81%), Gaps = 3/98 (3%)

Query: 490 PMPRMNTGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFKQ 549
           P+ +  TGNQ +++KY++LN LLA GTG DTFGN G  RIPAQHT+TGTFINSQGTG+KQ
Sbjct: 433 PLTQTRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQ 492

Query: 550 VNSEGKDPNSNPFLNSQYTGLPSTGIVPAYTGYGFGNQ 587
           V +E   P +NPFLNSQYTGLPST IVP  TGYGFGNQ
Sbjct: 493 VVNE---PKNNPFLNSQYTGLPSTSIVPTQTGYGFGNQ 527

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/82 (47%), Positives = 53/82 (64%)

Query: 206 DDLQRAIEESKRTVQEDEERRRQLSMYDEEDPEFQAALQLSREEEELKNXXXXXXXXXXX 265
           +DL++A+EES+ T QEDE RR +++ YD++DP+FQAALQLS+EEEELK            
Sbjct: 182 NDLEKALEESRITAQEDELRRNEMAQYDDDDPDFQAALQLSKEEEELKQLQELQKQQQLQ 241

Query: 266 XXXXXXXXXNTAYLDVFGNPVS 287
                      AY D+FGNP+S
Sbjct: 242 SQLQMPPQQQAAYYDIFGNPIS 263

>Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206W
           (REAL)
          Length = 626

 Score =  212 bits (539), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 96/140 (68%), Positives = 119/140 (85%), Gaps = 1/140 (0%)

Query: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60
           M +QFVRSAKN++KGYSSTQVLVRDATAND RTP +DTL+D+A  S+DSVDFFEIMD+L+
Sbjct: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           KRLND GKYWRH+ KSLTVLDYLVRFGSE+C  W R++ +++K LR FR  ++  GFD+G
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENES-GFDEG 119

Query: 121 QIVRVKARDLVELLQSGEQL 140
           QI+RVKA++LV LL   E+L
Sbjct: 120 QIIRVKAKELVSLLNDDERL 139

 Score =  142 bits (359), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 81/98 (82%), Gaps = 3/98 (3%)

Query: 490 PMPRMNTGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFKQ 549
           P+ +  TGNQ +++KY++LN LLA GTG+DTFGN G  RIPAQHT+TGTFINSQGTG+KQ
Sbjct: 450 PLEQTRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 509

Query: 550 VNSEGKDPNSNPFLNSQYTGLPSTGIVPAYTGYGFGNQ 587
           V SE   P +NPFL++QYTGLPST IVP  TGYGFGNQ
Sbjct: 510 VTSE---PKNNPFLSNQYTGLPSTNIVPTQTGYGFGNQ 544

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 27/41 (65%), Positives = 37/41 (90%)

Query: 206 DDLQRAIEESKRTVQEDEERRRQLSMYDEEDPEFQAALQLS 246
           D+L++ +EES+ T QEDE+RRR+L+ YD+EDP+FQAALQLS
Sbjct: 178 DELEKVLEESRITAQEDEQRRRELAQYDDEDPDFQAALQLS 218

>NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342
          Length = 483

 Score =  202 bits (513), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 115/140 (82%), Gaps = 1/140 (0%)

Query: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60
           MS+QFVRSAKN++KGYS+TQVLVRDAT+ND   P  + L ++A  SFDSVDFFEIMD+L+
Sbjct: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60

Query: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           KRLND GKYWRH+ KSLTVLDYLVRFGSE+C  W +++L+++K LR FR  DDG G DQG
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDG-GADQG 119

Query: 121 QIVRVKARDLVELLQSGEQL 140
           QI+RVKA++L  LL   E+L
Sbjct: 120 QIIRVKAKELTSLLLDEERL 139

 Score =  145 bits (365), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 69/91 (75%), Positives = 77/91 (84%), Gaps = 3/91 (3%)

Query: 496 TGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFKQVNSEGK 555
           TGNQ +T+KYS+LN LLA GTG+DTFGN G QRIPAQHTQTGTFINSQGTG++QV +   
Sbjct: 371 TGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTN--- 427

Query: 556 DPNSNPFLNSQYTGLPSTGIVPAYTGYGFGN 586
           DP +NPFLNSQYTGLPST IV   TGYGFGN
Sbjct: 428 DPKNNPFLNSQYTGLPSTNIVSTQTGYGFGN 458

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 40/84 (47%), Positives = 52/84 (61%), Gaps = 4/84 (4%)

Query: 204 DDDDLQRAIEESKRTVQEDEERRRQLSMYDEEDPEFQAALQLSREEEELKNXXXXXXXXX 263
           D D+LQRA+EES+ T +EDE RRRQ++ YD++DP+ Q ALQLS+EEEELK          
Sbjct: 173 DQDELQRALEESRLTAEEDERRRRQMAQYDDQDPDLQTALQLSKEEEELK----KLQEMQ 228

Query: 264 XXXXXXXXXXXNTAYLDVFGNPVS 287
                         Y D+FGNP+S
Sbjct: 229 RLQQQQGQMNQPQGYFDIFGNPIS 252

>TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}
           Anc_7.342 YLR206W
          Length = 599

 Score =  204 bits (519), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 93/144 (64%), Positives = 118/144 (81%), Gaps = 5/144 (3%)

Query: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60
           MS+QF+RS KN++KGYSSTQ+LVRDATAND  TP +D L+DIA  ++DSVDFFEIMD+L+
Sbjct: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60

Query: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGI----G 116
           KRLND GKYW+H+ KSLTVLDYL+RFGSE+C  W +++L+L+K L+ FR VDD I    G
Sbjct: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFR-VDDAIDYNTG 119

Query: 117 FDQGQIVRVKARDLVELLQSGEQL 140
           +DQGQIVRV+A +L  LL   E+L
Sbjct: 120 YDQGQIVRVRATELTSLLMDDERL 143

 Score =  153 bits (387), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 86/101 (85%), Gaps = 5/101 (4%)

Query: 488 PQPMPRMNTGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGF 547
           PQP+P+M TGNQE+++KY+ LN LLA GTG+DTFGN G  RIPAQHT TGTFINSQGTG+
Sbjct: 464 PQPIPQMRTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQGTGY 523

Query: 548 KQ-VNSEGKDPNSNPFLNSQYTGLPSTGIVPAYTGYGFGNQ 587
           KQ +N    DP +NPF+++QYTGLPST +VP+YTGYGFGNQ
Sbjct: 524 KQYIN----DPKNNPFMSNQYTGLPSTNVVPSYTGYGFGNQ 560

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 51/87 (58%), Gaps = 6/87 (6%)

Query: 205 DDDLQRAIEESKRTVQEDEERRRQLSMYDEEDPEFQAALQLSREEEELKNXXXXXXXXXX 264
           DDDLQ+AIEESKRT +EDE RRR     D+ED +F+ ALQLS+EEEELK           
Sbjct: 185 DDDLQKAIEESKRTAEEDERRRRNREG-DQED-DFETALQLSKEEEELKKLQELHAQQIA 242

Query: 265 XXXXXXX--XXXNTA--YLDVFGNPVS 287
                       N A  Y D+FGNP+S
Sbjct: 243 LQNQQNATPTTQNVANVYTDIFGNPIS 269

>NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.342
           YDL161W
          Length = 486

 Score =  195 bits (496), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 88/140 (62%), Positives = 112/140 (80%), Gaps = 2/140 (1%)

Query: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60
           MS+QFVRSAKN+MKGYS+TQVLVRDAT+ND   P  + L +I+  SFDSVDFFEIMD+L+
Sbjct: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60

Query: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           KRLND GKYW+HI KSLTVLDYLVRFGSE+C  W + +L+++K L+ F+  DD +  D+ 
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDNV--DES 118

Query: 121 QIVRVKARDLVELLQSGEQL 140
            I+RVKA++L  LLQ  E+L
Sbjct: 119 SIIRVKAKELTALLQDDERL 138

 Score =  140 bits (353), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 77/90 (85%), Gaps = 4/90 (4%)

Query: 496 TGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFKQVNSEGK 555
           TGNQ +++KY+ELNNLLA GTG+DTFGN G QRIPAQHTQTGTFINSQGTG+KQ+     
Sbjct: 370 TGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQI---VN 426

Query: 556 DP-NSNPFLNSQYTGLPSTGIVPAYTGYGF 584
           DP   NPFLN+QYTGLPS+ IVP++TGYGF
Sbjct: 427 DPVKKNPFLNNQYTGLPSSNIVPSHTGYGF 456

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 49/90 (54%), Gaps = 7/90 (7%)

Query: 205 DDDLQRAIEESKRTVQEDEERRRQLSMYDEEDPEFQAALQLSRE-------EEELKNXXX 257
           D+DLQ+A+EES+ T +EDE RRR+L+ YD +D ++Q ALQLS+E       +E  +    
Sbjct: 172 DEDLQKALEESRITAEEDERRRRELAQYDNQDTDYQTALQLSKEEEELKKLQELQRLQQL 231

Query: 258 XXXXXXXXXXXXXXXXXNTAYLDVFGNPVS 287
                               Y D+FGNP+S
Sbjct: 232 QQQQQQQMQFQQQPQQQEQVYYDIFGNPIS 261

>TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {ON}
           Anc_7.342 YLR206W
          Length = 487

 Score =  195 bits (496), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 90/135 (66%), Positives = 111/135 (82%), Gaps = 1/135 (0%)

Query: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60
           MS QFVRS KNV+KGYSSTQVLVR+ATAN+G  P++D L DIA  ++DS DFFEIMD+L+
Sbjct: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60

Query: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGI-GFDQ 119
           KRLND GKYW+HI KSLTVLDYLVRFGSE+C  W +++L+L+K L  FR+ D+   G DQ
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120

Query: 120 GQIVRVKARDLVELL 134
           GQI+RVKA++L  LL
Sbjct: 121 GQIIRVKAKELTALL 135

 Score =  135 bits (341), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 75/90 (83%), Gaps = 3/90 (3%)

Query: 496 TGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFKQVNSEGK 555
           TGN+E+TNKY+ELN LLA GTG+DTFGN G  RIPAQHTQTGTFINSQGTG++Q + E K
Sbjct: 376 TGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGESK 435

Query: 556 DPNSNPFLNSQYTGLPSTGIVPAYTGYGFG 585
               NPFL++QYTGLPS+ I+P  TGYGFG
Sbjct: 436 ---VNPFLSNQYTGLPSSNIIPTQTGYGFG 462

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/83 (45%), Positives = 49/83 (59%), Gaps = 11/83 (13%)

