Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0B026407.344ON30230216210.0
KAFR0L014707.344ON3003036935e-90
Kpol_530.367.344ON3113076225e-79
NCAS0E028907.344ON3153076172e-78
NDAI0E045007.344ON3273226157e-78
KLLA0D12474g7.344ON3123116042e-76
Suva_10.2997.344ON3202835904e-74
YLR205C (HMX1)7.344ON3173105879e-74
TDEL0C020307.344ON3113095818e-73
KLTH0H01386g7.344ON3072885791e-72
ZYRO0F11594g7.344ON3092835772e-72
Smik_12.2637.344ON3182815783e-72
Kwal_56.246247.344ON3072885731e-71
SAKL0F11242g7.344ON3092875712e-71
Ecym_47297.344ON3263075662e-70
Skud_12.2687.344ON3183105652e-70
TPHA0F029207.344ON3202975504e-68
ACL154W7.344ON3192795157e-63
CAGL0A03905g7.344ON2822654552e-54
Smik_15.183.26ON39771659.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0B02640
         (302 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0B02640 Chr2 complement(510618..511526) [909 bp, 302 aa] {ON...   629   0.0  
KAFR0L01470 Chr12 (272767..273669) [903 bp, 300 aa] {ON} Anc_7.3...   271   5e-90
Kpol_530.36 s530 complement(84853..85788) [936 bp, 311 aa] {ON} ...   244   5e-79
NCAS0E02890 Chr5 complement(565154..566101) [948 bp, 315 aa] {ON...   242   2e-78
NDAI0E04500 Chr5 complement(1009814..1010797) [984 bp, 327 aa] {...   241   7e-78
KLLA0D12474g Chr4 complement(1058158..1059096) [939 bp, 312 aa] ...   237   2e-76
Suva_10.299 Chr10 complement(525524..526486) [963 bp, 320 aa] {O...   231   4e-74
YLR205C Chr12 complement(552724..553677) [954 bp, 317 aa] {ON}  ...   230   9e-74
TDEL0C02030 Chr3 complement(351368..352303) [936 bp, 311 aa] {ON...   228   8e-73
KLTH0H01386g Chr8 complement(128402..129325) [924 bp, 307 aa] {O...   227   1e-72
ZYRO0F11594g Chr6 (951726..952655) [930 bp, 309 aa] {ON} similar...   226   2e-72
Smik_12.263 Chr12 complement(499758..500714) [957 bp, 318 aa] {O...   227   3e-72
Kwal_56.24624 s56 (1078618..1079541) [924 bp, 307 aa] {ON} YLR20...   225   1e-71
SAKL0F11242g Chr6 (878709..879638) [930 bp, 309 aa] {ON} similar...   224   2e-71
Ecym_4729 Chr4 complement(1423384..1424364) [981 bp, 326 aa] {ON...   222   2e-70
Skud_12.268 Chr12 complement(499347..500303) [957 bp, 318 aa] {O...   222   2e-70
TPHA0F02920 Chr6 (645567..646529) [963 bp, 320 aa] {ON} Anc_7.34...   216   4e-68
ACL154W Chr3 (83962..84921) [960 bp, 319 aa] {ON} Syntenic homol...   202   7e-63
CAGL0A03905g Chr1 complement(395219..396067) [849 bp, 282 aa] {O...   179   2e-54
Smik_15.18 Chr15 complement(35621..36814) [1194 bp, 397 aa] {ON}...    30   9.5  

>KNAG0B02640 Chr2 complement(510618..511526) [909 bp, 302 aa] {ON}
           Anc_7.344 YLR205C
          Length = 302

 Score =  629 bits (1621), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/302 (100%), Positives = 302/302 (100%)

Query: 1   MMSTIPSPTDTDALANRINFHTRDLHNEVDKAFSVKFMMALRHSFIYTDILKTFYTVFGT 60
           MMSTIPSPTDTDALANRINFHTRDLHNEVDKAFSVKFMMALRHSFIYTDILKTFYTVFGT
Sbjct: 1   MMSTIPSPTDTDALANRINFHTRDLHNEVDKAFSVKFMMALRHSFIYTDILKTFYTVFGT 60

Query: 61  VEQRIDELIASEGGDGVGAILGEFYVPEFRRADKIKRDLVFLGEWDTVESGQWTPPPQLA 120
           VEQRIDELIASEGGDGVGAILGEFYVPEFRRADKIKRDLVFLGEWDTVESGQWTPPPQLA
Sbjct: 61  VEQRIDELIASEGGDGVGAILGEFYVPEFRRADKIKRDLVFLGEWDTVESGQWTPPPQLA 120

Query: 121 GFLQYLRSEMDRDPITVLAPCHVLYLALFAGGRVFKSSLFKNLGFLPNFRDKNGPGEEMS 180
           GFLQYLRSEMDRDPITVLAPCHVLYLALFAGGRVFKSSLFKNLGFLPNFRDKNGPGEEMS
Sbjct: 121 GFLQYLRSEMDRDPITVLAPCHVLYLALFAGGRVFKSSLFKNLGFLPNFRDKNGPGEEMS 180

Query: 181 DHTLVSNATNFFQFAETIEDENKLRWTYKRNYELATRDTLTEDQKLAVIAASRDVFRHTF 240
           DHTLVSNATNFFQFAETIEDENKLRWTYKRNYELATRDTLTEDQKLAVIAASRDVFRHTF
Sbjct: 181 DHTLVSNATNFFQFAETIEDENKLRWTYKRNYELATRDTLTEDQKLAVIAASRDVFRHTF 240

Query: 241 AVIEEICQQNHDELMSFRSFKIVTYFLEEWKFNKNFKRGVLWGVAFLAQFLFVVLYCCFL 300
           AVIEEICQQNHDELMSFRSFKIVTYFLEEWKFNKNFKRGVLWGVAFLAQFLFVVLYCCFL
Sbjct: 241 AVIEEICQQNHDELMSFRSFKIVTYFLEEWKFNKNFKRGVLWGVAFLAQFLFVVLYCCFL 300

Query: 301 RR 302
           RR
Sbjct: 301 RR 302

>KAFR0L01470 Chr12 (272767..273669) [903 bp, 300 aa] {ON} Anc_7.344
           YLR205C
          Length = 300

 Score =  271 bits (693), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 143/303 (47%), Positives = 198/303 (65%), Gaps = 12/303 (3%)

