Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0B026307.346ON43843822080.0
Smik_12.2617.346ON43642715730.0
Suva_10.2977.346ON43641115730.0
Skud_12.2667.346ON43641115680.0
CAGL0A03927g7.346ON43744315620.0
YLR203C (MSS51)7.346ON43641215600.0
NCAS0E028807.346ON42941015440.0
TDEL0C020207.346ON42541015400.0
SAKL0F11286g7.346ON42341215310.0
Kpol_530.357.346ON42542015290.0
TPHA0F029307.346ON43641815200.0
Ecym_47277.346ON42943015140.0
KLLA0D12430g7.346ON41842614900.0
ZYRO0F11616g7.346ON41541414890.0
KLTH0H01342g7.346ON42241214750.0
Kwal_56.246317.346ON42243014720.0
NDAI0E044807.346ON44341114650.0
TBLA0E005007.346ON43741014240.0
ACL152W7.346ON42841314210.0
NCAS0A141207.346ON42741113920.0
KNAG0C037507.346ON42443713600.0
KAFR0B008407.346ON42641213520.0
NDAI0A019307.346ON45042513390.0
SAKL0G10714g5.286ON29958790.32
NDAI0D015001.521ON32160770.57
KLLA0C07557g8.715ON39530760.68
NCAS0G034701.521ON32160751.1
KNAG0B048805.286ON29558731.6
TDEL0E034105.286ON29569721.8
NCAS0D045106.329ON57654722.8
NCAS0A065605.286ON29658713.1
Skud_3.1161.136ON92755688.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0B02630
         (438 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0B02630 Chr2 complement(508645..509961) [1317 bp, 438 aa] {O...   855   0.0  
Smik_12.261 Chr12 complement(497673..498983) [1311 bp, 436 aa] {...   610   0.0  
Suva_10.297 Chr10 complement(523465..524775) [1311 bp, 436 aa] {...   610   0.0  
Skud_12.266 Chr12 complement(497291..498601) [1311 bp, 436 aa] {...   608   0.0  
CAGL0A03927g Chr1 (397179..398492) [1314 bp, 437 aa] {ON} highly...   606   0.0  
YLR203C Chr12 complement(550650..551960) [1311 bp, 436 aa] {ON} ...   605   0.0  
NCAS0E02880 Chr5 complement(563006..564295) [1290 bp, 429 aa] {O...   599   0.0  
TDEL0C02020 Chr3 complement(349453..350730) [1278 bp, 425 aa] {O...   597   0.0  
SAKL0F11286g Chr6 (880536..881807) [1272 bp, 423 aa] {ON} simila...   594   0.0  
Kpol_530.35 s530 complement(83032..84309) [1278 bp, 425 aa] {ON}...   593   0.0  
TPHA0F02930 Chr6 (647081..648391) [1311 bp, 436 aa] {ON} Anc_7.3...   590   0.0  
Ecym_4727 Chr4 complement(1420885..1422174) [1290 bp, 429 aa] {O...   587   0.0  
KLLA0D12430g Chr4 complement(1055878..1057134) [1257 bp, 418 aa]...   578   0.0  
ZYRO0F11616g Chr6 (953577..954824) [1248 bp, 415 aa] {ON} simila...   578   0.0  
KLTH0H01342g Chr8 complement(125673..126941) [1269 bp, 422 aa] {...   572   0.0  
Kwal_56.24631 s56 (1080985..1082253) [1269 bp, 422 aa] {ON} YLR2...   571   0.0  
NDAI0E04480 Chr5 complement(1007346..1008677) [1332 bp, 443 aa] ...   568   0.0  
TBLA0E00500 Chr5 (91769..93082) [1314 bp, 437 aa] {ON} Anc_7.346...   553   0.0  
ACL152W Chr3 (85701..86987) [1287 bp, 428 aa] {ON} Syntenic homo...   551   0.0  
NCAS0A14120 Chr1 (2777017..2778300) [1284 bp, 427 aa] {ON} Anc_7...   540   0.0  
KNAG0C03750 Chr3 (740426..741700) [1275 bp, 424 aa] {ON} Anc_7.3...   528   0.0  
KAFR0B00840 Chr2 (159480..160760) [1281 bp, 426 aa] {ON} Anc_7.3...   525   0.0  
NDAI0A01930 Chr1 complement(430531..431883) [1353 bp, 450 aa] {O...   520   0.0  
SAKL0G10714g Chr7 complement(908030..908929) [900 bp, 299 aa] {O...    35   0.32 
NDAI0D01500 Chr4 complement(361232..362197) [966 bp, 321 aa] {ON...    34   0.57 
KLLA0C07557g Chr3 complement(661000..662187) [1188 bp, 395 aa] {...    34   0.68 
NCAS0G03470 Chr7 complement(646978..647943) [966 bp, 321 aa] {ON...    33   1.1  
KNAG0B04880 Chr2 complement(936276..937163) [888 bp, 295 aa] {ON}      33   1.6  
TDEL0E03410 Chr5 complement(641975..642862) [888 bp, 295 aa] {ON...    32   1.8  
NCAS0D04510 Chr4 (856025..857755) [1731 bp, 576 aa] {ON} Anc_6.3...    32   2.8  
NCAS0A06560 Chr1 complement(1298997..1299887) [891 bp, 296 aa] {...    32   3.1  
Skud_3.116 Chr3 complement(178920..181703) [2784 bp, 927 aa] {ON...    31   8.7  

>KNAG0B02630 Chr2 complement(508645..509961) [1317 bp, 438 aa] {ON}
           Anc_7.346 YLR203C
          Length = 438

 Score =  855 bits (2208), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/438 (94%), Positives = 413/438 (94%)

Query: 1   MLCTWTLRPGVRSAHRALRASGLPCIARRQLMGFVRNALGLEXXXXXXXXXXENRFHPWD 60
           MLCTWTLRPGVRSAHRALRASGLPCIARRQLMGFVRNALGLE          ENRFHPWD
Sbjct: 1   MLCTWTLRPGVRSAHRALRASGLPCIARRQLMGFVRNALGLEPPPSPMDPTPENRFHPWD 60

Query: 61  QSPVDALRERAARIKTLAKCPVTGLNVEYTCPLSGIPTHHSREAWEQDTQYHATKRYETL 120
           QSPVDALRERAARIKTLAKCPVTGLNVEYTCPLSGIPTHHSREAWEQDTQYHATKRYETL
Sbjct: 61  QSPVDALRERAARIKTLAKCPVTGLNVEYTCPLSGIPTHHSREAWEQDTQYHATKRYETL 120