Query: 205 DDDLQRAIEESKRTVQEDEERRRQLSMYDEEDPEFQAALQLSREEEELKNXXXXXXXXXX 264
           D+DLQRA+EES+RT +EDE +RR     +++D + QAALQLS+EEEELK           
Sbjct: 166 DEDLQRALEESRRTAEEDERKRR----LNQDDSDLQAALQLSKEEEELKR-------LQE 214

Query: 265 XXXXXXXXXXNTAYLDVFGNPVS 287
                        Y DVFGNP+S
Sbjct: 215 LQSSMHMQQQQPVYYDVFGNPIS 237

>CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|Q05785 Saccharomyces
           cerevisiae YLR206w ENT2
          Length = 510

 Score =  194 bits (494), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 113/140 (80%)

Query: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60
           M  Q VRSAKN++KGYSSTQV+VRDATAND  +P +  LED+A  ++D+V+FFEIMD+L+
Sbjct: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60

Query: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           KRLND GKYWRH+ KSLTVLDYLVRFGSE+C  W +++L+++K LR FR  D+  G D+G
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120

Query: 121 QIVRVKARDLVELLQSGEQL 140
           QI+RVKA++L  LL   E+L
Sbjct: 121 QIIRVKAKELTSLLTDDERL 140

 Score =  147 bits (371), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 80/93 (86%), Gaps = 3/93 (3%)

Query: 493 RMNTGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFKQVNS 552
           +  TGNQ +++KYSELNNLLA GTG+DTFGN G  RIPAQHT+TGTFINSQGTG+KQV +
Sbjct: 360 KTRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTN 419

Query: 553 EGKDPNSNPFLNSQYTGLPSTGIVPAYTGYGFG 585
           E   P +NPFL+SQYTGLPST IVP++TGYGFG
Sbjct: 420 E---PKNNPFLSSQYTGLPSTNIVPSHTGYGFG 449

 Score = 57.0 bits (136), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 37/83 (44%), Positives = 50/83 (60%), Gaps = 4/83 (4%)

Query: 205 DDDLQRAIEESKRTVQEDEERRRQLSMYDEEDPEFQAALQLSREEEELKNXXXXXXXXXX 264
           DDDLQ+A+EES+ T +E+E RRR+ + Y+ +DP+  AALQLS+EEEELK           
Sbjct: 175 DDDLQKALEESRMTAEEEEARRREQAQYENQDPDLLAALQLSKEEEELKK----LQDMQR 230

Query: 265 XXXXXXXXXXNTAYLDVFGNPVS 287
                        Y D+FGNP+S
Sbjct: 231 MQELQAQQQQQNVYYDIFGNPIS 253

>YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}
           ENT1Epsin-like protein involved in endocytosis and actin
           patch assembly and functionally redundant with Ent2p;
           binds clathrin via a clathrin-binding domain motif at
           C-terminus
          Length = 454

 Score =  192 bits (488), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 89/140 (63%), Positives = 113/140 (80%), Gaps = 1/140 (0%)

Query: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60
           MS+QFVRSAKN++KGYSSTQVLVR+AT+ND      D+L ++A  S+DS DFFEIMD+L+
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           KRLND GKYWRHI K+LTV+DYL+RFGSE+C  W R++L+++K L+ FR  DD  G DQG
Sbjct: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDE-GIDQG 119

Query: 121 QIVRVKARDLVELLQSGEQL 140
           QIVRVKA++L  LL   E+L
Sbjct: 120 QIVRVKAKELTALLSDDERL 139

 Score =  144 bits (362), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 67/96 (69%), Positives = 79/96 (82%), Gaps = 3/96 (3%)

Query: 489 QPMPRMNTGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFK 548
           +P+ +  TGNQ +T+KYS+LN LLA GTG+DTFGN G  RIPAQHT+TGTFINSQGTG++
Sbjct: 339 EPLIQNRTGNQSMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYR 398

Query: 549 QVNSEGKDPNSNPFLNSQYTGLPSTGIVPAYTGYGF 584
           QV+    DPN NPFLNSQYTGLPST +VP  TGYGF
Sbjct: 399 QVSD---DPNHNPFLNSQYTGLPSTSVVPTQTGYGF 431

 Score = 57.8 bits (138), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 45/84 (53%), Gaps = 10/84 (11%)

Query: 204 DDDDLQRAIEESKRTVQEDEERRRQLSMYDEEDPEFQAALQLSREEEELKNXXXXXXXXX 263
           +DDDLQRAI  S+ T +EDE RR+Q       D +++ ALQLS+EEEELK          
Sbjct: 166 NDDDLQRAISASRLTAEEDERRRKQ-------DEDYETALQLSKEEEELKR---LQDLQR 215

Query: 264 XXXXXXXXXXXNTAYLDVFGNPVS 287
                         Y D+FGNP++
Sbjct: 216 MQQQQGQQQLQQPMYYDIFGNPIT 239

>Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa]
           {ON} complement(192214..193815) [1602 nt, 534 aa]
          Length = 533

 Score =  192 bits (488), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 115/140 (82%), Gaps = 1/140 (0%)

Query: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60
           M +QFVRSAKNV+KGYSSTQV+VR+AT+ND   P +DTL+ +A  ++DSV+FFEIMD+L+
Sbjct: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60

Query: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           KRLND GKYW+HI KSLTVLDYLVRFGSE+C  W +++L++++ L+ F ++DD    DQG
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDS-DHDQG 119

Query: 121 QIVRVKARDLVELLQSGEQL 140
           QI+RVKA++L  LL   E+L
Sbjct: 120 QIIRVKAKELTSLLNDEERL 139

 Score =  145 bits (366), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 67/91 (73%), Positives = 79/91 (86%), Gaps = 3/91 (3%)

Query: 496 TGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFKQVNSEGK 555
           TGNQ++T+K+ ELN LLA GTG+DTFGN G  RIPAQHT+TGTFINSQGTG++QV +   
Sbjct: 385 TGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYRQVTN--- 441

Query: 556 DPNSNPFLNSQYTGLPSTGIVPAYTGYGFGN 586
           DP +NPFLNSQYTGLPST IVP++TGYGFGN
Sbjct: 442 DPKNNPFLNSQYTGLPSTNIVPSHTGYGFGN 472

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 48/84 (57%), Gaps = 5/84 (5%)

Query: 204 DDDDLQRAIEESKRTVQEDEERRRQLSMYDEEDPEFQAALQLSREEEELKNXXXXXXXXX 263
           DDD+LQRAIEESKRT ++D+ RRR      +E+ + Q ALQLS+EEEELK          
Sbjct: 163 DDDELQRAIEESKRTAEDDDRRRRMRD---DEEADLQTALQLSKEEEELK--RLQELQRL 217

Query: 264 XXXXXXXXXXXNTAYLDVFGNPVS 287
                         Y D+FGNP+S
Sbjct: 218 QQQQQQQQQQQQPMYYDIFGNPIS 241

>ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {ON}
           some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 538

 Score =  190 bits (483), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 88/140 (62%), Positives = 111/140 (79%), Gaps = 1/140 (0%)

Query: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60
           M  QFVRSAKN +KGY+S QVLVRDATAN+   P +D L+++A  S+DSV+FFEIMD+++
Sbjct: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60

Query: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           KRLND GKYWRH+ KSLTVLDYLVRFGSE+C  W R++L+++K LR FR  DDG   D G
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHDDDGTQ-DGG 119

Query: 121 QIVRVKARDLVELLQSGEQL 140
           QI+RVKA++L  LL   E+L
Sbjct: 120 QIIRVKAKELTNLLMDDERL 139

 Score =  150 bits (378), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 83/195 (42%), Positives = 111/195 (56%), Gaps = 37/195 (18%)

Query: 392 PMTTGSNNPFAVNAAPIQQPNYTQSPNNYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 451
           P++TGSNNPFA+N  P+Q  +  Q+ ++                                
Sbjct: 355 PVSTGSNNPFALNGMPLQSNSKPQAASDLAGLNNWGN----------------------- 391

Query: 452 XXXXXXXXXVPNAQFSGNVPTGSPGQEAHGRAPAPVPQPMPRMNTGNQEVTNKYSELNNL 511
                      N+     +P   P  +      AP PQPM  + TGNQ +++KY++LN L
Sbjct: 392 -----------NSTGQLEMPKYQPRPQQPQHNTAPEPQPMQPVRTGNQSISDKYNDLNQL 440

Query: 512 LAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFKQVNSEGKDPNSNPFLNSQYTGLP 571
           LAQ TGVDTFGN G  RIPAQHT+TGTFINSQGTGFKQ ++E   P  NPFL +Q+TG+P
Sbjct: 441 LAQPTGVDTFGNVGDARIPAQHTKTGTFINSQGTGFKQYSNE---PKKNPFLPTQFTGIP 497

Query: 572 STGIVPAYTGYGFGN 586
           ++ +VP++TGYGFGN
Sbjct: 498 TSSVVPSHTGYGFGN 512

 Score = 57.0 bits (136), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 33/87 (37%), Positives = 47/87 (54%), Gaps = 5/87 (5%)

Query: 201 RGNDDDDLQRAIEESKRTVQEDEERRRQLSMYDEEDPEFQAALQLSREEEELKNXXXXXX 260
           R + D ++QRA++ S+ T +EDE RR+ L   + ED + + ALQLS+EEEELK       
Sbjct: 163 RNSYDSEMQRALDASRLTAEEDERRRKTL---NNEDADLETALQLSKEEEELKRLQELQK 219

Query: 261 XXXXXXXXXXXXXXNTAYLDVFGNPVS 287
                            Y D+FGNP+S
Sbjct: 220 AQQDQQRLSQMQPQ--GYYDIFGNPIS 244

>SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 498

 Score =  189 bits (480), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 118/287 (41%), Positives = 164/287 (57%), Gaps = 41/287 (14%)

Query: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60
           MS+  +R+AKNV+ GYSS QVLVR+AT+N+   P +D L+++A  ++D+V+FFEIMD+L+
Sbjct: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60

Query: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           KRLND GK WRH+ KSLTVLDYLVR+GSE+C  W++++L+++K LR F   +D +G D G
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMH-EDEMGVDHG 119

Query: 121 QIVRVKARDLVELLQSGEQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPEDEX 180
           QI+RVKA++L  LL+  E+L                                      E 
Sbjct: 120 QIIRVKAKELTSLLRDEERLT-------------------------------------EE 142

Query: 181 XXXXXXXXXXXXXXXESGGARGNDDDDLQRAIEESKRTVQEDEERRRQLSMYDEEDPEFQ 240
                           S G    DD DLQRA+EES+ T +E+E RRR  S  +++D +FQ
Sbjct: 143 RNMRKKRRGKTRRPERSRGGEEYDD-DLQRALEESRLTAEEEERRRRTDSGSNDDD-DFQ 200