Query: 1   MMSTIPSPTDTDALANRINFHTRDLHNEVDKAFSVKFMMALRHSFIYTDILKTFYTVFGT 60
           M   +PSPTDTDALANRINFHTRDLHN +DK  S+K   ALRHSFIY DIL ++Y VF T
Sbjct: 1   MEQQVPSPTDTDALANRINFHTRDLHNVIDKTMSIKATFALRHSFIYKDILLSYYYVFRT 60

Query: 61  VEQRIDELIASEGGDGVGAILGEFYVPEFRRADKIKRDLVFLGEWDTVESGQW-TPPPQL 119
           +E  ID +I+++    +G IL  F+  +FRR D+I +DL FL         QW +  P+L
Sbjct: 61  LEDEIDFIISNDRS-HIGEILRGFFNDKFRRKDQILKDLKFLNVIQDQSDDQWLSSRPEL 119

Query: 120 AGFLQYLRSEMDRDPITVLAPCHVLYLALFAGGRVFKSSLFKNLGF--LPNFRDKNGPGE 177
             FL +++S +   P+ VLA CHVLYLALFAGGR+ ++S+ KNL F  +P F       +
Sbjct: 120 CKFLNFIKSNLHEHPVDVLAYCHVLYLALFAGGRIMRASMNKNLSFFFMPKF-------D 172

Query: 178 EMSDHTLVSNATNFFQFAETIEDENKLRWTYKRNYELATRDTLTEDQKLAVIAASRDVFR 237
           +MS   ++ NATNFF+F + I  ENKL+  YKRNY++ T+  L ED+KL +I  SR++F+
Sbjct: 173 KMSHTDVIMNATNFFKFDKDIVSENKLKSEYKRNYDILTKAKLNEDEKLEIIDISREIFK 232

Query: 238 HTFAVIEEICQQNHDELMSFRSFKIVTYFLEEWKFNK-NFKRGVLWGVAFLAQFLFVVLY 296
             F +++EI   N DELM   ++K+VTY +EEWKF K   K+ V+  +     F+F+ L+
Sbjct: 233 FNFNLLQEIGTVNKDELMKNFNYKMVTYVVEEWKFRKPQIKKYVILFLIIFHLFVFINLF 292

Query: 297 CCF 299
             F
Sbjct: 293 KKF 295

>Kpol_530.36 s530 complement(84853..85788) [936 bp, 311 aa] {ON}
           complement(84853..85788) [936 nt, 312 aa]
          Length = 311

 Score =  244 bits (622), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 131/307 (42%), Positives = 186/307 (60%), Gaps = 24/307 (7%)

Query: 1   MMSTIPSPTDTDALANRINFHTRDLHNEVDKAFSVKFMMALRHSFIYTDILKTFYTVFGT 60
           M STIPSPTD  ALANRINF TRD HN+V     ++  +AL+H FIY + L  FY +F T
Sbjct: 1   MTSTIPSPTDVGALANRINFETRDFHNKVSAFMGIRLALALKHGFIYREGLVVFYHIFNT 60

Query: 61  VEQRIDELIASEGGDGVGAILGEFYVPEFRRADKIKRD--LVFLGEWDT--------VES 110
           +E  ID ++ ++    +  IL  FY+ EFRR DKI +D  L++  E+          + S
Sbjct: 61  IETEIDLVLNNQDDSQMKLILSSFYLDEFRRKDKILKDLELLYYPEFQNDRPQLLEFINS 120

Query: 111 GQWT-PPPQLAGFLQYLRSEMDRDPITVLAPCHVLYLALFAGGRVFKSSLFKNLGFLPNF 169
            ++T    QL  F++Y+++    DP T+LA CHVLYLALFAGG++ KS++ K+LG  P F
Sbjct: 121 DRFTNDSEQLQNFVKYIQTNATEDPCTLLAYCHVLYLALFAGGKIMKSNVTKHLGIFPKF 180

Query: 170 RDKNGPGEEMSDHTLVSNATNFFQFAETIEDEN---KLRWTYKRNYELATRDTLTEDQKL 226
                  E +S   +++  TNF+QF ++   E    KLRW YK+NYEL+TRD L E QKL
Sbjct: 181 -------EHLSHKEIIARGTNFYQFTDSTNPETTDVKLRWLYKKNYELSTRDELLEQQKL 233

Query: 227 AVIAASRDVFRHTFAVIEEICQQNHDELMSFRSFKIVTYFLEEWKFNKN---FKRGVLWG 283
            VI  S+DVF      I E+  +N +ELM+  S+K+ T+ +EEWK+N +   F +  L  
Sbjct: 234 TVIKTSKDVFVMLENCIAEVGTRNRNELMNIFSYKLFTFIVEEWKYNSSISPFLKKSLMF 293

Query: 284 VAFLAQF 290
           +  + QF
Sbjct: 294 ILIIIQF 300

>NCAS0E02890 Chr5 complement(565154..566101) [948 bp, 315 aa] {ON}
           Anc_7.344 YLR205C
          Length = 315

 Score =  242 bits (617), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 129/307 (42%), Positives = 187/307 (60%), Gaps = 24/307 (7%)

Query: 3   STIPSPTDTDALANRINFHTRDLHNEVDKAFSVKFMMALRHSFIYTDILKTFYTVFGTVE 62
           + IPSPTDT ALANRINF TRD HN+++K  S+K  +ALRH FIY   + T+Y +F  VE
Sbjct: 7   TIIPSPTDTKALANRINFQTRDAHNKINKKMSIKLAIALRHGFIYRQGILTYYYIFKVVE 66

Query: 63  QRIDELIASEGGD---GVGAILGEFYVPEFRRADKIKRDLVFL--GEWDTVESGQW---- 113
           + I +L  S        +G +L + ++PEF R + + +DL  L   E+ T E+ Q     
Sbjct: 67  EEIIKLTTSPTTSEEVKIGNLLSKTWIPEFNRTENLLKDLQLLYHDEYPTKEALQLFLET 126

Query: 114 ---TPPPQLAGFLQYLRSEMDRDPITVLAPCHVLYLALFAGGRVFKSSLFKNLGFLPNFR 170
                PP L  F++Y+   +  +P ++ A CHVLYLALFAGG++ +S ++KNLGFLPNF 
Sbjct: 127 NATELPPVLDSFIKYIHQSILENPCSIFAYCHVLYLALFAGGKIIRSKIYKNLGFLPNFN 186