Query: 121 KKVNIYEHDLRSGRPFPEFDFPQEQGYDKVVNMTNWDLFFYTRGFYSMDTEFQLAAVTKM 180
           KKVNIYEHDLRSGRPFPEFDFPQEQGYDKVVNMTNWDLFFYTRGFYSMDTEFQLAAVTKM
Sbjct: 121 KKVNIYEHDLRSGRPFPEFDFPQEQGYDKVVNMTNWDLFFYTRGFYSMDTEFQLAAVTKM 180

Query: 181 LSYPVTIASLLAQFSPYSLNPKGPITLEGLKSLAAVRYTLYSQSFNNSARAGGVTTGGAL 240
           LSYPVTIASLLAQFSPYSLNPKGPITLEGLKSLAAVRYTLYSQSFNNSARAGGVTTGGAL
Sbjct: 181 LSYPVTIASLLAQFSPYSLNPKGPITLEGLKSLAAVRYTLYSQSFNNSARAGGVTTGGAL 240

Query: 241 KNRPMRLFVLGARAEAQLPGHVWKQLSYLFPEQSFEMVFIGPESYYDRARGQYVRSPTPV 300
           KNRPMRLFVLGARAEAQLPGHVWKQLSYLFPEQSFEMVFIGPESYYDRARGQYVRSPTPV
Sbjct: 241 KNRPMRLFVLGARAEAQLPGHVWKQLSYLFPEQSFEMVFIGPESYYDRARGQYVRSPTPV 300

Query: 301 VEKVDETLKFIHYTDYFHVLHESQXXXXXXXXXXXXXXXHPGFASPENRDTWLSNTLPAL 360
           VEKVDETLKFIHYTDYFHVLHESQ               HPGFASPENRDTWLSNTLPAL
Sbjct: 301 VEKVDETLKFIHYTDYFHVLHESQDFFPYDPYFDCFFTFHPGFASPENRDTWLSNTLPAL 360

Query: 361 LDTKCAIFTTGFDRDDLMNDVALLNEKFGSEMDILMEPTKNVFGSTKWELNDLNPHEVYQ 420
           LDTKCAIFTTGFDRDDLMNDVALLNEKFGSEMDILMEPTKNVFGSTKWELNDLNPHEVYQ
Sbjct: 361 LDTKCAIFTTGFDRDDLMNDVALLNEKFGSEMDILMEPTKNVFGSTKWELNDLNPHEVYQ 420

Query: 421 FNMYIAGFRGKRYHTIKR 438
           FNMYIAGFRGKRYHTIKR
Sbjct: 421 FNMYIAGFRGKRYHTIKR 438

>Smik_12.261 Chr12 complement(497673..498983) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  610 bits (1573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/427 (69%), Positives = 334/427 (78%), Gaps = 11/427 (2%)

Query: 12  RSAHRALRASGLPCIARRQLMGFVRNALGLEXXXXXXXXXXENRFHPWDQSPVDALRERA 71
           RS+H  L  S      RR LMGFVRNALGL+          ENRFHPWDQSP   LRERA
Sbjct: 20  RSSHNRLVLSHQ---TRRHLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSVDLRERA 76

Query: 72  ARIKTLAKCPVTGLNVEYTCPLSGIPTHHSREAWEQDTQYHATKRYETLKKVNIYEHDLR 131
           A+I+TLA CPVTG ++ YTCPLSGIPTHHSREAWE D  YH +K+YE LKKVNIYEHDLR
Sbjct: 77  AKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLR 136

Query: 132 SGRPFPEFDFPQEQGYDKVVNMTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIASLL 191
           SGRPFPEFDFPQ QGYDK VN+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYP+TI SLL
Sbjct: 137 SGRPFPEFDFPQNQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLL 196

Query: 192 AQFSPYSLNPKGPITLEGLKSLAAVRYTLYSQSFNNSARAGGVTTGGALKNRPMRLFVLG 251
            +FSPYSLNPKGPITLEGLKSLAA+RYTLY    N S          A KNR MR+F+LG
Sbjct: 197 HKFSPYSLNPKGPITLEGLKSLAALRYTLYPLE-NRSLLT-------ATKNRAMRIFILG 248

Query: 252 ARAEAQLPGHVWKQLSYLFPEQSFEMVFIGPESYYDRARGQYVRSPTPVVEKVDETLKFI 311
           ARAEAQLPGHVWKQL +LFPEQ+FE+ FIGPE  Y R + +YV+S TPVV++VDETLKFI
Sbjct: 249 ARAEAQLPGHVWKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFI 308

Query: 312 HYTDYFHVLHESQXXXXXXXXXXXXXXXHPGFASPENRDTWLSNTLPALLDTKCAIFTTG 371
           H TD+F V HE+Q               HPG+ASPE+  +W+  T+ ALL+TKCAIFTTG
Sbjct: 309 HRTDFFEVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTG 368

Query: 372 FDRDDLMNDVALLNEKFGSEMDILMEPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGK 431
           F++ DL +D+ L+  K+G EMDILM+P KNVFGSTKWELND+NP EVYQFNMYIAGFRGK
Sbjct: 369 FNKKDLTDDLNLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGK 428

Query: 432 RYHTIKR 438
           RYHTIKR
Sbjct: 429 RYHTIKR 435

>Suva_10.297 Chr10 complement(523465..524775) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  610 bits (1573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/411 (70%), Positives = 329/411 (80%), Gaps = 8/411 (1%)

Query: 28  RRQLMGFVRNALGLEXXXXXXXXXXENRFHPWDQSPVDALRERAARIKTLAKCPVTGLNV 87
           RR LMGFVRNALGL+          ENRFHPWDQSP   LRERAA+I+TLA CPVTG ++
Sbjct: 33  RRHLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDI 92

Query: 88  EYTCPLSGIPTHHSREAWEQDTQYHATKRYETLKKVNIYEHDLRSGRPFPEFDFPQEQGY 147
            YTCPLSGIPTHHSREAWE D  YH +K+YE LKKVNIYEHDLRSGRPFPEFDFPQ+QGY
Sbjct: 93  NYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGY 152

Query: 148 DKVVNMTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIASLLAQFSPYSLNPKGPITL 207
           DK VN+TNWDLF YTR FYSMDTEFQLAAVTKMLSYP+TI SLL +FSPYSLNPKGPITL
Sbjct: 153 DKAVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITL 212

Query: 208 EGLKSLAAVRYTLYSQSFNNSARAGGVTTGGALKNRPMRLFVLGARAEAQLPGHVWKQLS 267
           EGLKSLAA+RYTLY    N S  A         +NR MR+F+LGARAEAQLPGHVWKQL 
Sbjct: 213 EGLKSLAALRYTLYPLE-NRSVLA-------TTRNRAMRIFILGARAEAQLPGHVWKQLQ 264