Query: 241 AALQLSREEEELKNXXXXXXXXXXXXXXXXXXXXNTAYLDVFGNPVS 287
            ALQLS+EEEEL+                        Y DVFGNP++
Sbjct: 201 TALQLSKEEEELRRLRNLQMQQQQTAMFQQQQQQ-PMYYDVFGNPIT 246

 Score =  139 bits (349), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 77/91 (84%), Gaps = 2/91 (2%)

Query: 496 TGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFKQVNSEGK 555
           TGNQ ++ KY++LNNLLA GTG+DTFGN G  RIPAQHT+TG FINSQGTG+KQV ++  
Sbjct: 376 TGNQSISQKYNDLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQVTND-- 433

Query: 556 DPNSNPFLNSQYTGLPSTGIVPAYTGYGFGN 586
            P +NPFL +QYTGLPST +VP+YTGYGFGN
Sbjct: 434 QPKNNPFLAAQYTGLPSTSVVPSYTGYGFGN 464

>Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]
           {ON} YDL161W (ENT1) - Ent1p [contig 161] FULL
          Length = 508

 Score =  186 bits (472), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 110/140 (78%), Gaps = 1/140 (0%)

Query: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60
           MS+  +R AKNV+ GYS+TQVL+R+AT+ND   P LD +++IA  S+DSV FFEIMD+L+
Sbjct: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           KRLND GK WRH+ KSLTVLDYLVR GSEHC  WA+++L+++K LR F   +D +G DQG
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREF-MHEDELGIDQG 119

Query: 121 QIVRVKARDLVELLQSGEQL 140
           QIVRVKAR+L  LL   E+L
Sbjct: 120 QIVRVKARELTALLLDDERL 139

 Score =  140 bits (354), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 74/90 (82%), Gaps = 3/90 (3%)

Query: 496 TGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFKQVNSEGK 555
           TGNQ +T K+SELNNLLA GTG+DTFGN G  RIPAQHT+TG FINSQGTG+KQV+S   
Sbjct: 397 TGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVSS--- 453

Query: 556 DPNSNPFLNSQYTGLPSTGIVPAYTGYGFG 585
            P  NPFL  QYTGLPST +VP+YTGYGFG
Sbjct: 454 TPKHNPFLGQQYTGLPSTNVVPSYTGYGFG 483

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 52/95 (54%), Gaps = 9/95 (9%)

Query: 202 GNDDDDLQRAIEESKRTV-QEDEERRRQLSMYDEEDPEFQAALQLSREEEELKNXXXXXX 260
           G++D+DLQRA+EES+ T  QE+ ERRR+L +YD    + Q ALQLS+EEEEL+       
Sbjct: 159 GSEDEDLQRAMEESRLTAEQEEAERRRKLEIYDNSSDDLQTALQLSKEEEELRRLRELQM 218

Query: 261 XXXXXXXXXXXXXXNTA--------YLDVFGNPVS 287
                         +          Y DVFGNP+S
Sbjct: 219 QQQMQQAQQQMFGLSQQQTQAQQPMYYDVFGNPIS 253

>KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 502

 Score =  183 bits (465), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 85/135 (62%), Positives = 107/135 (79%), Gaps = 1/135 (0%)

Query: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60
           MS+  +R AKNV+ GYS+TQVL+R+AT+ND   P LD +++IA  S+DSV FFEIMD+L+
Sbjct: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           KRLND GK WRH+ KSLTVLDYLVR GSEHC  WA+++L+++K LR F   +D  G DQG
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTH-EDETGVDQG 119

Query: 121 QIVRVKARDLVELLQ 135
           QIVRVKAR+L  LLQ
Sbjct: 120 QIVRVKARELTALLQ 134

 Score =  143 bits (361), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 83/98 (84%), Gaps = 5/98 (5%)

Query: 496 TGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFKQVNS--E 553
           TGNQ VT+K+S+LNNLLA GTG+DTFGN G  RIPAQHT+TGTFINSQGTG+KQV++  +
Sbjct: 389 TGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVSNMPQ 448

Query: 554 GKDPNSNPFLNSQYTGLPSTGIVPAYTGYGFGNQSDQQ 591
           GK    NPFL  QYTGLPST +VP+YTGYGFGNQ+ Q+
Sbjct: 449 GK---HNPFLGQQYTGLPSTSVVPSYTGYGFGNQNVQK 483

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 48/90 (53%), Gaps = 7/90 (7%)

Query: 205 DDDLQRAIEESKRTV-QEDEERRRQLSMYDEEDPEFQAALQLSREEEELKNXXXXXXXXX 263
           DDD+QRA+EES+ T  QE+ ERRR+L MYD    + Q ALQLS+EEEEL+          
Sbjct: 162 DDDMQRALEESRMTAEQEEAERRRKLEMYDNSADDLQTALQLSKEEEELRRLRELQMQQQ 221

Query: 264 XXXXXXXXXXXNTA------YLDVFGNPVS 287
                               Y DVFGNP+S
Sbjct: 222 MQQAQQQMFGLQQQQTQQPMYYDVFGNPIS 251

>KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.342
           YLR206W
          Length = 447

 Score =  176 bits (445), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 108/136 (79%), Gaps = 1/136 (0%)

Query: 5   FVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLEKRLN 64
            +RSAKN++KGYS T+VLVRDATAN+   P  + L+D+A  S++SV+FFEI+D+L+KR+N
Sbjct: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60

Query: 65  DSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQGQIVR 124
           D GKYWRH+ K+LTVLDYLVRFGSE+C  W +++L+++K LR F   D G G D+G+I+R
Sbjct: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAG-GEDEGKIIR 119

Query: 125 VKARDLVELLQSGEQL 140
           VKA++L  LL   E+L
Sbjct: 120 VKAKELTSLLMDEERL 135

 Score =  150 bits (379), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 71/105 (67%), Positives = 85/105 (80%), Gaps = 3/105 (2%)

Query: 484 PAPVPQPMPRMNTGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQ 543
           PA   +P+ +  +GNQ +++KYS LNNLLA GTG+DTFGN G QRIPAQHTQTGTFINSQ
Sbjct: 328 PATQTKPLTQTRSGNQAISDKYSALNNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQ 387

Query: 544 GTGFKQVNSEGKDPNSNPFLNSQYTGLPSTGIVPAYTGYGFGNQS 588
           GTG++QVN++ K    NPFLN QYTGLPST IVP  TG+GFGNQ+
Sbjct: 388 GTGYRQVNNDDK---PNPFLNGQYTGLPSTNIVPTQTGFGFGNQA 429

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/94 (43%), Positives = 52/94 (55%), Gaps = 9/94 (9%)

Query: 197 SGGAR---GNDDDDLQRAIEESKRTVQEDEERRRQLSMYDEEDPEFQAALQLSREEEELK 253
           SGG+R      D+DLQRAIEESKRT +E+E RRR  +     + + QAALQLSREEE+L+
Sbjct: 153 SGGSRERNNRSDEDLQRAIEESKRTAEEEERRRRNGA---SSEADRQAALQLSREEEDLR 209

Query: 254 NXXXXXXXXXXXXXXXXXXXXNTAYLDVFGNPVS 287
                                   Y DVFGNP++
Sbjct: 210 RLQEQARLAQQQQQQQQQQPM---YYDVFGNPIT 240

>Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar to
           Ashbya gossypii ACL157C
          Length = 514

 Score =  175 bits (443), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 107/140 (76%)

Query: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60
           MS+Q +RSAKNVM GYS  QVLVR+AT+ND   P LD +E++A  ++ +V+FFEIM +L+
Sbjct: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60

Query: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           +RLND  K WRH+ KSLTV DYLVR G+E C DWAR+++F+++ L  F  VD+  G D G
Sbjct: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120

Query: 121 QIVRVKARDLVELLQSGEQL 140
           Q++RVKA++L+ LL+  E+L
Sbjct: 121 QLIRVKAKELIALLRDDERL 140

 Score =  135 bits (341), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 67/99 (67%), Positives = 78/99 (78%), Gaps = 3/99 (3%)

Query: 496 TGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFKQVNSEGK 555
           TGNQ +++KY ELN LLA GTG+DTFGN G  RI +QHT+T TFINS GTGFKQV++E  
Sbjct: 405 TGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNE-- 462

Query: 556 DPNSNPFLNSQYTGLPSTGIVPAYTGYGFGNQSD-QQNA 593
            P  NPFL +QYTGLPST IVP++TGYGFGN S  QQ A
Sbjct: 463 PPKHNPFLTTQYTGLPSTNIVPSHTGYGFGNASSFQQTA 501

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/42 (59%), Positives = 31/42 (73%), Gaps = 1/42 (2%)

Query: 205 DDDLQRAIEESKRTVQEDEERRRQLSMYDEEDPEFQAALQLS 246
           D DL+RA+EES R   E+EERRR+L+   E+  E QAALQLS
Sbjct: 167 DPDLKRALEES-RITAEEEERRRKLAEKTEDAEELQAALQLS 207

>KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.342
           YLR206W
          Length = 414

 Score =  171 bits (432), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 107/136 (78%), Gaps = 1/136 (0%)

Query: 5   FVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLEKRLN 64
            +RSAKN++KGYSSTQ LVRDAT+N    P +D L ++A +++++++FFEIMD+L+KR+N
Sbjct: 1   MLRSAKNLVKGYSSTQKLVRDATSNSHDNPPIDQLSELAEMTYNNMEFFEIMDMLDKRIN 60

Query: 65  DSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQGQIVR 124
             GKYW+H+ KSL VLDYLVRFGSE+C  W +++L+++K LR F + D+  G DQGQ+VR
Sbjct: 61  SKGKYWKHVIKSLIVLDYLVRFGSENCVIWCKENLYIIKTLREFTYEDES-GMDQGQMVR 119

Query: 125 VKARDLVELLQSGEQL 140
           V+A++L  LL   E+L
Sbjct: 120 VRAKELTSLLMDEERL 135

 Score =  140 bits (352), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 82/103 (79%), Gaps = 3/103 (2%)

Query: 490 PMPRMNTGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFKQ 549
           P+ +  TG+Q +++KYS LN LLA GTG+DTFGN G QRIPAQHT+TGTFINSQGTG+KQ
Sbjct: 310 PLKQTRTGSQSISDKYSALNTLLATGTGIDTFGNTGNQRIPAQHTKTGTFINSQGTGYKQ 369

Query: 550 VNSEGKDPNSNPFLNSQYTGLPSTGIVPAYTGYGFGNQSDQQN 592
           V++ G +   N FLNSQYTGLPS+ IVP+ TGYGFGN +   N
Sbjct: 370 VSTNGFN---NVFLNSQYTGLPSSNIVPSQTGYGFGNSTVNNN 409