Query: 171 DKNGPGEEMSDHTLVSNATNFFQF-AETIEDENKLRWTYKRNYELATRDTLTEDQKLAVI 229
                   +S   +    TNFF+F ++ + +E KL+  +K+NYEL TR++L E +K  +I
Sbjct: 187 -------HLSSKEVFEKGTNFFKFGSDGVIEETKLKLEFKKNYELNTRESLNEKEKSIII 239

Query: 230 AASRDVFRHTFAVIEEICQQNHDELMSFRSFKIVTYFLEEWKFNKNF--KRG--VLWGVA 285
             S+ +F +    +EE+   N ++LMS  +FK+VTY LEEWKFN NF  KRG  ++  V 
Sbjct: 240 ETSKKIFDYNLMAMEELGSINKEQLMSKLNFKMVTYLLEEWKFNDNFLSKRGKHLIMVVM 299

Query: 286 FLAQFLF 292
            L   LF
Sbjct: 300 VLLHMLF 306

>NDAI0E04500 Chr5 complement(1009814..1010797) [984 bp, 327 aa] {ON}
           Anc_7.344 YLR205C
          Length = 327

 Score =  241 bits (615), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 130/322 (40%), Positives = 189/322 (58%), Gaps = 42/322 (13%)

Query: 2   MSTIPSPTDTDALANRINFHTRDLHNEVDKAFSVKFMMALRHSFIYTDILKTFYTVFGTV 61
           ++ IPSPTDT+ALANRINFHTRD HN++DK  ++K  +ALRH  IY   + T+Y +F  V
Sbjct: 6   VTIIPSPTDTEALANRINFHTRDAHNKIDKKMTLKLAVALRHGDIYRQGILTYYYIFQAV 65

Query: 62  EQRIDELI-----ASEGGDGVGAILGEFYVPEFRRADKIKRDLVFLGEWDTVESGQ---- 112
           E  I+ L+     A++     G++L + ++ EF R DK+ +DL  L   D  ++ Q    
Sbjct: 66  ESEINYLLSFNTDATKEQKRTGSLLSKIWLTEFNRTDKLFKDLKLLYS-DRFQNDQDLLN 124

Query: 113 ----------WTPPPQLAGFLQYLRSEMDRDPITVLAPCHVLYLALFAGGRVFKSSLFKN 162
                          +L  F+ ++   +  +P  +LA CHVLYLALFAGG++ KS ++KN
Sbjct: 125 FINEEFKLIHQNKNSKLYQFVNFIHISIQTNPCCILAYCHVLYLALFAGGKIIKSKIYKN 184

Query: 163 LGFLPNFRDKNGPGEEMSDHTLVSNATNFFQFAE---------TIEDENKLRWTYKRNYE 213
           LGFLPNF         +S   L +NATNFFQF E         +I +ENKL+  +KRN+E
Sbjct: 185 LGFLPNFN-------HLSSKELFNNATNFFQFTENSDSLEGINSISNENKLKLKFKRNFE 237

Query: 214 LATRDTLTEDQKLAVIAASRDVFRHTFAVIEEICQQNHDELMSFRSFKIVTYFLEEWKFN 273
           L TR  L E++KL +I  ++ +F+     +EE+ Q+N  ELM+  SFK++ Y  EEWKFN
Sbjct: 238 LNTRSNLNENEKLTIIEIAKQIFQWNLESMEELGQRNQKELMNLFSFKLINYLFEEWKFN 297

Query: 274 KNFKRGVLWGVAFLAQFLFVVL 295
            + K+       F A  +FV+L
Sbjct: 298 DSIKKN------FKAILMFVIL 313

>KLLA0D12474g Chr4 complement(1058158..1059096) [939 bp, 312 aa]
           {ON} similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205C HMX1 ER localized, heme-binding peroxidase
           involved in the degradation of heme
          Length = 312

 Score =  237 bits (604), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 131/311 (42%), Positives = 185/311 (59%), Gaps = 18/311 (5%)

Query: 3   STIPSPTDTDALANRINFHTRDLHNEVDKAFSVKFMMALRHSFIYTDILKTFYTVFGTVE 62
           +TIPSPTD  ALANRINF TRD+HN+++   S+K   A+RH FIY   +  +Y VF  +E
Sbjct: 7   TTIPSPTDVGALANRINFQTRDMHNKINAYMSMKMAFAMRHGFIYRQGIVAYYYVFHAIE 66

Query: 63  QRIDELI---ASEGGDGVGAILGEFYVPEFRRADKIKRDLVFL--GEWDTVESGQ----- 112
           Q ID L+    +   + V  IL +F+  EFRR+DK+  DL  L   E+   E  Q     
Sbjct: 67  QEIDRLLEHPVTVQDEKVKGILQQFWCEEFRRSDKLVLDLQVLYNDEYPGSEQLQEFLDG 126

Query: 113 WTPPPQLAGFLQYLRSEMDRDPITVLAPCHVLYLALFAGGRVFKSSLFKNLGFLPNFRDK 172
           +  P +L  F+  + S + ++P T+LA CHVLYLALFAGGRV KS+L++++G  P F   
Sbjct: 127 FQLPAKLQEFVDEIHSNVQKEPHTILAYCHVLYLALFAGGRVMKSNLYRHIGLFPKFG-- 184

Query: 173 NGPGEEMSDHTLVSNATNFFQFAET-IEDENKLRWTYKRNYELATRDTLTEDQKLAVIAA 231
                 +S   LV  ATNFF F+E  ++DEN+LRW YK+ YELATR  LTE +KL +I  
Sbjct: 185 -----HLSPKELVRRATNFFTFSEEGVDDENRLRWQYKKGYELATRTELTEAEKLRIIEV 239

Query: 232 SRDVFRHTFAVIEEICQQNHDELMSFRSFKIVTYFLEEWKFNKNFKRGVLWGVAFLAQFL 291
           S+ +F+    V+ EI + N  ELM   S+K++++  EEWK+++     V   + F     
Sbjct: 240 SQTIFQRNMEVVAEIGEINRAELMGKFSYKLISFLSEEWKYSEKLTPEVKKLIVFALIVF 299