Query: 268 YLFPEQSFEMVFIGPESYYDRARGQYVRSPTPVVEKVDETLKFIHYTDYFHVLHESQXXX 327
           +LFPEQ+FE+ FIGPE  Y R + +YV+S TPVV+++DETLKF H+TD+F V HE+Q   
Sbjct: 265 FLFPEQNFEIHFIGPECLYKRDKQEYVKSATPVVQRIDETLKFFHHTDFFQVFHEAQDFF 324

Query: 328 XXXXXXXXXXXXHPGFASPENRDTWLSNTLPALLDTKCAIFTTGFDRDDLMNDVALLNEK 387
                       HPG+ASPE+  +W+  T+ ALL+TKCAIFTTGF++ DLM+D+ L+  K
Sbjct: 325 PYDPYMDVFFTFHPGYASPESHGSWMGETMTALLETKCAIFTTGFNKKDLMDDINLVKSK 384

Query: 388 FGSEMDILMEPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHTIKR 438
           +G EMDILM+P KNVFGSTKWELND+NP EVYQFNMYIAGFRGKRYHTIKR
Sbjct: 385 YGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIKR 435

>Skud_12.266 Chr12 complement(497291..498601) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  608 bits (1568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/411 (69%), Positives = 330/411 (80%), Gaps = 8/411 (1%)

Query: 28  RRQLMGFVRNALGLEXXXXXXXXXXENRFHPWDQSPVDALRERAARIKTLAKCPVTGLNV 87
           RR LMGFVRNALGL+          ENRFHPWDQSP   LRERAA+I+TLA CPVTG ++
Sbjct: 33  RRHLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDI 92

Query: 88  EYTCPLSGIPTHHSREAWEQDTQYHATKRYETLKKVNIYEHDLRSGRPFPEFDFPQEQGY 147
            YTCPLSGIPTHHSREAWE D  YH +K+YE LKKVNIYEHDLRSGRPFPEFDFPQ+QGY
Sbjct: 93  NYTCPLSGIPTHHSREAWEMDKTYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGY 152

Query: 148 DKVVNMTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIASLLAQFSPYSLNPKGPITL 207
           DK VN+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYP+TI S+L +FSPYSLNPKGPITL
Sbjct: 153 DKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHKFSPYSLNPKGPITL 212

Query: 208 EGLKSLAAVRYTLYSQSFNNSARAGGVTTGGALKNRPMRLFVLGARAEAQLPGHVWKQLS 267
           EGLKSLAA+RYTLY    N S  A         KNR MR+F+LGARAEAQLPGHVWKQL 
Sbjct: 213 EGLKSLAALRYTLYPLE-NRSVLA-------TTKNRAMRIFILGARAEAQLPGHVWKQLQ 264

Query: 268 YLFPEQSFEMVFIGPESYYDRARGQYVRSPTPVVEKVDETLKFIHYTDYFHVLHESQXXX 327
           +LFPEQ+FE+ F+GPE  Y R + +YV+S TPVV++VDETL+FIH+TD+F V HE+Q   
Sbjct: 265 FLFPEQNFEIHFVGPECLYKRDKQEYVKSATPVVQRVDETLRFIHHTDFFDVFHEAQDFF 324

Query: 328 XXXXXXXXXXXXHPGFASPENRDTWLSNTLPALLDTKCAIFTTGFDRDDLMNDVALLNEK 387
                       HPG+ASPE+  +W+  T+ ALL+TKCAIFTTGF++ DLM+D+  +  K
Sbjct: 325 PYDPYMDVFFTFHPGYASPESHGSWMGETMRALLETKCAIFTTGFNKKDLMDDINAVKSK 384

Query: 388 FGSEMDILMEPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHTIKR 438
           +G EMDILM+P +NVFGSTKWELND+NP EVYQFNMYIAGFRGKRYHTIKR
Sbjct: 385 YGKEMDILMDPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIKR 435

>CAGL0A03927g Chr1 (397179..398492) [1314 bp, 437 aa] {ON} highly
           similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203c MSS51
          Length = 437

 Score =  606 bits (1562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/443 (65%), Positives = 344/443 (77%), Gaps = 24/443 (5%)

Query: 11  VRSAHRALRASG--LPCIARRQLMGFVRNALGLEXXXXXXXXXXENRFHPWDQSPVDALR 68
           +R+  RA++ +G    C+++RQLMGFVRNALGL+          +NRFHPWDQSP   LR
Sbjct: 2   IRTRTRAVQNTGKFYACVSKRQLMGFVRNALGLDPPPSPDEPTEQNRFHPWDQSPAVDLR 61

Query: 69  ERAARIKTLAKCPVTGLNVEYTCPLSGIPTHHSREAWEQDTQYHATKRYETLKKVNIYEH 128
           ERAARIKTLAKCPVT   ++YTCP+SGIPTHHSREAWEQD +YHA+K+YE LKKVNIYEH
Sbjct: 62  ERAARIKTLAKCPVTHKPIQYTCPISGIPTHHSREAWEQDKEYHASKKYEILKKVNIYEH 121

Query: 129 DLRSGRPFPEFDFPQEQGYDKVVNMTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIA 188
           DLRSGRPFPEFDFP++QG D+ VN+TNWDLF YTR FYSMDTEFQLAAVTKMLSYP+TI 
Sbjct: 122 DLRSGRPFPEFDFPRDQGPDRTVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIG 181

Query: 189 SLLAQFSPYSLNPKGPITLEGLKSLAAVRYTLYSQSFNNSARAGGVTTGGALKNRPMRLF 248
           S+L QFSPYSLNPKGPITLEGLKSLAA+RYTLY     N A    VTT    KN+PMR+F
Sbjct: 182 SVLHQFSPYSLNPKGPITLEGLKSLAALRYTLY--PLQNRA----VTTTA--KNKPMRIF 233

Query: 249 VLGARAEAQLPGHVWKQLSYLFPEQSFEMVFIGPESYYDRARGQYVRSPT---------- 298
           +LGARAEAQLPGHVWKQL +LFP+Q+FE+ FIGPES YDR R +Y+RS T          
Sbjct: 234 ILGARAEAQLPGHVWKQLQFLFPQQNFEIHFIGPESLYDRERNEYIRSATANGETAADGT 293