 Score = 31.2 bits (69), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 15/19 (78%)

Query: 392 PMTTGSNNPFAVNAAPIQQ 410
           P+ TGSNNPFA+N   +QQ
Sbjct: 275 PLATGSNNPFALNNKKLQQ 293

>KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]
           {ON} some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 478

 Score =  172 bits (436), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 106/140 (75%)

Query: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60
           MS+ F+RSAKN++ GYS  QVLVR AT+ND   P +D LE++A  +FD+V+FFEIMD+L+
Sbjct: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60

Query: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           KRLND G+ WRH+ KSLT LD+LVR GSE+C  W +++L+++K LR F   D+    D G
Sbjct: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120

Query: 121 QIVRVKARDLVELLQSGEQL 140
           +IVRVKA++L  LL+  E+L
Sbjct: 121 EIVRVKAKELTALLRDEERL 140

 Score =  152 bits (383), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 84/100 (84%), Gaps = 2/100 (2%)

Query: 489 QPMPRMNTGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFK 548
           +P+P+  TGNQ +++K+SELNNLLA GTG+DTFGN G  R+PAQHT+TGTFINSQGTG+K
Sbjct: 354 KPVPKQRTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYK 413

Query: 549 QVNSEGKDPNSNPFLNSQYTGLPSTGIVPAYTGYGFGNQS 588
           Q+ ++   P  NPFL SQYTG+PS+ I P+YTGYGFGNQ+
Sbjct: 414 QITNDA--PKHNPFLTSQYTGIPSSAIAPSYTGYGFGNQA 451

 Score = 38.1 bits (87), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 45/80 (56%), Gaps = 2/80 (2%)

Query: 208 LQRAIEESKRTVQEDEERRRQLSMYDEEDPEFQAALQLSREEEELKNXXXXXXXXXXXXX 267
           LQRA+EES+ T +E+E RR+QL M   +D   QAAL+LS+EEEEL+              
Sbjct: 169 LQRALEESRITAEEEERRRKQL-MMQGDDSSLQAALELSKEEEELRR-LQQLQAQQQAAL 226

Query: 268 XXXXXXXNTAYLDVFGNPVS 287
                     Y D+FGNP+S
Sbjct: 227 WQQQQQQQPMYYDIFGNPIS 246

>ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR206W
           (ENT2) and YDL161W (ENT1)
          Length = 515

 Score =  166 bits (421), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 72/131 (54%), Positives = 101/131 (77%)

Query: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60
           MS+Q +RSAKNV+ GYS  Q+LVR+AT+N+   P +D +E++A  S+ +V+FFEI+ +L+
Sbjct: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60

Query: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           KRL+D  K+WRH+ KSLTV D+LVR G+E C DWAR++L+L + L  F  VD+  G D G
Sbjct: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120

Query: 121 QIVRVKARDLV 131
           QI+RVKAR+LV
Sbjct: 121 QIIRVKARELV 131

 Score =  144 bits (364), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 71/106 (66%), Positives = 84/106 (79%), Gaps = 5/106 (4%)

Query: 484 PAPVPQPMPRMN---TGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFI 540
           P P  QP P++    TGNQ +T+KYSELN LLA GTG+DTFGN G  RIPAQHT+TGTFI
Sbjct: 388 PRPQSQPGPQLQPTRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFI 447

Query: 541 NSQGTGFKQVNSEGKDPNSNPFLNSQYTGLPSTGIVPAYTGYGFGN 586
           NSQGTG+KQV +E   P  NPF+ +QYTGLPST +VP++TGYGFGN
Sbjct: 448 NSQGTGYKQVGNE--PPKHNPFIATQYTGLPSTNMVPSHTGYGFGN 491

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 45/86 (52%), Gaps = 3/86 (3%)

Query: 205 DDDLQRAIEESKRTVQEDEERRRQLSMYDEEDPEFQAALQLSR---EEEELKNXXXXXXX 261
           D DLQRA+EES+ T +E+E RRR+ +   +++ E + ALQLS+   E  +L+        
Sbjct: 167 DPDLQRALEESRITAEEEERRRREKTNQQQDNEELEVALQLSKEEEELRKLRELQQQREQ 226

Query: 262 XXXXXXXXXXXXXNTAYLDVFGNPVS 287
                           Y D+FGNP+S
Sbjct: 227 QMALWQQQQQQQPQAMYYDIFGNPIS 252

>TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {ON}
           Anc_7.342 YLR206W
          Length = 701

 Score =  168 bits (426), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 104/140 (74%), Gaps = 1/140 (0%)

Query: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60
           MS QFVRS KN+ KGYS TQVLVRDATAN+     +D L+ +  +S+D+ +F +I  VL+
Sbjct: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60

Query: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           +R++D  KYWRH+ KSLTV+DYLVRFGSE C  WARD+   L+ LR+F +  D  G DQG
Sbjct: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDF-YYSDSAGIDQG 119

Query: 121 QIVRVKARDLVELLQSGEQL 140
           Q++RVKA +L++LL+  E+L
Sbjct: 120 QLIRVKAAELIDLLRDPERL 139

 Score =  110 bits (275), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 63/83 (75%), Gaps = 3/83 (3%)

Query: 494 MNTGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFKQVNSE 553
           M+TGN  ++ KYS LN LLAQGTG+DTFGNEG  RIPAQHT+TGTFINSQGTG+KQV S 
Sbjct: 594 MHTGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVTSS 653

Query: 554 GKDPNSNPFLNSQYTGLPSTGIV 576
               +  P L +QYTGLP+   V
Sbjct: 654 S---SPIPLLPTQYTGLPAQTAV 673

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 40/53 (75%), Gaps = 2/53 (3%)

Query: 201 RGNDDDDLQRAIEESKRTVQEDEERRRQLSMYDEEDPEFQAALQLSREEEELK 253
           R  D++D+ RA+EESK+T +EDE RRR+    +++D   + A++LS+EE+ELK
Sbjct: 170 RPEDEEDVDRALEESKKTAEEDEARRRKDQEREKQD--LKEAVKLSKEEDELK 220

>KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125C ENT3
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p
          Length = 400

 Score = 86.7 bits (213), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 50/140 (35%), Positives = 84/140 (60%), Gaps = 2/140 (1%)

Query: 2   SRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLEK 61
           ++++ R A+NV+  Y+  +  VR+AT N+        +E IA  +++  +  EI+ ++ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEHIAQGTYNYREREEILGMIFR 74

Query: 62  RLND-SGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           R  + +   WR I K+L +L+YLV+ GSE   D  R +L L+K L +F ++D   G DQG
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLVKHGSERFIDDVRTNLNLVKMLESFHYIDSQ-GRDQG 133

Query: 121 QIVRVKARDLVELLQSGEQL 140
             VR +A  LV+LL+S EQ+
Sbjct: 134 INVRNRASQLVKLLESDEQI 153

>NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {ON}
           Anc_4.346
          Length = 435

 Score = 86.3 bits (212), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 81/135 (60%), Gaps = 2/135 (1%)

Query: 2   SRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLEK 61
           ++++ R A+NV+  Y+  +  VR+AT N+        +E IA  +++  + +EI+ ++ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMESKVREATNNEPWGASSTLMEQIAQGTYNVRERYEIVGMIFR 74

Query: 62  RLND-SGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           R  + +G  WR I K+L +LDYL++ GSE   D  R  L L++ L  F ++D   G DQG
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSEPFIDDVRSSLKLIQMLETFHYIDSE-GRDQG 133

Query: 121 QIVRVKARDLVELLQ 135
             VR +A+ LVELLQ
Sbjct: 134 INVRNRAKLLVELLQ 148

>KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.346
           YJR125C
          Length = 403

 Score = 85.5 bits (210), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 48/135 (35%), Positives = 81/135 (60%), Gaps = 2/135 (1%)

Query: 2   SRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLEK 61
           ++++ R A+NV+  ++  +  VR+AT N+        +E IA  +++  +  E+M +L +
Sbjct: 15  AKKYFRKAQNVVFNFTEMESKVREATNNEPWGASSTLMEQIAQGTYNYKEREEVMMMLMR 74

Query: 62  RLND-SGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           R  + +G  WR I K+L +LDYL+R GSE   D  R  L +++ L +F ++D   G DQG
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIRRGSEKFIDDVRAALRIVRLLESFHYIDSQ-GRDQG 133

Query: 121 QIVRVKARDLVELLQ 135
             VR +A+ +VELLQ
Sbjct: 134 VNVRNRAKQIVELLQ 148

>Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..9313)
           [1257 nt, 419 aa]
          Length = 418

 Score = 85.5 bits (210), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 81/140 (57%), Gaps = 2/140 (1%)

Query: 2   SRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLEK 61
           ++++ R A+NVM  Y+  +  VR+AT N+        +E I+  +++  +  EI+ ++ +
Sbjct: 15  AKKYFRKAQNVMFNYTEMEGKVREATNNEPWGASSTLMEQISQGTYNIREREEILSMIFR 74

Query: 62  RLND-SGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           R  + +   WR I K+L +L+YL++ GSE   D  R  L L+K L +F ++D   G DQG
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLIKHGSERFIDDVRSSLSLIKMLESFHYIDSQ-GRDQG 133

Query: 121 QIVRVKARDLVELLQSGEQL 140
             VR KA+ L  LL+  EQ+
Sbjct: 134 INVRNKAQSLTALLKDDEQI 153

>TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa]
           {ON} Anc_4.346 YJR125C
          Length = 426

 Score = 84.7 bits (208), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 47/140 (33%), Positives = 81/140 (57%), Gaps = 2/140 (1%)

Query: 2   SRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLEK 61
           ++++ R A+NV+  Y+  +  VR+AT N+        +E IA  +++  +  EI+ ++ +
Sbjct: 15  AKKYFRKAQNVVFNYTDMEAKVREATNNEPWGASSTLMEQIAQGTYNPREREEILSMILR 74

Query: 62  RLND-SGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           R  + SG  WR I K+L +L+YL+  G+E   D AR  L L++ L +F +VD   G DQG
Sbjct: 75  RFTEKSGNLWRQIYKALQLLEYLITHGAERFIDEARSSLGLIRMLESFHYVDSE-GRDQG 133

Query: 121 QIVRVKARDLVELLQSGEQL 140
             VR +A+ +  LL S + +
Sbjct: 134 ANVRSRAQAMTSLLSSDDAI 153

>SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 415

 Score = 84.3 bits (207), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 85/140 (60%), Gaps = 2/140 (1%)