Query: 292 FVVLYCCFLRR 302
            +V     LRR
Sbjct: 300 NMVFVYTILRR 310

>Suva_10.299 Chr10 complement(525524..526486) [963 bp, 320 aa] {ON}
           YLR205C (REAL)
          Length = 320

 Score =  231 bits (590), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 123/283 (43%), Positives = 173/283 (61%), Gaps = 18/283 (6%)

Query: 3   STIPSPTDTDALANRINFHTRDLHNEVDKAFSVKFMMALRHSFIYTDILKTFYTVFGTVE 62
           + IPSPTD  ALANRINFHTRD HN+++    +K  +A+RH FIY   +  +Y VF  +E
Sbjct: 9   TIIPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIE 68

Query: 63  QRIDELI---ASEGGDGVGAILGEFYVPEFRRADKIKRDLVFL--GEWDTVES-----GQ 112
           Q ID L+    SE       IL +F++ +FRR+ +I +DL  L    + + ES       
Sbjct: 69  QEIDRLLNDAVSEKELQACGILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLAT 128

Query: 113 WTPPPQLAGFLQYLRSEMDRDPITVLAPCHVLYLALFAGGRVFKSSLFKNLGFLPNFRDK 172
           +  PP L  F+  +   + ++P T+L+ CHVLYLALFAGG++ +S+L++ LG  PNF   
Sbjct: 129 FEKPPLLQQFVDDIHDNIRQEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNF--- 185

Query: 173 NGPGEEMSDHTLVSNATNFFQFAET-IEDENKLRWTYKRNYELATRDTLTEDQKLAVIAA 231
               E+++   LV   TNFF F+E    +E +L+W YK+NYELATR  LTE QKL +I+ 
Sbjct: 186 ----EKLTQKELVKKGTNFFTFSELGPTEETRLKWEYKKNYELATRTELTEAQKLKIISV 241

Query: 232 SRDVFRHTFAVIEEICQQNHDELMSFRSFKIVTYFLEEWKFNK 274
           +  +F   F ++ EI + N  ELMS  SFK VTY  EEW F+K
Sbjct: 242 AEGIFDWNFNIVAEIGELNRRELMSKFSFKCVTYVYEEWMFSK 284

>YLR205C Chr12 complement(552724..553677) [954 bp, 317 aa] {ON}
           HMX1ER localized heme oxygenase, involved in heme
           degradation during iron starvation and in the oxidative
           stress response; expression is regulated by AFT1 and
           oxidative stress; relocates to the perinuclear region in
           the presence of oxidants
          Length = 317

 Score =  230 bits (587), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 126/310 (40%), Positives = 180/310 (58%), Gaps = 19/310 (6%)

Query: 3   STIPSPTDTDALANRINFHTRDLHNEVDKAFSVKFMMALRHSFIYTDILKTFYTVFGTVE 62
           + IPSPTD  ALANRINF TRD HN+++    +K  +A+RH FIY   +  +Y VF  +E
Sbjct: 7   TIIPSPTDVGALANRINFQTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIE 66

Query: 63  QRIDELI---ASEGGDGVGAILGEFYVPEFRRADKIKRDLVFL--GEWDTVES-----GQ 112
           Q ID L+    +E       IL +F++ +FRR+ +I +DL  L    + + ES       
Sbjct: 67  QEIDRLLNDPVTEEELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLAT 126

Query: 113 WTPPPQLAGFLQYLRSEMDRDPITVLAPCHVLYLALFAGGRVFKSSLFKNLGFLPNFRDK 172
           +  PP L  F+  +   + ++P T+L+ CHVLYLALFAGG++ +S+L++ LG  PNF   
Sbjct: 127 FQKPPLLQQFINNIHENIHKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNF--- 183

Query: 173 NGPGEEMSDHTLVSNATNFFQFAET-IEDENKLRWTYKRNYELATRDTLTEDQKLAVIAA 231
               E++S   LV   TNFF F++    +E +L+W YK+NYELATR  LTE QKL +I+ 
Sbjct: 184 ----EKLSQKELVKKGTNFFTFSDLGPTEETRLKWEYKKNYELATRTELTEAQKLQIISV 239

Query: 232 SRDVFRHTFAVIEEICQQNHDELMSFRSFKIVTYFLEEWKFNKN-FKRGVLWGVAFLAQF 290
           +  +F   F ++ EI + N  ELM   SFK +TY  EEW FNK+   R  L  V  L   
Sbjct: 240 AEGIFDWNFNIVAEIGELNRRELMGKFSFKCITYLYEEWMFNKDSATRRALHTVMLLVLS 299

Query: 291 LFVVLYCCFL 300
           +  +    FL
Sbjct: 300 IIAIWVLYFL 309

>TDEL0C02030 Chr3 complement(351368..352303) [936 bp, 311 aa] {ON}
           Anc_7.344 YLR205C
          Length = 311

 Score =  228 bits (581), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 134/309 (43%), Positives = 185/309 (59%), Gaps = 25/309 (8%)

Query: 4   TIPSPTDTDALANRINFHTRDLHNEVDKAFSVKFMMALRHSFIYTDILKTFYTVFGTVEQ 63
           TIP+PTD  ALANRINFHTRD HN+V+   SV+   AL+H FIY   +  FY +F  VEQ
Sbjct: 7   TIPAPTDVGALANRINFHTRDAHNKVNAYMSVRLAFALKHGFIYRQGILAFYHIFDAVEQ 66

Query: 64  RIDELIASEGGD---GVGAILGEFYVPEFRRADKIKRDL--VFLGEWDTVES----GQWT 114
            +D L+     D    +  +L +F++ EFRR ++I +DL  ++  E+   ES     +  
Sbjct: 67  ELDRLLNDPQNDEERQMQHVLRQFWLEEFRRTNRIFKDLEVLYSPEYSDSESLRNFVEHQ 126

Query: 115 P-PPQLAGFLQYLRSEMDRDPITVLAPCHVLYLALFAGGRVFKSSLFKNLGFLPNFRDKN 173
           P  PQL  F+  + S + +D  T+LA CHVLYLALFAGG+V +S+L+++ G  P F    
Sbjct: 127 PLAPQLQSFVDSIHSTVQQDSCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKF---- 182