Query: 299 ----PVVEKVDETLKFIHYTDYFHVLHESQXXXXXXXXXXXXXXXHPGFASPENRDTWLS 354
               PV +++DET+KF ++TDYFH LH +Q               HPG ASPE++DTW+ 
Sbjct: 294 TSSIPVTKRIDETMKFFYHTDYFHTLHTAQDFFPYDPYQDVFFMFHPGLASPESKDTWMK 353

Query: 355 NTLPALLDTKCAIFTTGFDRDDLMNDVALLNEKFGSEMDILMEPTKNVFGSTKWELNDLN 414
           +T+  LLDTKCAIFTTGF++ D+ +D+ +L + +G EMD+LM P KNVFGSTKWEL+D +
Sbjct: 354 DTVKGLLDTKCAIFTTGFNKKDMADDIQILQDTYGKEMDMLMNPVKNVFGSTKWELDDSD 413

Query: 415 PHEVYQFNMYIAGFRGKRYHTIK 437
           PH VYQFNMYIAGFRGKRYH IK
Sbjct: 414 PHSVYQFNMYIAGFRGKRYHPIK 436

>YLR203C Chr12 complement(550650..551960) [1311 bp, 436 aa] {ON}
           MSS51Specific translational activator for the
           mitochondrial COX1 mRNA; loosely associated with the
           matrix face of the mitochondrial inner membrane;
           influences both COX1 mRNA translation and Cox1p assembly
           into cytochrome c oxidase
          Length = 436

 Score =  605 bits (1560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/412 (70%), Positives = 330/412 (80%), Gaps = 8/412 (1%)

Query: 27  ARRQLMGFVRNALGLEXXXXXXXXXXENRFHPWDQSPVDALRERAARIKTLAKCPVTGLN 86
            RR LMGFVRNALGL+          ENRFHPWDQSP   LRERAA+I+TLA CPVTG +
Sbjct: 32  TRRHLMGFVRNALGLDPPPSPEDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKD 91

Query: 87  VEYTCPLSGIPTHHSREAWEQDTQYHATKRYETLKKVNIYEHDLRSGRPFPEFDFPQEQG 146
           + YTCPLSGIPTHHSREAWE D  YH +K+YE LKKVNIYEHDLRSGRPFPEFDFPQ+QG
Sbjct: 92  INYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQG 151

Query: 147 YDKVVNMTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIASLLAQFSPYSLNPKGPIT 206
           YDK VN+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYP+TI SLL +FSPYSLNPKGPIT
Sbjct: 152 YDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPIT 211

Query: 207 LEGLKSLAAVRYTLYSQSFNNSARAGGVTTGGALKNRPMRLFVLGARAEAQLPGHVWKQL 266
           LEGLKSLAA+RYTLY        R+   TT    KNR MR+F+LGARAEAQLPGHVWKQL
Sbjct: 212 LEGLKSLAALRYTLYPL----ENRSLPTTT----KNRAMRIFILGARAEAQLPGHVWKQL 263

Query: 267 SYLFPEQSFEMVFIGPESYYDRARGQYVRSPTPVVEKVDETLKFIHYTDYFHVLHESQXX 326
            +LFPEQSFE+ FIGPE  Y R + +YV+S TPVV++VDETLKFI+ T++F V HE+Q  
Sbjct: 264 QFLFPEQSFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIYRTNFFEVFHEAQDF 323

Query: 327 XXXXXXXXXXXXXHPGFASPENRDTWLSNTLPALLDTKCAIFTTGFDRDDLMNDVALLNE 386
                        HPG+ASPE+  +W+  T+ ALL+TKCAIFTTGF++ DL +D+ L+  
Sbjct: 324 FPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDINLVKS 383

Query: 387 KFGSEMDILMEPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHTIKR 438
           K+G EMD+LMEP +NVFGSTKWELND+NP EVYQFNMYIAGFRGKRYHTIKR
Sbjct: 384 KYGKEMDVLMEPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIKR 435

>NCAS0E02880 Chr5 complement(563006..564295) [1290 bp, 429 aa] {ON}
           Anc_7.346 YLR203C
          Length = 429

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/410 (69%), Positives = 330/410 (80%), Gaps = 8/410 (1%)

Query: 29  RQLMGFVRNALGLEXXXXXXXXXXENRFHPWDQSPVDALRERAARIKTLAKCPVTGLNVE 88
           R LMGFVRNALGL+          ENRFHPWDQSP   LRERAARI+TLA+CPVTG  + 
Sbjct: 28  RHLMGFVRNALGLDPPTSPDDPTPENRFHPWDQSPSPDLRERAARIRTLARCPVTGKEIN 87

Query: 89  YTCPLSGIPTHHSREAWEQDTQYHATKRYETLKKVNIYEHDLRSGRPFPEFDFPQEQGYD 148
           YTCP+SGIPTHHSREAWEQD +YHA+KRYE LKKVNIYEHDLRSGRPFPEFDFP++QG D
Sbjct: 88  YTCPISGIPTHHSREAWEQDKEYHASKRYELLKKVNIYEHDLRSGRPFPEFDFPRDQGQD 147

Query: 149 KVVNMTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIASLLAQFSPYSLNPKGPITLE 208
           ++VNMTNWDLF YTR FYSMDTEFQ+AAVTKMLSYP+TI S+L QFSPYSL PKGPI+LE
Sbjct: 148 RMVNMTNWDLFLYTRAFYSMDTEFQMAAVTKMLSYPITIGSVLHQFSPYSLQPKGPISLE 207

Query: 209 GLKSLAAVRYTLYSQSFNNSARAGGVTTGGALKNRPMRLFVLGARAEAQLPGHVWKQLSY 268
           GLKSLAA+RYTLY        R    TT    K RPMR+F+LGARAE+QLPGHVWKQL Y
Sbjct: 208 GLKSLAALRYTLYPM----QNRLVISTT----KARPMRIFILGARAESQLPGHVWKQLQY 259

Query: 269 LFPEQSFEMVFIGPESYYDRARGQYVRSPTPVVEKVDETLKFIHYTDYFHVLHESQXXXX 328
           LFPEQ+FE+ FIGPESYYD+ + +Y++  TP+ E VDETLK I++T+YFH LHE+Q    
Sbjct: 260 LFPEQTFEIHFIGPESYYDKDKKKYIQLTTPITESVDETLKLIYHTEYFHKLHEAQDFFP 319

Query: 329 XXXXXXXXXXXHPGFASPENRDTWLSNTLPALLDTKCAIFTTGFDRDDLMNDVALLNEKF 388
                      HPGFAS E  + W+ +T+  LLDTKCAIFTTGF ++DL+ D+A++ +K+
Sbjct: 320 YDPYMDVFFIFHPGFASAEIGEHWMKDTMKGLLDTKCAIFTTGFTKNDLLEDIAVVQDKY 379