Query: 2   SRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLEK 61
           ++++ R A+NV+  Y+  +  VR+AT N+        +E I+  +++  +  EI+ ++ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQISAGTYNYREREEILGMIFR 74

Query: 62  RLND-SGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           R  + +   WR I K+L +L+YL++ GSE   D +R +L L+K L +F + D   G DQG
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLIKHGSERFIDDSRANLTLIKMLESFHYTDSQ-GRDQG 133

Query: 121 QIVRVKARDLVELLQSGEQL 140
             VR +A++LV+LL + +Q+
Sbjct: 134 INVRNRAQELVKLLNNDDQI 153

>TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.346
           YJR125C
          Length = 375

 Score = 82.0 bits (201), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 47/140 (33%), Positives = 79/140 (56%), Gaps = 2/140 (1%)

Query: 2   SRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLEK 61
           ++++ R A+NV+  Y+  +  VR+AT N+        +E I+  +++  +  EI+ ++ +
Sbjct: 15  AKKYFRRAQNVVFNYTDMEAKVREATNNEPWGASTTLMEQISQGTYNMREREEILGMIFR 74

Query: 62  RLNDS-GKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           RL +     WR I K+L +LDYL+R  SE   D  R  + L+K L +F ++D   G DQG
Sbjct: 75  RLTEKRANEWRQIYKALQLLDYLIRHASERFIDDTRSSISLIKMLESFHYIDSQ-GRDQG 133

Query: 121 QIVRVKARDLVELLQSGEQL 140
             VR +A+ L ELL   E +
Sbjct: 134 INVRNRAKALAELLSDDETI 153

>NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa]
           {ON} Anc_4.346
          Length = 423

 Score = 82.4 bits (202), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 79/135 (58%), Gaps = 2/135 (1%)

Query: 2   SRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLEK 61
           ++++ R A+NV+  Y+  +  VR+AT N+        +E IA  +++  +  EI+ ++ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNIREREEILSMIFR 74

Query: 62  RLND-SGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           R  + +G  WR I K+L +LDYL++ GSE   D  R  + +LK L+ F ++ D  G DQG
Sbjct: 75  RFTEKTGSEWRQIYKALQLLDYLIKHGSEKFIDDVRSSVAVLKLLQTFHYI-DAEGRDQG 133

Query: 121 QIVRVKARDLVELLQ 135
             VR +   L+ELL+
Sbjct: 134 INVRNRVTTLIELLR 148

>AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR125C
           (ENT3)
          Length = 364

 Score = 80.9 bits (198), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 80/140 (57%), Gaps = 2/140 (1%)

Query: 2   SRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLEK 61
           ++++ R A+NVM  Y+  +  VR+AT N+        +  IA  +++  +  EI+ ++ +
Sbjct: 15  AKKYFRKAQNVMLNYTGMEAKVREATNNEPWGASSTLMTQIAQGTYNFREREEILAMILR 74

Query: 62  R-LNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           R L  S   WR I KS+ +L+YLV+ GSE   D  R +L L++ L  F ++D   G DQG
Sbjct: 75  RFLEKSANEWRQIYKSMQLLEYLVKHGSERFIDDVRSNLNLIRMLETFHYIDSQ-GRDQG 133

Query: 121 QIVRVKARDLVELLQSGEQL 140
             VR + + LV+LL+  E +
Sbjct: 134 INVRNRTKALVKLLEDDELI 153

>KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 401

 Score = 80.9 bits (198), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 79/134 (58%), Gaps = 2/134 (1%)

Query: 2   SRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLEK 61
           ++++ R A+N++  Y+  +  VR+AT N+        +E I+  +++  +  EI+ ++ +
Sbjct: 15  AKKYFRKAQNMVFNYTEMEAKVREATNNEPWGASSTLMEQISQGTYNYREREEILGMIFR 74

Query: 62  RLND-SGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           R  + +   WR I K+L +LDYL+R G+E   D  R +L L+K L +F ++D   G DQG
Sbjct: 75  RFTEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYIDSQ-GRDQG 133

Query: 121 QIVRVKARDLVELL 134
             VR +A +LV LL
Sbjct: 134 INVRNRAHELVLLL 147

>ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 424

 Score = 80.9 bits (198), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 78/134 (58%), Gaps = 2/134 (1%)

Query: 2   SRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLEK 61
           ++++ R A+NV+  Y+  +  VR+AT N+        +E IA  +++  +  EI+ ++ +
Sbjct: 50  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGTSSTLMEYIAQGTYNLREREEILGMIFR 109

Query: 62  RLND-SGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           R  + +   WR I K+L +L+YL++ GSE   D  R  + LLK L +F +VD   G DQG
Sbjct: 110 RFTEKTANEWRQIYKALQLLEYLIKHGSERFIDDTRCSISLLKMLESFHYVDSQ-GRDQG 168

Query: 121 QIVRVKARDLVELL 134
             VR +A+ L ELL
Sbjct: 169 INVRTRAKALTELL 182

>Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 80.5 bits (197), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 78/134 (58%), Gaps = 2/134 (1%)

Query: 2   SRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLEK 61
           ++++ R A+NV+  Y+  +  VR+AT N+        ++ I+  +++  +  EI+ ++ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLND-SGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           R  + +G  WR I K+L +LDYL++ GSE   D  R  + L+K L  F ++D   G DQG
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILETFHYIDSQ-GRDQG 133

Query: 121 QIVRVKARDLVELL 134
             VR + + L+ELL
Sbjct: 134 INVRTRVKTLIELL 147

>Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125C
           (ENT3) - Ent3p [contig 219] FULL
          Length = 382

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 78/134 (58%), Gaps = 2/134 (1%)

Query: 2   SRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLEK 61
           ++++ R A+NV+  Y+  +  VR+AT N+        +E IA  +++  +  EI+ ++ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQIAQGTYNYREREEILGMIFR 74

Query: 62  RLND-SGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           R  + +   WR I K+L +LDYL+R G+E   D  R +L L+K L +F ++D   G DQG
Sbjct: 75  RFTEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYIDSQ-GRDQG 133

Query: 121 QIVRVKARDLVELL 134
             VR +A +L  LL
Sbjct: 134 INVRNRAHELALLL 147

>Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 80.1 bits (196), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 78/134 (58%), Gaps = 2/134 (1%)

Query: 2   SRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLEK 61
           ++++ R A+NV+  Y+  +  VR+AT N+        ++ I+  +++  +  EI+ ++ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLND-SGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           R  + +G  WR I K+L +LDYL++ GSE   D  R  + L+K L +F + D   G DQG
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILESFHYTDSQ-GRDQG 133

Query: 121 QIVRVKARDLVELL 134
             VR + + LVELL
Sbjct: 134 INVRTRVKALVELL 147

>YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON}
           ENT3Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes; associates with the clathrin
           adaptor Gga2p
          Length = 408

 Score = 79.7 bits (195), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 79/134 (58%), Gaps = 2/134 (1%)

Query: 2   SRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLEK 61
           ++++ R A+NV+  Y+  +  VR+AT N+        ++ I+  +++  +  EI+ ++ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLND-SGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           R  + +G  WR I K+L +LDYL++ GSE   D  R+ + L++ L  F ++D   G DQG
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQ-GRDQG 133

Query: 121 QIVRVKARDLVELL 134
             VR + + L+ELL
Sbjct: 134 INVRTRVKALIELL 147

>TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346
           YJR125C
          Length = 399

 Score = 79.0 bits (193), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 77/135 (57%), Gaps = 2/135 (1%)

Query: 2   SRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLEK 61
           ++++ R A+NVM  Y+  +  VR+AT N+        ++ IA  +++  +  EI+ ++ +
Sbjct: 15  AKKYFRKAQNVMFNYTDMEAKVREATNNEPWGASSTLMKQIAQGTYNIREREEILGMVFR 74

Query: 62  RLND-SGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           R  + +   WR I KSL + DYL++ GSE   D  R  + L+K L +F ++D   G DQG
Sbjct: 75  RYTEKTASEWRQIYKSLQLTDYLIKHGSERFIDDVRTSISLIKMLESFHYIDSQ-GRDQG 133

Query: 121 QIVRVKARDLVELLQ 135
             VR KA+ LV  L+
Sbjct: 134 INVRNKAQSLVAFLK 148

>KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON}
           Anc_4.346 YJR125C
          Length = 399

 Score = 79.0 bits (193), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 78/134 (58%), Gaps = 2/134 (1%)

Query: 2   SRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLEK 61
           ++++ R A+NV+  Y+  +  VR+AT N+        +E IA  +++  +  EI+ ++ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNLREREEILGMIFR 74

Query: 62  RLND-SGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           R  + +G  WR I KSL +LDYL+R GSE   D  R  + L++ L  F ++D   G DQG
Sbjct: 75  RFTEKAGSEWRQIYKSLQLLDYLIRRGSERFIDDVRSSIRLIELLETFHYIDSQ-GRDQG 133

Query: 121 QIVRVKARDLVELL 134
             VR +A+ L ELL
Sbjct: 134 INVRNRAKALGELL 147

>Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {ON}
           YJR125C (REAL)
          Length = 409

 Score = 78.2 bits (191), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 79/134 (58%), Gaps = 2/134 (1%)

Query: 2   SRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLEK 61
           ++++ R A+NV+  Y+  +  VR+AT N+        ++ I+  +++  +  EI+ ++ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLND-SGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           R  + +G  WR I K+L +LDYL++ GSE   D  R+ + L++ L  F ++D   G DQG
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQ-GRDQG 133

Query: 121 QIVRVKARDLVELL 134
             VR + + L++LL
Sbjct: 134 INVRTRVKALIDLL 147

>Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar to
           Ashbya gossypii AER155C
          Length = 392

 Score = 76.3 bits (186), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 80/140 (57%), Gaps = 2/140 (1%)

Query: 2   SRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLEK 61
           ++++ R A+NV+  Y+  +  VR+AT N+        +  IA  +++  +  EI+ ++ +
Sbjct: 15  AKKYFRKAQNVVFNYTGMEAKVREATNNESWGAPSSLMAQIAQGTYNYRERKEILGMIFR 74

Query: 62  R-LNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           R +  +   WR I KS+ +L+YL+  GSE   D  R  L L+K L +F ++D   G DQG
Sbjct: 75  RFVEKTASEWRQIYKSVQLLEYLIYHGSEGFIDDVRSGLNLIKMLESFHYIDSQ-GRDQG 133

Query: 121 QIVRVKARDLVELLQSGEQL 140
             VR + + LV+LL + EQ+
Sbjct: 134 INVRNRTQALVQLLNNDEQI 153

>CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125c ENT3
           cytoskeletal adaptor
          Length = 412