Query: 174 GPGEEMSDHTLVSNATNFFQFAETIED-ENKLRWTYKRNYELATRDTLTEDQKLAVIAAS 232
              E ++   LV   TNFF F++   D ENKLRW YK  YELATR  L+E QK  ++  S
Sbjct: 183 ---EYLTPKELVIRGTNFFTFSDEGSDAENKLRWKYKEGYELATRQELSESQKTRILQVS 239

Query: 233 RDVFRHTFAVIEEICQQNHDELMSFRSFKIVTYFLEEWKF----NKNFKRGVLWGVAFLA 288
             +F     VI EI + N +ELMS  SFK++TY  EEWK+    +K  K  ++  +A L 
Sbjct: 240 SQIFDWNMDVIGEIGEMNRNELMSKFSFKLLTYLSEEWKYSTILSKRSKDSII-VMAILI 298

Query: 289 QFL--FVVL 295
           QFL  ++VL
Sbjct: 299 QFLVAYIVL 307

>KLTH0H01386g Chr8 complement(128402..129325) [924 bp, 307 aa] {ON}
           similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205C HMX1 ER localized, heme-binding peroxidase
           involved in the degradation of heme
          Length = 307

 Score =  227 bits (579), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 121/288 (42%), Positives = 175/288 (60%), Gaps = 18/288 (6%)

Query: 2   MSTIPSPTDTDALANRINFHTRDLHNEVDKAFSVKFMMALRHSFIYTDILKTFYTVFGTV 61
           M+TIPSPTD  ALANRINFHTRD HN++DK  S KF  A++H FIY   +  F+ VF  +
Sbjct: 1   MTTIPSPTDVGALANRINFHTRDQHNKIDKQMSAKFAFAMKHGFIYRQGVLAFFYVFQAI 60

Query: 62  EQRIDEL---IASEGGDGVGAILGEFYVPEFRRADKIKRD--LVFLGEWDTVES-----G 111
           EQ +D L     +   +    IL +F+  EFRRA +I +D  L++  E+ T  S      
Sbjct: 61  EQELDRLRQEAQTPEEEQTRDILNQFWTEEFRRAPRILQDLELLYAKEFPTSASLRTFLE 120

Query: 112 QWTPPPQLAGFLQYLRSEMDRDPITVLAPCHVLYLALFAGGRVFKSSLFKNLGFLPNFRD 171
           + T  P+L GF+ Y+ + +   P  +LA CHVLYLALFAGGRV +S+++++ G  P F +
Sbjct: 121 ETTLAPELQGFVDYVHASIRSRPTAILAYCHVLYLALFAGGRVMRSTIYRSTGLFPKFPN 180

Query: 172 KNGPGEEMSDHTLVSNATNFFQFAET-IEDENKLRWTYKRNYELATRDTLTEDQKLAVIA 230
                  ++   +V   TNFF F++  ++ EN+LR  YKR YELATR  LTE+QKL ++ 
Sbjct: 181 -------LTTEEVVRRGTNFFTFSDAGVQAENQLRKNYKRGYELATRQGLTEEQKLNILD 233

Query: 231 ASRDVFRHTFAVIEEICQQNHDELMSFRSFKIVTYFLEEWKFNKNFKR 278
            S  +F     V+ EI + N  ELM   SF+++T+ +EEW+++    R
Sbjct: 234 VSNAIFEWNTRVVTEIGEINRQELMGKLSFRLLTFVIEEWQYSDKLTR 281

>ZYRO0F11594g Chr6 (951726..952655) [930 bp, 309 aa] {ON} similar to
           uniprot|P32339 Saccharomyces cerevisiae YLR205C HMX1 ER
           localized, heme-binding peroxidase involved in the
           degradation of heme
          Length = 309

 Score =  226 bits (577), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 122/283 (43%), Positives = 173/283 (61%), Gaps = 21/283 (7%)

Query: 2   MSTIPSPTDTDALANRINFHTRDLHNEVDKAFSVKFMMALRHSFIYTDILKTFYTVFGTV 61
           M+TIP+PTD  ALANRINFHTRD HN+++   SV+   AL+H +I+   +  +Y +F  +
Sbjct: 1   MATIPAPTDVGALANRINFHTRDAHNKINAYMSVRLAFALKHGWIFRQGILAYYYIFQAI 60

Query: 62  EQRIDELI---ASEGGDGVGAILGEFYVPEFRRADKIKRDLVFL--GEWDT-------VE 109
           EQ +D ++    +E    +  +LG+F++ +FRR D+I +DL  L   E+ T       + 
Sbjct: 61  EQELDRIMDHARNEKEMQMQNVLGKFWMNDFRRTDRIFQDLTLLYSPEFPTESSLEQFLT 120

Query: 110 SGQWTPPPQLAGFLQYLRSEMDRDPITVLAPCHVLYLALFAGGRVFKSSLFKNLGFLPNF 169
           SG    P  L  F+  +   +  +P T+LA CHVLYLALFAGG+V +S+L+++ G  P F
Sbjct: 121 SGNHLAPT-LQAFVDSIHKNVQEEPCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKF 179

Query: 170 RDKNGPGEEMSDHTLVSNATNFFQFAET-IEDENKLRWTYKRNYELATRDTLTEDQKLAV 228
                  + +S   LV   TNFF F+E   E ENKLRW YKR YELATRD LTE+QK  +
Sbjct: 180 -------QHLSPRELVQRGTNFFTFSEEGSEAENKLRWRYKRGYELATRDELTEEQKQKI 232

Query: 229 IAASRDVFRHTFAVIEEICQQNHDELMSFRSFKIVTYFLEEWK 271
           I+ S ++F+     I EI + N  ELM   SF+++TY  EEWK
Sbjct: 233 ISVSSEIFQWNMETIAEIGELNRQELMGSVSFRLLTYLHEEWK 275

>Smik_12.263 Chr12 complement(499758..500714) [957 bp, 318 aa] {ON}
           YLR205C (REAL)
          Length = 318

 Score =  227 bits (578), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 122/281 (43%), Positives = 171/281 (60%), Gaps = 18/281 (6%)

Query: 5   IPSPTDTDALANRINFHTRDLHNEVDKAFSVKFMMALRHSFIYTDILKTFYTVFGTVEQR 64
           IPSPTD  ALANRINFHTRD HN+++    +K  +A+RH FIY   +  +Y VF  +EQ 
Sbjct: 9   IPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQE 68