Query: 389 GSEMDILMEPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHTIKR 438
           G E+DILM+PTKNVFGSTKWELND+NP EVYQFNMYIAGFRGKRY TIKR
Sbjct: 380 GKELDILMKPTKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYPTIKR 429

>TDEL0C02020 Chr3 complement(349453..350730) [1278 bp, 425 aa] {ON}
           Anc_7.346 YLR203C
          Length = 425

 Score =  597 bits (1540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/410 (68%), Positives = 328/410 (80%), Gaps = 9/410 (2%)

Query: 28  RRQLMGFVRNALGLEXXXXXXXXXXENRFHPWDQSPVDALRERAARIKTLAKCPVTGLNV 87
           RR ++GFVRNALGL+          ENRFHPWDQSPV  LRERAARI+TLA+CPVTG  +
Sbjct: 24  RRFIIGFVRNALGLDPPPSPDDPTPENRFHPWDQSPVGDLRERAARIRTLARCPVTGKEI 83

Query: 88  EYTCPLSGIPTHHSREAWEQDTQYHATKRYETLKKVNIYEHDLRSGRPFPEFDFPQEQGY 147
            YTCPLSGIPTHHSREAWEQD QYH +K+YE LKKVNIYEHDLRSGRPFPEFDFPQ Q +
Sbjct: 84  NYTCPLSGIPTHHSREAWEQDKQYHQSKKYEILKKVNIYEHDLRSGRPFPEFDFPQGQDF 143

Query: 148 DKVVNMTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIASLLAQFSPYSLNPKGPITL 207
           D+ VNMTNWDLFFYTR FYSMDTEFQLAAVTKMLSYP++IAS+L QFSPYSLNPKGP+TL
Sbjct: 144 DRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPISIASVLHQFSPYSLNPKGPVTL 203

Query: 208 EGLKSLAAVRYTLYSQSFNNSARAGGVTTGGALKNRPMRLFVLGARAEAQLPGHVWKQLS 267
           EGLKSLAA+RYTLY     N        T  + K+RPMR+F+LGARAEAQLPGHVWKQL 
Sbjct: 204 EGLKSLAALRYTLY--PLENK-------TISSTKDRPMRIFILGARAEAQLPGHVWKQLQ 254

Query: 268 YLFPEQSFEMVFIGPESYYDRARGQYVRSPTPVVEKVDETLKFIHYTDYFHVLHESQXXX 327
           YLFPEQ FE+ F+GPE   ++ + QYV S TPVV++VDET+ F+++TD+FHVLHE+Q   
Sbjct: 255 YLFPEQMFELHFVGPECLLNKEKHQYVTSSTPVVKRVDETISFVYHTDFFHVLHEAQDFF 314

Query: 328 XXXXXXXXXXXXHPGFASPENRDTWLSNTLPALLDTKCAIFTTGFDRDDLMNDVALLNEK 387
                       HPGF +PE   +WL+ T+  LL+TKCAIFTTGF++ DL+ DV  + +K
Sbjct: 315 PYDPYLDVFFCFHPGFGAPETSASWLNETMKGLLETKCAIFTTGFNKADLLRDVDAVKDK 374

Query: 388 FGSEMDILMEPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHTIK 437
           +G E+D+LMEP KNVFGSTKWELND+NP EVYQFNMYIAGFRGKRYH I+
Sbjct: 375 YGKEVDVLMEPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIE 424

>SAKL0F11286g Chr6 (880536..881807) [1272 bp, 423 aa] {ON} similar
           to uniprot|P32335 Saccharomyces cerevisiae YLR203C MSS51
           Protein required for the maturation and translation of
           COX1 mRNA involved in maturation of COX1 and COB mRNA
          Length = 423

 Score =  594 bits (1531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/412 (66%), Positives = 325/412 (78%), Gaps = 8/412 (1%)

Query: 26  IARRQLMGFVRNALGLEXXXXXXXXXXENRFHPWDQSPVDALRERAARIKTLAKCPVTGL 85
           I +R ++GFVRNALGL+          +NRFHPWDQSP   LR RAA I+ LA+CPVTG 
Sbjct: 19  IQKRHIIGFVRNALGLDPPPSPDDPTPDNRFHPWDQSPSPDLRTRAATIRALARCPVTGK 78

Query: 86  NVEYTCPLSGIPTHHSREAWEQDTQYHATKRYETLKKVNIYEHDLRSGRPFPEFDFPQEQ 145
            + YTCP SGIPTHHSREAWEQDT YHATK+YE LKKVNIYEHDLRSGRPFPEFDFPQ+Q
Sbjct: 79  EINYTCPQSGIPTHHSREAWEQDTMYHATKKYEILKKVNIYEHDLRSGRPFPEFDFPQDQ 138

Query: 146 GYDKVVNMTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIASLLAQFSPYSLNPKGPI 205
            YD++VNMTNWDLFFYTR FYSMDTEFQLAAVTKMLSYP T+ S+L +FSPY+LNPKGPI
Sbjct: 139 DYDRMVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPTTVGSVLHEFSPYALNPKGPI 198

Query: 206 TLEGLKSLAAVRYTLYSQSFNNSARAGGVTTGGALKNRPMRLFVLGARAEAQLPGHVWKQ 265
           TLEGLKSLAA+RYTLY Q               A K+RPMR+F+LGARAEAQLPGHVWKQ
Sbjct: 199 TLEGLKSLAALRYTLYPQQHRK--------VSAATKDRPMRIFILGARAEAQLPGHVWKQ 250

Query: 266 LSYLFPEQSFEMVFIGPESYYDRARGQYVRSPTPVVEKVDETLKFIHYTDYFHVLHESQX 325
             +LFPE +FE+ FIGPES+YDR + +Y+ S TP+V +VDETL F+++TDYFHV HE+Q 
Sbjct: 251 FQFLFPEINFELHFIGPESFYDREKREYITSSTPIVRRVDETLSFVYHTDYFHVFHEAQD 310

Query: 326 XXXXXXXXXXXXXXHPGFASPENRDTWLSNTLPALLDTKCAIFTTGFDRDDLMNDVALLN 385
                         HPGFA+PE+ + W+  T+  LL+TKCAIFTTGF+  DL+ D+  + 
Sbjct: 311 FFPYDPYLDIFFCFHPGFAAPESTEHWMGKTMEGLLETKCAIFTTGFNEQDLVRDMTAVR 370