 Score = 73.6 bits (179), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 73/124 (58%), Gaps = 2/124 (1%)

Query: 2   SRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLEK 61
           ++++ R A+NV+  Y+  +  VR+AT N+        +E IA  +++  +  EI+ ++ +
Sbjct: 15  AKKYFRKAQNVVYNYTDMESKVREATNNEPWGASSTLMEQIAQGTYNIREREEILGMIFR 74

Query: 62  RLND-SGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           R  + SG  WR I K+L +L+YL++ GSE   D  R+ + ++K L +F ++ D  G DQG
Sbjct: 75  RFTEKSGSEWRQIYKALQLLEYLIKHGSERFIDDTRNSISIVKLLESFHYI-DSQGRDQG 133

Query: 121 QIVR 124
             VR
Sbjct: 134 VNVR 137

>SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some
           similarities with uniprot|Q07872 Saccharomyces
           cerevisiae YLL038C ENT4 Protein of unknown function
           contains an N-terminal epsin-like domain
          Length = 262

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/141 (32%), Positives = 74/141 (52%), Gaps = 17/141 (12%)

Query: 5   FVRSAKNVMKGYSSTQVLVRDATAND---GRTPHLDTLEDIAGLSFDSVDFFEIMDVLEK 61
           F+RS +N+  G S+T+V V+ AT +D   G T  L  + +I+ L++ +    EI  V+ +
Sbjct: 3   FIRSVRNM--GQSTTEVKVKKATDDDEYSGATGAL--MNEISVLTYSAKTLREITQVIHR 58

Query: 62  RLNDSGKYWR-------HIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDG 114
           RL  SG Y +       HI K+LT++ YL+  GS     W R + +L+  LR F    D 
Sbjct: 59  RL--SGNYRKSSHRNAVHILKTLTLISYLINNGSNDFVSWIRQYAYLVDTLREFNVSADK 116

Query: 115 IGFDQGQIVRVKARDLVELLQ 135
                 + VR+ +  L +LL+
Sbjct: 117 -DRKMAEQVRMLSIKLSKLLK 136

>TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON}
           Anc_4.346 YJR125C
          Length = 339

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 69/134 (51%), Gaps = 2/134 (1%)

Query: 2   SRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLEK 61
           +++F R A+N +   +  +  VR+AT ND     +  +  I   +F+     +I+++L  
Sbjct: 15  AKKFFRMAENFLFNLTDMESKVREATNNDPWGTSVILMAQINAGTFEINQRADIINMLLN 74

Query: 62  R-LNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120
           R L  +G  WR I KS+ +L YL+  GS       + +L L+K L  F F+DD  G++Q 
Sbjct: 75  RFLEKNGSQWRQIYKSVLLLQYLLINGSTEFVSEVKLNLTLIKNLMLFEFIDDQ-GYNQS 133

Query: 121 QIVRVKARDLVELL 134
             +      L+EL+
Sbjct: 134 SKISKATERLIELM 147

>Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON}
           complement(17825..18631) [807 nt, 269 aa]
          Length = 268

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 73/146 (50%), Gaps = 20/146 (13%)

Query: 3   RQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTL-EDIAGLSFDSVDFFEIMDVLEK 61
           R FV+SA         T+  V++AT ++  +    TL  +I+ L++      EI+ VL+K
Sbjct: 8   RNFVQSA---------TEAKVKEATDDNETSGATGTLMNEISVLTYSPKTLKEIIQVLKK 58

Query: 62  RLNDSGKY-----WRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFV--DDG 114
           RL  S K        HI K++T++ YL+  GS     WAR ++ + + L++F  +  DD 
Sbjct: 59  RLTGSSKKSSHRNCVHILKTMTLISYLINNGSNDFIAWARSNIMIFEVLKDFEVIHEDDE 118

Query: 115 IGFDQGQIVRVKARDLVELLQSGEQL 140
              +Q   +R  A DL  L+   E L
Sbjct: 119 KMAEQ---IRYIAGDLCILINDDELL 141

>Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {ON}
           YLL038C (ENT4) - Ent4p [contig 144] FULL
          Length = 254

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 62/112 (55%), Gaps = 12/112 (10%)

Query: 5   FVRSAKNVMKGYSSTQVLVRDATAND---GRTPHLDTLEDIAGLSFDSVDFFEIMDVLEK 61
            +++ +N+  G SST+V  R+AT +D   G T  L  + +++ L++      EI  V+ K
Sbjct: 3   LLKTVRNI--GQSSTEVKTRNATNDDEHNGATGSL--MNELSVLTYSPRTLREITQVIRK 58

Query: 62  RLN-----DSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNF 108
           RL+      S K   H+ K+LT++ YL+  GS+    W R +L+L+  L+ F
Sbjct: 59  RLSGNSRMSSHKNAVHLLKTLTLIAYLINNGSDEFVVWIRSYLYLIDTLKEF 110

>Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to
           Ashbya gossypii ACL061C
          Length = 254

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/116 (33%), Positives = 62/116 (53%), Gaps = 12/116 (10%)

Query: 5   FVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTL-EDIAGLSFDSVDFFEIMDVLEKRL 63
           F+ S +++  G SST V V+ AT +        +L  +IA L++      EI  VL+KRL
Sbjct: 3   FLSSVRHL--GSSSTTVKVKKATDDSEHNGAYGSLMNEIAILTYSPNTLREITQVLKKRL 60

Query: 64  NDSGKYWR-------HIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVD 112
              G Y +       ++ K+LT++ +LV  GSE C  W R HL L+++ ++F   D
Sbjct: 61  --VGNYKKTPSKRAVNLLKTLTLIRFLVINGSEECIAWLRRHLVLIRSFQDFTLRD 114

>ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 259

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 54/99 (54%), Gaps = 6/99 (6%)

Query: 15  GYSSTQVLVRDATANDGRTPHLDTL-EDIAGLSFDSVDFFEIMDVLEKRLNDSGKYWRH- 72
           G SST++ VR AT  D +T    TL  +I+ L++      EI  VL++RL+  G+   H 
Sbjct: 11  GPSSTELKVRKATNEDEKTGATGTLMNEISVLTYSPKTVREITQVLKRRLSSYGRRTSHK 70

Query: 73  ----IEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRN 107
               I K+LT++ YL+  GSE    W R +L   + L++
Sbjct: 71  NSIHIVKALTLILYLINNGSEEFVAWVRGNLIYFECLKS 109

>TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.17
           YLL038C
          Length = 423

 Score = 53.5 bits (127), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 70/133 (52%), Gaps = 12/133 (9%)

Query: 17  SSTQVLVRDAT---ANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLEKRLNDSGKY---- 69
           S T++ VR AT    N G T  L  + +I+ L++ +    EI+ VL+KRL   GK     
Sbjct: 13  SPTELKVRTATDDNENSGATGTL--MNEISVLTYSTKTNKEIVTVLKKRLTGYGKKSSHR 70

Query: 70  -WRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQGQI-VRVKA 127
              HI K+LT++ YL+  GS     W  ++  L + ++NF  V D I  ++  I +R  +
Sbjct: 71  NCIHIIKTLTLIAYLMNNGSLEFIRWINENQLLFEVMKNFE-VSDTIHDEKFAIQIRDLS 129

Query: 128 RDLVELLQSGEQL 140
             ++EL+ + E L
Sbjct: 130 ERILELINNRELL 142

>TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON}
           Anc_4.17 YLL038C
          Length = 280

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 67/133 (50%), Gaps = 13/133 (9%)

Query: 17  SSTQVLVRDATANDGRTPHLDTL-EDIAGLSFDSVDFFEIMDVLEKRL-----NDSGKYW 70
           S T+  VR AT +D  +    TL  +I+ L++      EI+ +L+KRL      +S K  
Sbjct: 13  SPTESKVRQATDDDETSGATGTLMNEISVLTYSPKTLKEIVQILKKRLTGYSKKNSHKNC 72

Query: 71  RHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFR---FVDDGIGFDQGQIVRVKA 127
            HI K+LT++ YL+  GS     W R ++ L + L+NF      D+ +G    QIV +  
Sbjct: 73  VHILKTLTLITYLINNGSNDFIAWTRSNIMLFEYLKNFEVQNLEDEKMG---QQIVFI-C 128

Query: 128 RDLVELLQSGEQL 140
            D+  ++   + L
Sbjct: 129 NDICNIINDDDML 141

>KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 255

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 55/102 (53%), Gaps = 10/102 (9%)

Query: 15  GYSSTQVLVRDATAND---GRTPHLDTLEDIAGLSFDSVDFFEIMDVLEKRLN-----DS 66
           G S T++  ++AT +D   G T  L  + +I+ L++ S    EI  V+ KRL+      S
Sbjct: 11  GQSQTEIKTKNATNDDEYSGATGSL--MNEISVLTYSSRTLREITAVVRKRLSGNNRKSS 68

Query: 67  GKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNF 108
            K   HI K+LT+  YL+  GS     W R +++L+ +L+ F
Sbjct: 69  HKNAVHILKTLTLTAYLINNGSNEFVAWIRSYVYLIDSLKEF 110

>TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17
           YLL038C
          Length = 257

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 67/130 (51%), Gaps = 7/130 (5%)

Query: 17  SSTQVLVRDATANDGRTPHLDTL-EDIAGLSFDSVDFFEIMDVLEKRL-----NDSGKYW 70
           S+T++ V+ AT  +  +    TL  +I+ L++      EI+ V+ KRL      +S K  
Sbjct: 13  STTELKVKQATDENESSGATGTLMNEISVLTYSPKTLKEIVQVVRKRLMGHGRRNSHKIC 72

Query: 71  RHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQGQIVRVKARDL 130
            H+ K+LT++ YL+  GS     W R ++ L+  L+ F  V D      GQ +R  ++DL
Sbjct: 73  IHLVKTLTLVTYLMNNGSNDFIAWVRGNMALVDCLKEFN-VQDRNDEKIGQQIRAMSQDL 131

Query: 131 VELLQSGEQL 140
             L++  + L
Sbjct: 132 CTLIKDDDLL 141

>Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 66/126 (52%), Gaps = 8/126 (6%)

Query: 17  SSTQVLVRDATANDGRTPHLDTL-EDIAGLSFDSVDFFEIMDVLEKRL------NDSGKY 69
           S T+  V+ AT+ D  +    TL  +I+ L++      EI+ V+ KRL       +S + 
Sbjct: 13  SPTESKVKQATSEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNRRNSHRN 72

Query: 70  WRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQGQIVRVKARD 129
              + K+LT++ YL+  GS     W + ++ L++ L NF  + D     + + +R  +R+
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILENF-HIQDVRDERKREEIRKLSRN 131