Query: 65  IDELIAS--EGGD-GVGAILGEFYVPEFRRADKIKRDLVFL--GEWDTVES-----GQWT 114
           ID L+     G +    AIL +F++ +FRR+ +I +DL  L    + + ES       + 
Sbjct: 69  IDRLLNDPVTGKELQTSAILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFE 128

Query: 115 PPPQLAGFLQYLRSEMDRDPITVLAPCHVLYLALFAGGRVFKSSLFKNLGFLPNFRDKNG 174
            PP L  F+  +   + ++P T+L+ CHVLYLALFAGG++ +S+L++ LG  PNF     
Sbjct: 129 KPPVLQQFVNNIHENIQKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNF----- 183

Query: 175 PGEEMSDHTLVSNATNFFQFAET-IEDENKLRWTYKRNYELATRDTLTEDQKLAVIAASR 233
             E++S   LV   TNFF F++    +E +L+  YK+NYELATR  LTE QKL +I+ + 
Sbjct: 184 --EKLSQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVAE 241

Query: 234 DVFRHTFAVIEEICQQNHDELMSFRSFKIVTYFLEEWKFNK 274
            +F   F ++ EI + N  ELM   SFK VTY  EEW FNK
Sbjct: 242 GIFDWNFNIVAEIGELNRRELMGKFSFKCVTYVYEEWMFNK 282

>Kwal_56.24624 s56 (1078618..1079541) [924 bp, 307 aa] {ON} YLR205C
           (HMX1) - Putative heme oxygenase [contig 161] FULL
          Length = 307

 Score =  225 bits (573), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 125/288 (43%), Positives = 176/288 (61%), Gaps = 18/288 (6%)

Query: 2   MSTIPSPTDTDALANRINFHTRDLHNEVDKAFSVKFMMALRHSFIYTDILKTFYTVFGTV 61
           MSTIPSPTD  ALANRINF+TRD HN++DK  SVKF  A++H FIY   L  F+ VF  +
Sbjct: 1   MSTIPSPTDVGALANRINFYTRDEHNKIDKQMSVKFAFAMKHGFIYRQGLLAFFYVFQAI 60

Query: 62  EQRIDELIA-SEGGDGVGA--ILGEFYVPEFRRADKIKRD--LVFLGEWDTVES-----G 111
           EQ ID L+  ++  + V    IL +F+V  F R  +I +D  L++  E+ + E       
Sbjct: 61  EQEIDRLLQNAQTAEEVQTRDILLQFWVSSFSRTPRIYQDLKLLYAKEFPSDEQLSLFLQ 120

Query: 112 QWTPPPQLAGFLQYLRSEMDRDPITVLAPCHVLYLALFAGGRVFKSSLFKNLGFLPNFRD 171
           Q T PP+  GF+ ++   +   P ++LA CHVLYLALFAGGRV +S+++++ G  P F D
Sbjct: 121 QNTLPPEQQGFVDFVHESVRARPTSILAFCHVLYLALFAGGRVMRSTIYRSTGLFPKFPD 180

Query: 172 KNGPGEEMSDHTLVSNATNFFQFAET-IEDENKLRWTYKRNYELATRDTLTEDQKLAVIA 230
                  ++   +V   TNFF F++  ++ EN+LR  YKR YELATR+ LTEDQKL ++ 
Sbjct: 181 -------LTPEEVVRKGTNFFTFSDDGVQAENQLRKEYKRGYELATREGLTEDQKLNILE 233

Query: 231 ASRDVFRHTFAVIEEICQQNHDELMSFRSFKIVTYFLEEWKFNKNFKR 278
            +   F     VI EI + N  ELM   SFK+V++ ++EWK  +   R
Sbjct: 234 VAAATFEWNTRVISEIGEINRQELMGKLSFKLVSFAIDEWKHTEKLTR 281

>SAKL0F11242g Chr6 (878709..879638) [930 bp, 309 aa] {ON} similar to
           uniprot|P32339 Saccharomyces cerevisiae YLR205C HMX1 ER
           localized, heme-binding peroxidase involved in the
           degradation of heme
          Length = 309

 Score =  224 bits (571), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 121/287 (42%), Positives = 169/287 (58%), Gaps = 18/287 (6%)

Query: 3   STIPSPTDTDALANRINFHTRDLHNEVDKAFSVKFMMALRHSFIYTDILKTFYTVFGTVE 62
           +TIPSPTD  ALANRINFHTRD HN+++   SVK   A++H  IY   +  FY +F  VE
Sbjct: 4   TTIPSPTDVGALANRINFHTRDSHNKINADMSVKLAFAMKHGHIYRQGILAFYYIFAAVE 63

Query: 63  QRIDELIASEGGD---GVGAILGEFYVPEFRRADKIKRDLVFL--GEWDTVESGQW---- 113
           Q ID L+ +           IL +F+  EFRR++ I +DL  L   E+ T          
Sbjct: 64  QEIDNLLQNASTPLELQTQKILNQFWCEEFRRSNMIFQDLELLYSKEYSTRTELHAFLDD 123

Query: 114 -TPPPQLAGFLQYLRSEMDRDPITVLAPCHVLYLALFAGGRVFKSSLFKNLGFLPNFRDK 172
              PPQ   F++Y+   +   P T+LA CHVLYLALFAGG++ KS+++++ G  P F   
Sbjct: 124 NVLPPQQQAFVEYIHQTVREKPYTILAYCHVLYLALFAGGKLMKSNIYRHTGLFPKF--- 180

Query: 173 NGPGEEMSDHTLVSNATNFFQFAETIED-ENKLRWTYKRNYELATRDTLTEDQKLAVIAA 231
               + ++   +V   TNFF F+E   D E KLRW YK+ YELATR  LTE+QK  +I  
Sbjct: 181 ----QHLTPEQIVRRGTNFFTFSEEGADAEGKLRWEYKKGYELATRKELTEEQKQEIIKV 236

Query: 232 SRDVFRHTFAVIEEICQQNHDELMSFRSFKIVTYFLEEWKFNKNFKR 278
           S ++F     VI E+ + N +ELM   SFK+V++ LEEWK+++   +
Sbjct: 237 SSEIFDWNMDVIGELGEINRNELMGKFSFKLVSFILEEWKYSEKLSK 283

>Ecym_4729 Chr4 complement(1423384..1424364) [981 bp, 326 aa] {ON}
           similar to Ashbya gossypii ACL154W
          Length = 326