Query: 386 EKFGSEMDILMEPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHTIK 437
           EK+G+EMD+LMEP +N+FGSTKWELND+NP EVYQFNMYIAGFRGKRYH I+
Sbjct: 371 EKYGNEMDMLMEPVRNLFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIE 422

>Kpol_530.35 s530 complement(83032..84309) [1278 bp, 425 aa] {ON}
           complement(83032..84309) [1278 nt, 426 aa]
          Length = 425

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/420 (65%), Positives = 327/420 (77%), Gaps = 6/420 (1%)

Query: 18  LRASGLPCIARRQLMGFVRNALGLEXXXXXXXXXXENRFHPWDQSPVDALRERAARIKTL 77
           L A     I +R LMGFVRNALGL+          ENRFHPWDQSP   LRERAA+I+TL
Sbjct: 11  LGAGSYSLIQKRSLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPCVDLRERAAKIRTL 70

Query: 78  AKCPVTGLNVEYTCPLSGIPTHHSREAWEQDTQYHATKRYETLKKVNIYEHDLRSGRPFP 137
           AKCPVT  ++ YTCPLSGIPTHH +EAW  D  YH +KRYE LKKVNIYEHDLRSGRPFP
Sbjct: 71  AKCPVTHKDINYTCPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYEHDLRSGRPFP 130

Query: 138 EFDFPQEQGYDKVVNMTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIASLLAQFSPY 197
           EFDFPQ+Q YD+++N+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYP+TI SLL QFSPY
Sbjct: 131 EFDFPQDQDYDRLINLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHQFSPY 190

Query: 198 SLNPKGPITLEGLKSLAAVRYTLYSQSFNNSARAGGVTTGGALKNRPMRLFVLGARAEAQ 257
           SLNPKGP+TLEGLKSLAA+RYTLY   + N ++   V T    ++RPMR+F+LGARAEAQ
Sbjct: 191 SLNPKGPVTLEGLKSLAALRYTLY--PYQNKSQNVKVNT----RDRPMRIFILGARAEAQ 244

Query: 258 LPGHVWKQLSYLFPEQSFEMVFIGPESYYDRARGQYVRSPTPVVEKVDETLKFIHYTDYF 317
           LPGHVWKQ  YLFPEQ FE+ FIGPE Y ++ + QY+ S TP+V+KVD+TLK + + DYF
Sbjct: 245 LPGHVWKQFQYLFPEQEFEIHFIGPECYLNKEKNQYITSSTPIVKKVDDTLKLVFHPDYF 304

Query: 318 HVLHESQXXXXXXXXXXXXXXXHPGFASPENRDTWLSNTLPALLDTKCAIFTTGFDRDDL 377
           HV HE+Q               HPG+A PE  + WL  T+ ALLDTKCAIFTTGF + DL
Sbjct: 305 HVFHEAQDFFPYDPFLDVFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFSKQDL 364

Query: 378 MNDVALLNEKFGSEMDILMEPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHTIK 437
           + D+ ++  ++G+E+D+LM+P KNVFGSTKWELND+NP EVYQFNMYIAGFRGKRYH I+
Sbjct: 365 LRDIDVVKNRYGNELDMLMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIE 424

>TPHA0F02930 Chr6 (647081..648391) [1311 bp, 436 aa] {ON} Anc_7.346
           YLR203C
          Length = 436

 Score =  590 bits (1520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/418 (65%), Positives = 327/418 (78%), Gaps = 7/418 (1%)

Query: 21  SGLPCIARRQLMGFVRNALGLEXXXXXXXXXXENRFHPWDQSPVDALRERAARIKTLAKC 80
           + LP   +R LMGFV+NALGL+          ENRFHPWDQSP   LRERAARI+TLAKC
Sbjct: 26  TSLPSSQKRSLMGFVKNALGLDPSPSPDDPTPENRFHPWDQSPSPDLRERAARIRTLAKC 85

Query: 81  PVTGLNVEYTCPLSGIPTHHSREAWEQDTQYHATKRYETLKKVNIYEHDLRSGRPFPEFD 140
           PVT   + YTCPLSGIPTHHSREAWE D  YH +KRYE LKKVNIYEHDLRSGRPFPEFD
Sbjct: 86  PVTKKEINYTCPLSGIPTHHSREAWEADKDYHQSKRYEILKKVNIYEHDLRSGRPFPEFD 145

Query: 141 FPQEQGYDKVVNMTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIASLLAQFSPYSLN 200
           FP +Q +D+VVN+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYP+TI S+L QFSPYSLN
Sbjct: 146 FPLDQIHDRVVNLTNWDLFFYTRNFYSMDTEFQLAAVTKMLSYPMTIGSILHQFSPYSLN 205

Query: 201 PKGPITLEGLKSLAAVRYTLYSQSFNNSARAGGVTTGGALKNRPMRLFVLGARAEAQLPG 260
           PKGPITLEGLKSLAA+RY+LY        R   ++    L +RPMR+F+LGARAEAQLPG
Sbjct: 206 PKGPITLEGLKSLAALRYSLYP-----FQRKSNISL--KLHDRPMRIFILGARAEAQLPG 258

Query: 261 HVWKQLSYLFPEQSFEMVFIGPESYYDRARGQYVRSPTPVVEKVDETLKFIHYTDYFHVL 320
           HVWKQL +LFP+Q+FE+ FIG E   +  + +Y++S  PVV+K+DET+K I+++DYFHV 
Sbjct: 259 HVWKQLQFLFPDQTFEIHFIGTECLLNNEKNKYIKSAIPVVKKIDETMKLIYHSDYFHVY 318

Query: 321 HESQXXXXXXXXXXXXXXXHPGFASPENRDTWLSNTLPALLDTKCAIFTTGFDRDDLMND 380
           HE+Q               HPGFA+PE  D W+ +T+ ALL+TKCAIFTTGF++ D+ ND
Sbjct: 319 HEAQDFVPYDPYLDVFFTFHPGFAAPETSDLWMGDTMKALLETKCAIFTTGFNKQDITND 378

Query: 381 VALLNEKFGSEMDILMEPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHTIKR 438
           V ++  ++G EMD LM+P KN +GSTKWELND+NP E++QFNMY+AGFRGKRYHTIKR
Sbjct: 379 VEIVKARYGKEMDTLMDPIKNSYGSTKWELNDMNPQEIFQFNMYVAGFRGKRYHTIKR 436

>Ecym_4727 Chr4 complement(1420885..1422174) [1290 bp, 429 aa] {ON}
           similar to Ashbya gossypii ACL152W
          Length = 429

 Score =  587 bits (1514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/430 (64%), Positives = 337/430 (78%), Gaps = 12/430 (2%)