Query: 130 LVELLQ 135
           L+ELLQ
Sbjct: 132 LLELLQ 137

>Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 67/131 (51%), Gaps = 8/131 (6%)

Query: 17  SSTQVLVRDATANDGRTPHLDTL-EDIAGLSFDSVDFFEIMDVLEKRL------NDSGKY 69
           S T+  V+ AT+ D  +    TL  +I+ L++      EI+ ++ KRL       +S + 
Sbjct: 13  SPTESKVKQATSEDETSGATGTLMNEISILTYSPKTVREIIQIVRKRLLLGQNRRNSHRS 72

Query: 70  WRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQGQIVRVKARD 129
              + K+LT++ YL+  GS     W + ++ L++ L +F+   D      G+ +R  +R+
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQ-AQDARDDRNGEEIRKLSRN 131

Query: 130 LVELLQSGEQL 140
           L ELLQ  E L
Sbjct: 132 LHELLQDDELL 142

>KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038C ENT4
           Protein of unknown function contains an N- terminal
           epsin- like domain
          Length = 225

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 66/121 (54%), Gaps = 11/121 (9%)

Query: 15  GYSSTQVLVRDAT-ANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLEKRLNDSGKYWRH- 72
           G S+TQ+ V+ AT +N+        + +++ L++      EI +V+ KRL +     ++ 
Sbjct: 11  GQSTTQLKVKQATDSNESYGATGTLMNELSVLTYSEKSANEIYEVIRKRLMNGSSRLKNS 70

Query: 73  ------IEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQGQIVRVK 126
                 + K+LT+++YL+  GSE    W R HL  ++AL+++   +D    D+ ++ ++K
Sbjct: 71  HDSVVQVLKTLTLIEYLLYNGSEEFVLWMRRHLAYIEALKDYHCSNDK---DKSKVKQIK 127

Query: 127 A 127
           +
Sbjct: 128 S 128

>ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL038C
           (ENT4)
          Length = 234

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 64/129 (49%), Gaps = 11/129 (8%)

Query: 15  GYSSTQVLVRDATAND---GRTPHLDTLEDIAGLSFDSVDFFEIMDVLEKRLN-----DS 66
           G S T   VR AT ++   G +  L  + +I  L++      ++  VL+KRL+      S
Sbjct: 11  GSSPTAAKVRKATDDNEFVGASSAL--ISEITILTYSCKTLLDVTRVLKKRLSGNANKSS 68

Query: 67  GKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQGQIVRVK 126
            K   HI K+LT+ +YL+  GSE    W +    LL+ L++F   ++       QI R  
Sbjct: 69  HKNAVHILKALTLTNYLIANGSEDFVQWLQGCAVLLRRLKDFTTGNERDSHMASQI-RSF 127

Query: 127 ARDLVELLQ 135
           +  L+EL+Q
Sbjct: 128 SLSLLELMQ 136

>NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4.17
           YLL038C
          Length = 267

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 65/133 (48%), Gaps = 13/133 (9%)

Query: 17  SSTQVLVRDATANDGRTPHLDTL-EDIAGLSFDSVDFFEIMDVLEKRLNDSGKYWRH--- 72
           S T+  V+ AT  D       TL  +I+ L++      EI+ VL+KRL+   +   H   
Sbjct: 13  SPTESKVKQATNEDETMGATGTLMNEISVLTYSPKTLKEIVQVLKKRLSGYSRKTSHKNC 72

Query: 73  --IEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRF---VDDGIGFDQGQIVRVKA 127
             I K+LT++ YL+  GS     W R++  L+  L + +     DD +G +   I    A
Sbjct: 73  IFIIKTLTLMAYLINNGSNEFVAWIRNNSSLISNLISEKVEYPKDDKMGPEIKSI----A 128

Query: 128 RDLVELLQSGEQL 140
            DL+EL+Q  + L
Sbjct: 129 ADLMELIQDDDLL 141

>NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON}
           Anc_4.17 YLL038C
          Length = 310

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 64/128 (50%), Gaps = 12/128 (9%)

Query: 19  TQVLVRDATANDGRTPHLDTL-EDIAGLSFDSVDFFEIMDVLEKRLND---SGKYWRH-- 72
           T+  V+ AT ++  T    TL  +I+ L++      +I+ V++KRL+    S K   H  
Sbjct: 15  TESKVKQATDDNETTGATGTLMNEISVLTYSPKTLKDIIQVIKKRLSSATSSNKKLSHKT 74

Query: 73  ---IEKSLTVLDYLVRFGSEHCADWARDHLFLLKALR---NFRFVDDGIGFDQGQIVRVK 126
              I K+LT++ YL+  GS    +W R + +L++ +    NF+  D+         ++V 
Sbjct: 75  SVYIIKTLTLISYLINNGSNEFIEWLRLNFYLVENITKKCNFQLQDNSADSKMIGQIKVI 134

Query: 127 ARDLVELL 134
           A D+  L+
Sbjct: 135 AEDMTNLI 142

>SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly
           similar to uniprot|P53309 Saccharomyces cerevisiae
           YGR241C YAP1802 Yeast Assembly Polypeptide, member of
           AP180 protein family, binds Pan1p and clathrin; member
           of clathrin assembly polypeptide AP180 family and weakly
           similar to uniprot|P38856 Saccharomyces cerevisiae
           YHR161C YAP1801 Yeast Assembly Polypeptide member of
           AP180 protein family binds Pan1p and clathrin clathrin
           assembly protein
          Length = 669

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 39/86 (45%), Gaps = 2/86 (2%)

Query: 22  LVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLEKRLNDSGKYWRHIEKSLTVLD 81
           LV+ AT      P    ++ I   + DS +F EIM  LE R+ND+   W  + KSL V+ 
Sbjct: 7   LVKGATKIKMAPPKQKYIDPILLGTSDSSEFMEIMKALESRINDTA--WTIVYKSLIVIH 64

Query: 82  YLVRFGSEHCADWARDHLFLLKALRN 107
            ++R G          H      LR+
Sbjct: 65  LMMRDGDRDVTIKYLSHHLEFFQLRD 90

>YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}
           ENT4Protein of unknown function, contains an N-terminal
           epsin-like domain; proposed to be involved in the
           trafficking of Arn1p in the absence of ferrichrome
          Length = 247

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 52/103 (50%), Gaps = 7/103 (6%)

Query: 17  SSTQVLVRDATANDGRTPHLDTL-EDIAGLSFDSVDFFEIMDVLEKRL------NDSGKY 69
           S T+  V+ AT  D  +    TL  +I+ L++      EI+ V+ KRL       +S + 
Sbjct: 13  SPTESKVKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNRRNSHRN 72

Query: 70  WRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVD 112
              + K+LT++ YL+  GS     W + ++ L++ L +F+  D
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQVQD 115

>Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 52/103 (50%), Gaps = 7/103 (6%)

Query: 17  SSTQVLVRDATANDGRTPHLDTL-EDIAGLSFDSVDFFEIMDVLEKRL------NDSGKY 69
           S T+  V+ AT  D  +    TL  +I+ L++      EI+ V+ KRL       +S + 
Sbjct: 13  SPTESKVKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVVRKRLLLGQNRRNSHRN 72

Query: 70  WRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVD 112
              + K+LT++ YL+  GS     W + ++ L++ L +F+  D
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKSNMILVEILEDFQVQD 115

>YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}
           YAP1801Protein involved in clathrin cage assembly; binds
           Pan1p and clathrin; homologous to Yap1802p, member of
           the AP180 protein family
          Length = 637

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 43/91 (47%), Gaps = 10/91 (10%)

Query: 22  LVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLEKRLNDSGKYWRHIEKSLTVLD 81
           LV+ AT      P    L+ I   + +  DF+EI+  L+ R+ND+   W  + KSL V+ 
Sbjct: 7   LVKGATKIKSAPPKQKYLDPILLGTSNEEDFYEIVKGLDSRINDTA--WTIVYKSLLVVH 64

Query: 82  YLVRFGSEHCADWARDHLFLLKALRNFRFVD 112
            ++R GS+  A        L    RN  F D
Sbjct: 65  LMIREGSKDVA--------LRYYSRNLEFFD 87

>TBLA0H01210 Chr8 (269471..270946) [1476 bp, 491 aa] {ON} Anc_8.335
           YDR153C
          Length = 491

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 66/164 (40%), Gaps = 37/164 (22%)

Query: 3   RQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLEKR 62
           R   R A+N++  Y   Q+ +R AT  D   P    L+ I  L  + V   +I+D + KR
Sbjct: 17  RNAARYAQNMIIAYEPYQIDIRQATNTDSWGPTKKHLDQIL-LDRNKVPLRKIVDYIMKR 75

Query: 63  LNDS-------------------GKYWRHIEKSLTVLDY-------------LVRFGSEH 90
           L D                    G  WR + KSL VL +             LV +   H
Sbjct: 76  LMDHINTRPRNLYDRARKDYVNYGTEWRVVFKSLIVLKFLLLNVDPGEQLDDLVEYLLNH 135

Query: 91  CADWARDHLFLLKALRNFRFVDDGIGFDQGQIVRVKARDLVELL 134
              +  D L + +   +     DG      +++++K ++++EL+
Sbjct: 136 YGFFKHDILEIYQVQNS----SDGKDSKHQEVIQLKCQEIIELI 175

>CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038c ENT4
          Length = 260

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 57/109 (52%), Gaps = 8/109 (7%)

Query: 8   SAKNVMKGY--SSTQVLVRDATANDGRTPHLDTL-EDIAGLSFDSVDFFEIMDVLEKRLN 64
           S  +  KG+  S T++ VR AT ++       TL  +I+ L++      +++ V+ KRL+
Sbjct: 2   SLMHTFKGFLLSPTELKVRQATDDNELAGATGTLMNEISVLTYSKKTLKDVIQVIRKRLS 61

Query: 65  -----DSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNF 108
                +S +   H+ K+LT++ YL+  GS     W +   ++++ L +F
Sbjct: 62  GVNKRNSHRTCLHVLKTLTLVSYLLNNGSNDFIAWLKSSKYVIEYLSSF 110

>Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON}
           YHR161C (REAL)
          Length = 621

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 45/90 (50%), Gaps = 6/90 (6%)

Query: 22  LVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLEKRLNDSGKYWRHIEKSLTVLD 81
           LV+ AT      P    L+ I   +    DF+EI+  L+ R+ND+   W  + K+L V+ 
Sbjct: 7   LVKGATKIKSAPPKQKYLDPILLATGSEEDFYEIVKALDSRVNDTA--WTIVYKTLLVVH 64