 Score =  222 bits (566), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 125/307 (40%), Positives = 183/307 (59%), Gaps = 19/307 (6%)

Query: 2   MSTIPSPTDTDALANRINFHTRDLHNEVDKAFSVKFMMALRHSFIYTDILKTFYTVFGTV 61
           +  IPSPTD  ALANRINF TRD+H + D     K  +A+RH FIY   +  FY +F  V
Sbjct: 19  VGMIPSPTDVGALANRINFCTRDMHTKADAFVMGKMALAMRHGFIYRQGILAFYYIFHAV 78

Query: 62  EQRIDELIASEGGD---GVGAILGEFYVPEFRRADKIKRDLVFL--GEWDTVESGQ---- 112
           EQ+ID L+ +        + AIL +F+  EFRR+ ++ RDL F    E+ T    Q    
Sbjct: 79  EQQIDRLLETPSTKEELQISAILRQFWCEEFRRSGRLLRDLEFFYHHEYPTQNELQQFLN 138

Query: 113 -WTPPPQLAGFLQYLRSEMDRDPITVLAPCHVLYLALFAGGRVFKSSLFKNLGFLPNFRD 171
            +  PP+L  F+ ++R +   +P T+LA CHVLY ALFAGG+V +S++++N+G  P  + 
Sbjct: 139 DFELPPKLQRFVDFIRDKTMENPSTILAYCHVLYNALFAGGKVMRSNIYRNIGLFP--KP 196

Query: 172 KNGPGEEMSDHTLVSNATNFFQFAET-IEDENKLRWTYKRNYELATRDTLTEDQKLAVIA 230
           K     E S      N TNFF F++  +++ENKLRW YK+NYELATR+ L E+QKL +I 
Sbjct: 197 KGISAAESS-----RNGTNFFTFSDDGVDEENKLRWQYKKNYELATREGLDENQKLEIID 251

Query: 231 ASRDVFRHTFAVIEEICQQNHDELMSFRSFKIVTYFLEEWKFNKNFKRGVLWGVAFLAQF 290
            S   F+    ++ EI + N  ELM+  SFK++T+   EW++N+     V   +A    F
Sbjct: 252 VSIANFQAVMDILGEIGETNKKELMNIFSFKLLTFLSNEWRYNQKLSSEVKQALAIAVFF 311

Query: 291 L-FVVLY 296
           + F+++Y
Sbjct: 312 INFLMIY 318

>Skud_12.268 Chr12 complement(499347..500303) [957 bp, 318 aa] {ON}
           YLR205C (REAL)
          Length = 318

 Score =  222 bits (565), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 123/310 (39%), Positives = 181/310 (58%), Gaps = 24/310 (7%)

Query: 3   STIPSPTDTDALANRINFHTRDLHNEVDKAFSVKFMMALRHSFIYTDILKTFYTVFGTVE 62
           + IPSPTD  ALANRINFHTRD HN+++    ++  +A+RH FIY   +  +Y VF  +E
Sbjct: 7   TIIPSPTDVGALANRINFHTRDAHNKINTFMGIRMAIAMRHGFIYRQGILAYYYVFDAIE 66

Query: 63  QRIDELI---ASEGGDGVGAILGEFYVPEFRRADKIKRDLVFL--GEWDTVES-----GQ 112
           Q ID L+    +E       IL +F++ +FRR+ +I +DL  L    + + ES      +
Sbjct: 67  QEIDRLLHDPVTEKELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNLFKSTESLNEFLAK 126

Query: 113 WTPPPQLAGFLQYLRSEMDRDPITVLAPCHVLYLALFAGGRVFKSSLFKNLGFLPNFRDK 172
           +  PP L  F+  +   + ++P T+L+ CHVLYLALFAGG++ +S+L++ LG  PNF   
Sbjct: 127 FEKPPLLQQFVNDIHENIRKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNF--- 183

Query: 173 NGPGEEMSDHTLVSNATNFFQFAET-IEDENKLRWTYKRNYELATRDTLTEDQKLAVIAA 231
               E +S   LV   TNFF F++    +E +L+  YK+NYELATR  LTE QKL +I+ 
Sbjct: 184 ----ERLSQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISV 239

Query: 232 SRDVFRHTFAVIEEICQQNHDELMSFRSFKIVTYFLEEW------KFNKNFKRGVLWGVA 285
           +  +F   F ++ EI + N  ELM   SFK VTY  EEW       F K F   +L  ++
Sbjct: 240 AGGIFDWNFHIVAEIGELNRRELMGKFSFKCVTYVYEEWMSDKDSAFRKAFNTAMLLMLS 299

Query: 286 FLAQFLFVVL 295
            +A ++  +L
Sbjct: 300 IIAVWVIYLL 309

>TPHA0F02920 Chr6 (645567..646529) [963 bp, 320 aa] {ON} Anc_7.344
           YLR205C
          Length = 320

 Score =  216 bits (550), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 120/297 (40%), Positives = 168/297 (56%), Gaps = 27/297 (9%)

Query: 2   MSTIPSPTDTDALANRINFHTRDLHNEVDKAFSVKFMMALRHSFIYTDILKTFYTVFGTV 61
           +  IPSPTD  ALANRINF TRD HN++    S++  +ALRH FIY   L  FY +FGT+
Sbjct: 4   VKIIPSPTDVKALANRINFETRDFHNKIGAFMSIRLALALRHGFIYRQGLVAFYHIFGTI 63

Query: 62  EQRIDELIASEGGD------GVGAILGEFYVPEFRRADKIKRDLVFL------GEWDTV- 108
           E  ID L+ +   +          IL  FYV EFRR D + +DL  L      G    V 
Sbjct: 64  ENEIDNLLNTLDSELDSVQIQTKKILKSFYVNEFRRKDNLLQDLTVLYYPEFKGNRQDVL 123

Query: 109 -----ESGQWTPPPQLAGFLQYLRSEMDRDPITVLAPCHVLYLALFAGGRVFKSSLFKNL 163
                E+      P+L  F  Y++      P T++A CHVLYLALFAGG++ KS++ KN+
Sbjct: 124 DFLNSETFNKENYPELNFFTDYIKDTTKEKPYTIIAYCHVLYLALFAGGKIMKSNVLKNV 183