Query: 8   RPGVRSAHRALRASGLPCIARRQLMGFVRNALGLEXXXXXXXXXXENRFHPWDQSPVDAL 67
           RPG  S+  + R  G     RRQ+MGFVRNALGL+          +NRFHPWDQSP   L
Sbjct: 11  RPGFISSSSS-RVCGKQ--QRRQIMGFVRNALGLDPPTSPDEPTVDNRFHPWDQSPSPEL 67

Query: 68  RERAARIKTLAKCPVTGLNVEYTCPLSGIPTHHSREAWEQDTQYHATKRYETLKKVNIYE 127
           RERAARIK LAKCPVTG N++++C  SGIPTHHS EAW+ D++YH +KRY  LKKVNIYE
Sbjct: 68  RERAARIKALAKCPVTGKNIQFSCKYSGIPTHHSEEAWKNDSEYHESKRYRLLKKVNIYE 127

Query: 128 HDLRSGRPFPEFDFPQEQGYDKVVNMTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTI 187
           HDLRSGRPF EFDFP++Q YD++VNM NWDL+FYTR F+SMDTEFQLAAVTKMLSYP+TI
Sbjct: 128 HDLRSGRPFLEFDFPEQQDYDRMVNMMNWDLYFYTRSFFSMDTEFQLAAVTKMLSYPITI 187

Query: 188 ASLLAQFSPYSLNPKGPITLEGLKSLAAVRYTLYSQSFNNSARAGGVTTGGALKNRPMRL 247
            S+L Q+SPYSLNPKGPITLEGLKSLAA+RYTLY +  N   R        +++++P+R+
Sbjct: 188 GSILHQYSPYSLNPKGPITLEGLKSLAALRYTLYPEQ-NRRVR--------SIQDKPLRV 238

Query: 248 FVLGARAEAQLPGHVWKQLSYLFPEQSFEMVFIGPESYYDRARGQYVRSPTPVVEKVDET 307
           F+LGARAEAQLPGHVWKQL YLFPE   E+ F+GPES YDR + +YV S  PVV+++D+T
Sbjct: 239 FILGARAEAQLPGHVWKQLQYLFPESLIELHFVGPESNYDREKREYVTSSIPVVKRIDDT 298

Query: 308 LKFIHYTDYFHVLHESQXXXXXXXXXXXXXXXHPGFASPENRDTWLSNTLPALLDTKCAI 367
           +K  ++TDYFHV HE+Q               HPGF SPE RDTW+++TL ALL TKCAI
Sbjct: 299 MKMHYHTDYFHVFHEAQDFFPYDPYNDIFFCFHPGFGSPETRDTWMNSTLQALLQTKCAI 358

Query: 368 FTTGFDRDDLMNDVALLNEKFGSEMDILMEPTKNVFGSTKWELNDLNPHEVYQFNMYIAG 427
           FTTGF++ DLM+D+  + EK+G E+D+L++PTKNVFGSTKWELNDLNPHEVYQFNMYIAG
Sbjct: 359 FTTGFNKKDLMDDLQAVKEKYGDELDMLVDPTKNVFGSTKWELNDLNPHEVYQFNMYIAG 418

Query: 428 FRGKRYHTIK 437
           FRGKRYH I+
Sbjct: 419 FRGKRYHAIE 428

>KLLA0D12430g Chr4 complement(1055878..1057134) [1257 bp, 418 aa]
           {ON} similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203C MSS51 Protein required for the maturation and
           translation of COX1 mRNA involved in maturation of COX1
           and COB mRNA
          Length = 418

 Score =  578 bits (1490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/426 (63%), Positives = 333/426 (78%), Gaps = 15/426 (3%)

Query: 18  LRASGLPCIAR-----RQLMGFVRNALGLEXXXXXXXXXXENRFHPWDQSPVDALRERAA 72
           + AS  P + R     R +MGFVRNALGL+          ENRFHPWDQSP   LRERAA
Sbjct: 1   MLASRTPVVYRAKPMTRPIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPSPDLRERAA 60

Query: 73  RIKTLAKCPVTGLNVEYTCPLSGIPTHHSREAWEQDTQYHATKRYETLKKVNIYEHDLRS 132
           RIK +A CPVT  ++++TCPLSGIPTHHSREAWE+DT+YH +KRYE LKKVNIYEHDLRS
Sbjct: 61  RIKAMATCPVTHKDIQFTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRS 120

Query: 133 GRPFPEFDFPQEQGYDKVVNMTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIASLLA 192
           GRPFPEFDFPQ+Q YD++VNM+NWDLFFYTR FYSMDTEFQLAAVTKMLSYP+TI S+L 
Sbjct: 121 GRPFPEFDFPQDQDYDRMVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLH 180

Query: 193 QFSPYSLNPKGPITLEGLKSLAAVRYTLYSQSFNNSARAGGVTTGGALKNRPMRLFVLGA 252
           Q+SPYSLNPKGPITLEGLKSLAA+RYTLY +  +   RAG        ++ P+R+F+LG 
Sbjct: 181 QYSPYSLNPKGPITLEGLKSLAALRYTLYPEQ-SGRFRAG--------QDTPIRIFILGT 231

Query: 253 RAEAQLPGHVWKQLSYLFPEQSFEMVFIGPESYYDRARGQYVRSPTP-VVEKVDETLKFI 311
           RAEAQLPGHVWKQL YL P+ S E+ F+GPES+YDR +  YV+S T  +V+++DE ++  
Sbjct: 232 RAEAQLPGHVWKQLQYLIPDTSIELHFVGPESFYDREKRSYVQSSTETIVKRIDEKMQLF 291

Query: 312 HYTDYFHVLHESQXXXXXXXXXXXXXXXHPGFASPENRDTWLSNTLPALLDTKCAIFTTG 371
           ++TD+FHV HE+Q               HPGFA+PE  + W+ +T+ AL+ TKCA+FTTG
Sbjct: 292 YHTDFFHVFHEAQDFFPYDPYNDVFFCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTG 351

Query: 372 FDRDDLMNDVALLNEKFGSEMDILMEPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGK 431
           F ++DL+ D++++ +K+GSE+D+LMEP  NVFGSTKWELND NPHEVYQFNMYIAGFRGK
Sbjct: 352 FSKEDLLRDISIVQDKYGSELDMLMEPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGK 411

Query: 432 RYHTIK 437
           RYH I+
Sbjct: 412 RYHAIE 417

>ZYRO0F11616g Chr6 (953577..954824) [1248 bp, 415 aa] {ON} similar
           to uniprot|P32335 Saccharomyces cerevisiae YLR203C MSS51
           Protein required for the maturation and translation of
           COX1 mRNA involved in maturation of COX1 and COB mRNA
          Length = 415