Query: 82  YLVRFGSEHCA--DWARDHLFLLKALRNFR 109
            ++R G +  A   ++R+  F   ++ N R
Sbjct: 65  LMMREGKKDVALRYYSRNLEFF--SIENIR 92

>TBLA0B05770 Chr2 complement(1364772..1366814) [2043 bp, 680 aa]
           {ON} Anc_5.84 YGR241C
          Length = 680

 Score = 39.7 bits (91), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 51/112 (45%), Gaps = 9/112 (8%)

Query: 22  LVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLEKRLNDSGKYWRHIEKSLTVLD 81
           LV+ AT      P    ++ I   S D  DF EI+  L  R++DS   W  + KSL V  
Sbjct: 7   LVKGATKIKMAPPKQKYIDPILMGSTDPRDFHEIIRALYSRISDSA--WTVVYKSLIVTH 64

Query: 82  YLVRFGSEHCA-DWARDHL--FLLKALRNFRFVDDGI----GFDQGQIVRVK 126
            L+R G +    D+  ++L  F L  +   +F    +     ++Q  +VR K
Sbjct: 65  LLIREGEKDITLDYLSNNLDFFNLNGINTSKFSSGDVRALERYNQYLLVRAK 116

>Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON}
           YHR161C (REAL)
          Length = 627

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 41/91 (45%), Gaps = 10/91 (10%)

Query: 22  LVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLEKRLNDSGKYWRHIEKSLTVLD 81
           LV+ AT      P    L+ I   +    DF+EI+  L  R+ND+   W  + KSL V+ 
Sbjct: 7   LVKGATKIKSAPPKQKYLDPILLGTSSEEDFYEIVKGLNFRINDTA--WTIVYKSLLVVH 64

Query: 82  YLVRFGSEHCADWARDHLFLLKALRNFRFVD 112
            ++R G++  A        L    RN  F D
Sbjct: 65  LMIREGAKDVA--------LRYYSRNLEFFD 87

>KAFR0B05800 Chr2 complement(1200666..1201814) [1149 bp, 382 aa]
           {ON} Anc_8.335 YDR153C
          Length = 382

 Score = 38.1 bits (87), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 66/161 (40%), Gaps = 32/161 (19%)

Query: 3   RQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLEKR 62
           R   R A+NV+  Y   Q+ VR AT  D   P    LE +    F  V  + + + + KR
Sbjct: 17  RNAARFAQNVIVQYEPYQIDVRRATNTDAWGPTTKHLEKVMRNRF-QVPMYLVTEYILKR 75

Query: 63  LNDS-------------------GKYWRHIEKSLTVLDYL---VRFGSE-----HCADWA 95
           L D                    G  WR + K LTV++YL   V  G E      C    
Sbjct: 76  LIDHIATKPKNLYEKARKEYVNYGSEWRVVLKCLTVIEYLLLNVNDGDELNQIKSCL-LT 134

Query: 96  RDHLFLLKALRNF--RFVDDGIGFDQGQIVRVKARDLVELL 134
             H+ L + + NF  +F +DG      + +R K   ++++L
Sbjct: 135 HKHI-LTREVLNFKIKFSNDGKMEVHERSIRKKGEKILQML 174

>KLLA0A05522g Chr1 (507778..509481) [1704 bp, 567 aa] {ON} similar
          to uniprot|P53309 Saccharomyces cerevisiae YGR241C
          YAP1802 Yeast Assembly Polypeptide, member of AP180
          protein family, binds Pan1p and clathrin; member of
          clathrin assembly polypeptide AP180 family
          Length = 567

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 36/71 (50%), Gaps = 2/71 (2%)

Query: 22 LVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLEKRLNDSGKYWRHIEKSLTVLD 81
          LV+ AT      P     + I   + +  DF EI++ LE+R+NDS   W  + KSL V  
Sbjct: 7  LVKGATKIKMAPPKTKYTDPILLGTTNERDFGEIVNALEERINDSA--WTVVFKSLAVAH 64

Query: 82 YLVRFGSEHCA 92
           ++R G +  A
Sbjct: 65 LMIRDGDKDIA 75

>TDEL0B00320 Chr2 complement(59154..61067) [1914 bp, 637 aa] {ON}
           Anc_8.863 YML088W
          Length = 637

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 3/47 (6%)

Query: 205 DDDLQRAIEESKRTVQEDEERRRQLSMYDEEDPEFQAALQLSREEEE 251
           DDDL+RAIEES R  QE+++     S  DE+D +F  AL+ SR +EE
Sbjct: 547 DDDLERAIEES-RLAQENQQFVE--SFADEDDEDFIRALEQSRADEE 590

>KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17
           YLL038C
          Length = 275

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 51/104 (49%), Gaps = 14/104 (13%)

Query: 5   FVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTL-EDIAGLSFDSVDFFEIMDVLEKRL 63
           F  S +N++  YS T++ VR AT  +       TL  +I+ L++ +    EI+ +L+K+L
Sbjct: 3   FFNSVRNLV--YSQTELKVRQATDENEIIRSTGTLMNEISVLTYSAKTLKEIIGILKKKL 60

Query: 64  N-----------DSGKYWRHIEKSLTVLDYLVRFGSEHCADWAR 96
           +            S K    + K+ T++ YL+  GS    +W +
Sbjct: 61  SLLYGLKNGNGIISHKVCVQVLKTFTLISYLLNNGSNDFINWLK 104

>NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8.335
           YDR153C
          Length = 418

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 63/160 (39%), Gaps = 28/160 (17%)

Query: 3   RQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLEKR 62
           R   R A+NV+  Y   QV +R AT  D   P    L+ +    +  V  + +++   KR
Sbjct: 17  RNAARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLQKVLRNRY-QVPLYLMVEYTLKR 75

Query: 63  LNDS-------------------GKYWRHIEKSLTVLDYL---VRFGSE-----HCADWA 95
           L D                    G  WR + K LTV++YL   V  G E      C D  
Sbjct: 76  LVDHIAVKPKNFYERARKEYVNYGAEWRVVLKCLTVVEYLMLNVDDGDELNQVVRCLDTH 135

Query: 96  RDHLFLLKALRNFRFVDDGIGFDQGQIVRVKARDLVELLQ 135
           +  L     +    F +DG      + +R K  D+++ L+
Sbjct: 136 KHILTREIPMYKVGFSNDGKMEIHERGIRKKGEDILQYLE 175

>KAFR0L02050 Chr12 complement(386478..388451) [1974 bp, 657 aa] {ON}
           Anc_8.863 YML088W
          Length = 657

 Score = 35.8 bits (81), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 34/49 (69%), Gaps = 1/49 (2%)

Query: 203 NDDDDLQRAIEESKRTVQEDEERRRQLSMYDEEDPEFQAALQLSREEEE 251
           +DD++ +R +EES+R  + D+ RR  +S  D++D E + AL+ SR E++
Sbjct: 565 DDDEEFRRILEESQRQAEIDQ-RRTPVSHEDDDDEELRRALEQSRLEQQ 612

>AFL176C Chr6 complement(106401..108215) [1815 bp, 604 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNR006W
           (VPS27)
          Length = 604

 Score = 34.7 bits (78), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 34/62 (54%), Gaps = 7/62 (11%)

Query: 199 GARGNDDDDLQRAIEESKRTVQEDEERRRQLSMY-------DEEDPEFQAALQLSREEEE 251
             R ++DDDL+RAIE S R  +  +     ++         D+EDPEF AA+Q S  E +
Sbjct: 256 AEREDEDDDLRRAIELSLRESKTQDNLVPTVTRLENSDATKDDEDPEFLAAVQASLREHQ 315

Query: 252 LK 253
           L+
Sbjct: 316 LE 317

>ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|Q6Q5U2 Saccharomyces
           cerevisiae YDR153C ENT5 Protein containing an N-terminal
           epsin-like domain involved in clathrin recruitment and
           traffic between the Golgi and endosomes associates with
           the clathrin adaptor Gga2p clathrin adaptor complex AP-1
           and clathrin
          Length = 407

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 41/101 (40%), Gaps = 20/101 (19%)

Query: 3   RQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLEKR 62
           R   R A+N++  Y   QV VR AT  D   P    LE +    +  V  + I +   KR
Sbjct: 17  RNAARFAQNMIVQYEPYQVDVRRATNTDSWGPTPKHLEKVLRNRY-QVPMYLITEYTLKR 75

Query: 63  LNDS-------------------GKYWRHIEKSLTVLDYLV 84
           L D                    G  WR + K LTV++YL+
Sbjct: 76  LIDHIATRPKNFYEKARKEYVNYGSEWRVVLKCLTVVEYLL 116

>KNAG0J02870 Chr10 (549107..550096) [990 bp, 329 aa] {ON} Anc_4.17
           YLL038C
          Length = 329

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 60/134 (44%), Gaps = 18/134 (13%)

Query: 17  SSTQVLVRDATANDGRTPHLDT---LEDIAGLSFDSVDFFEIMDVLEKRLNDSGKYWRHI 73
           S+T++ V+ AT +D       T   + +I+ L++      EI  VL KR +      R +
Sbjct: 13  STTELKVKQAT-DDSEVLSSSTGTVMNEISVLTYSPKTLKEIQSVLRKRFHLMSTLPRKV 71

Query: 74  E--------KSLTVLDYLVRFGSEHCADWARDHLFLLKALRN-----FRFVDDGIGFDQG 120
                    K+LT++ +L+  GS     W + ++   + L+N     F F D        
Sbjct: 72  LHRSCLIVLKTLTLILFLLNNGSNAFVSWIKSNVGAFEPLQNVPITEFSFTDKA-DLPMY 130

Query: 121 QIVRVKARDLVELL 134
           + +R  A D+++L+
Sbjct: 131 EQIRQSASDILQLI 144

>TDEL0G01080 Chr7 (220997..222544) [1548 bp, 515 aa] {ON} Anc_5.84
           YGR241C
          Length = 515

 Score = 31.2 bits (69), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 22/41 (53%), Gaps = 6/41 (14%)

Query: 557 PNSNPFLN-----SQYTGLPSTG-IVPAYTGYGFGNQSDQQ 591
           P  NPFL       Q TG  S   I PA+TG GFG  S++Q
Sbjct: 338 PTGNPFLTMNDLPQQQTGFYSANQITPAFTGAGFGGYSNEQ 378

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.132    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,342,684
Number of extensions: 1794830
Number of successful extensions: 8376
Number of sequences better than 10.0: 114
Number of HSP's gapped: 8468
Number of HSP's successfully gapped: 176
Length of query: 646
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 530
Effective length of database: 40,180,143
Effective search space: 21295475790
Effective search space used: 21295475790
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 69 (31.2 bits)