Query: 164 GFLPNFRDKNGPGEEMSDHTLVSNATNFFQFAE--TIEDENKLRWTYKRNYELATRDTLT 221
           G  P F       + MS   + +  +NFF+F +  T + ++KLR+ YK+NYEL+TRD L 
Sbjct: 184 GLFPKF-------DHMSHEEVTNQGSNFFRFTQEDTADFDSKLRFEYKKNYELSTRDELN 236

Query: 222 EDQKLAVIAASRDVFRHTFAVIEEICQQNHDELMSFRSFKIVTYFLEEWKFNKNFKR 278
           E QK  +I  S+++F     VI EI  +N  +LM   + K +TY +EEWK+N+   +
Sbjct: 237 EMQKNDIIEVSKNIFVMLENVIAEIGAKNRTKLMGGFTLKTITYLVEEWKYNEKLTK 293

>ACL154W Chr3 (83962..84921) [960 bp, 319 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR205C (HMX1)
          Length = 319

 Score =  202 bits (515), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 117/279 (41%), Positives = 159/279 (56%), Gaps = 17/279 (6%)

Query: 5   IPSPTDTDALANRINFHTRDLHNEVDKAFSVKFMMALRHSFIYTDILKTFYTVFGTVEQR 64
           +P PTDT ALANRINFHTR+LH++ D   S KF +ALRH  IY   L   Y +F +VEQ 
Sbjct: 18  VPLPTDTGALANRINFHTRELHSKADAFVSAKFAVALRHPSIYRQGLLAMYYIFRSVEQH 77

Query: 65  IDELI---ASEGGDGVGAILGEFYVPEFRRADKIKRD--LVFLGEWDTVES-----GQWT 114
           ID L+   A+     +G IL  F+ PEF RA  + +D  + +  E+ T          + 
Sbjct: 78  IDRLLRAPATADEARIGEILRAFWRPEFARAPALVQDFEVYYAAEYSTSAQLHQFLDSYE 137

Query: 115 PPPQLAGFLQYLRSEMDRDPITVLAPCHVLYLALFAGGRVFKSSLFKNLGFLPNFRDKNG 174
            PP+LA  +  + +   R P T+LA CHVLYLALFAGGRV +S+L + LG LP       
Sbjct: 138 LPPRLAAAVADIEAAALRQPWTILAHCHVLYLALFAGGRVMRSALSRQLGLLPR------ 191

Query: 175 PGEEMSDHTLVSNATNFFQFAETIEDENKLRWTYKRNYELATRDTLTEDQKLAVIAASRD 234
               +S        T+FF F     +ENK R  YKR YELATR  L+E +K  VI A+R 
Sbjct: 192 -AAGLSARETQLRGTHFFTFGAGAGEENKARVAYKRAYELATRTALSEAEKADVIDAARA 250

Query: 235 VFRHTFAVIEEICQQNHDELMSFRSFKIVTYFLEEWKFN 273
            F H  AV+ E+  +N  EL+   S++++T+  EEW++ 
Sbjct: 251 DFDHIQAVMAELAVRNRQELLGSPSYRLLTFLGEEWRYR 289

>CAGL0A03905g Chr1 complement(395219..396067) [849 bp, 282 aa] {ON}
           similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205c
          Length = 282

 Score =  179 bits (455), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 100/265 (37%), Positives = 153/265 (57%), Gaps = 30/265 (11%)

Query: 33  FSVKFMMALRHSFIYTDILKTFYTVFGTVEQRIDELIASEGGDGV-GA------------ 79
            SV+F +ALRH  +Y   +  FY VF  +EQ ID L++ +   G  GA            
Sbjct: 1   MSVRFAVALRHGKLYRQGILAFYYVFQAIEQEIDALLSIDTATGATGATDVSDQKLLASK 60

Query: 80  ILGEFYVPEFRRADKIKRDLVFLGEWDTVESGQWTP-------PPQLAGFLQYLRSEMDR 132
           I+ +F++PEFRR +++ +DL+ L   +   S +          PPQL GF+  + + + +
Sbjct: 61  IVKQFWMPEFRRTEQLYKDLLLLYSPEYPTSTELDAMLVDHQLPPQLQGFVDMVHATVRQ 120

Query: 133 DPITVLAPCHVLYLALFAGGRVFKSSLFKNLGFLPNFRDKNGPGEEMSDHTLVSNATNFF 192
           +P+TVLA CHV+YLALFAGG+V +S+L++N G  P F       E +S   L    TNFF
Sbjct: 121 NPVTVLAYCHVMYLALFAGGKVMRSTLYRNTGLFPKF-------EHLSSKELARKGTNFF 173

Query: 193 QFAET-IEDENKLRWTYKRNYELATRDTLTEDQKLAVIAASRDVFRHTFAVIEEICQQNH 251
            F++  ++ EN+L+W YK+NYELATR+ L E+ KL +I  ++ +F     +I+EI Q N 
Sbjct: 174 TFSDAGVDVENQLKWQYKKNYELATREALAENDKLEIIDVAKRIFERNMDIIQEIGQLNK 233

Query: 252 DELMSFRSFKIVTYFLEEWKF-NKN 275
           + L +     ++ Y  EE KF NK+
Sbjct: 234 EALTN-NKLDLLQYVFEELKFYNKD 257

>Smik_15.18 Chr15 complement(35621..36814) [1194 bp, 397 aa] {ON}
           YOL136C (REAL)
          Length = 397

 Score = 29.6 bits (65), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 32/71 (45%), Gaps = 3/71 (4%)

Query: 221 TEDQKLAVIAASRDVFRHTFAVIEEICQQNHDELMSFRSFKIVTYFLEEWKFNKNFKRGV 280
            +D  + +  A+         + EEIC  N DEL    +F +V   L+   FNK+F +  
Sbjct: 188 NDDCDVGIFDATNSTIERRKFIFEEICSFNTDEL---STFNLVPIILQVSCFNKDFIKYN 244

Query: 281 LWGVAFLAQFL 291
           +   +F   +L
Sbjct: 245 IHNKSFNEDYL 255

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.140    0.430 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,531,749
Number of extensions: 1412431
Number of successful extensions: 4548
Number of sequences better than 10.0: 23
Number of HSP's gapped: 4586
Number of HSP's successfully gapped: 23
Length of query: 302
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 193
Effective length of database: 40,982,805
Effective search space: 7909681365
Effective search space used: 7909681365
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 65 (29.6 bits)