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/414 (65%), Positives = 321/414 (77%), Gaps = 9/414 (2%)

Query: 24  PCIARRQLMGFVRNALGLEXXXXXXXXXXENRFHPWDQSPVDALRERAARIKTLAKCPVT 83
           P   RR ++GFVRNALGL+          ENRFH WDQSP   LRERAARI+ LA+CPVT
Sbjct: 10  PITQRRTIIGFVRNALGLDPPPSPDDPTPENRFHLWDQSPAGDLRERAARIRALAQCPVT 69

Query: 84  GLNVEYTCPLSGIPTHHSREAWEQDTQYHATKRYETLKKVNIYEHDLRSGRPFPEFDFPQ 143
           G  + YTCPLSGIPTHHS+EAWEQD +YH +K++E LKKVNIYEHDLRSGRPFPEFDFPQ
Sbjct: 70  GKEINYTCPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGRPFPEFDFPQ 129

Query: 144 EQGYDKVVNMTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIASLLAQFSPYSLNPKG 203
           +  +D+ VNMTNWDLFFYTR FYSMDTEFQLAAVTKMLSYP+TIAS+L QFSPYSLNPKG
Sbjct: 130 DLEFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQFSPYSLNPKG 189

Query: 204 PITLEGLKSLAAVRYTLYSQSFNNSARAGGVTTGGALKNRPMRLFVLGARAEAQLPGHVW 263
           PITLEGLKSLAA+RYTLY   F N        T  A K+RPMRLF+LGARAEA LPGHVW
Sbjct: 190 PITLEGLKSLAALRYTLY--PFENK-------TVAATKDRPMRLFILGARAEALLPGHVW 240

Query: 264 KQLSYLFPEQSFEMVFIGPESYYDRARGQYVRSPTPVVEKVDETLKFIHYTDYFHVLHES 323
           KQL +LFPE +FE+ FIGPE   ++ + QYV SP PVV+++DETL F+++TDYFHV H++
Sbjct: 241 KQLQFLFPETAFELHFIGPECLVNKEKHQYVSSPAPVVKRIDETLSFVYHTDYFHVYHDA 300

Query: 324 QXXXXXXXXXXXXXXXHPGFASPENRDTWLSNTLPALLDTKCAIFTTGFDRDDLMNDVAL 383
           Q               HPGF +PE+   WL  T+P LL+TKCAIF TG ++  L+ D+  
Sbjct: 301 QDFFPYDPYLDAFFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINA 360

Query: 384 LNEKFGSEMDILMEPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHTIK 437
           + +K   E+DILMEPTKN++GSTKWELND+NP EVYQFNMYIAGFRGKRYH I+
Sbjct: 361 VMDKHSKEIDILMEPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIE 414

>KLTH0H01342g Chr8 complement(125673..126941) [1269 bp, 422 aa] {ON}
           similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203C MSS51 Protein required for the maturation and
           translation of COX1 mRNA involved in maturation of COX1
           and COB mRNA
          Length = 422

 Score =  572 bits (1475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/412 (65%), Positives = 321/412 (77%), Gaps = 8/412 (1%)

Query: 26  IARRQLMGFVRNALGLEXXXXXXXXXXENRFHPWDQSPVDALRERAARIKTLAKCPVTGL 85
           + +R +MGFVRNALGL+          ENRFHPWDQSP   LRERAA I+ LAKCPVTG 
Sbjct: 18  VQKRHIMGFVRNALGLDPPPSPDEPTPENRFHPWDQSPSPDLRERAATIRALAKCPVTGR 77

Query: 86  NVEYTCPLSGIPTHHSREAWEQDTQYHATKRYETLKKVNIYEHDLRSGRPFPEFDFPQEQ 145
            + YTCP SGIPTH+SREAWE D +Y  +KR E LKKVNIYEHDLRSGRPFPEFDFP +Q
Sbjct: 78  EINYTCPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNIYEHDLRSGRPFPEFDFPLDQ 137

Query: 146 GYDKVVNMTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIASLLAQFSPYSLNPKGPI 205
            +D++VN+TNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTI S+L QFSPYSLNPKGP+
Sbjct: 138 DFDRMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIGSVLHQFSPYSLNPKGPV 197

Query: 206 TLEGLKSLAAVRYTLYSQSFNNSARAGGVTTGGALKNRPMRLFVLGARAEAQLPGHVWKQ 265
           TLEGLKSLAA+RYTLY +    + R   +T     KN P+R+F+LGARAEAQLPGHVWKQ
Sbjct: 198 TLEGLKSLAALRYTLYPEQ---NRRVTSIT-----KNSPLRIFILGARAEAQLPGHVWKQ 249

Query: 266 LSYLFPEQSFEMVFIGPESYYDRARGQYVRSPTPVVEKVDETLKFIHYTDYFHVLHESQX 325
           L ++FPE + E+ F+GPESYYDR + +YV S +P+V +VDETL F+++TDYFHV HE+Q 
Sbjct: 250 LQFMFPETNIELHFVGPESYYDRNKREYVHSSSPIVRRVDETLSFVYHTDYFHVFHEAQD 309

Query: 326 XXXXXXXXXXXXXXHPGFASPENRDTWLSNTLPALLDTKCAIFTTGFDRDDLMNDVALLN 385
                         HPGFA+PE+R+ W+  T+ ALL+TKCA+FTTGF+  DL  DV  + 
Sbjct: 310 FFPYDPYTDIFFCFHPGFAAPESRENWMGKTMEALLETKCAVFTTGFNELDLRRDVGTVV 369

Query: 386 EKFGSEMDILMEPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHTIK 437
            K G E+D+LMEP  N FGSTKWELND+NP EVYQFNM+IAGFRGKRYH I+
Sbjct: 370 GKHGKELDMLMEPVHNAFGSTKWELNDMNPQEVYQFNMFIAGFRGKRYHAIE 421

>Kwal_56.24631 s56 (1080985..1082253) [1269 bp, 422 aa] {ON} YLR203C
           (MSS51) - involved in maturation of COX1 and COB mRNA
           [contig 161] FULL
          Length = 422

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/430 (63%), Positives = 328/430 (76%), Gaps = 16/430 (3%)

Query: 8   RPGVRSAHRALRASGLPCIARRQLMGFVRNALGLEXXXXXXXXXXENRFHPWDQSPVDAL 67
           R  +R++H +L+        +R +MGFVRNALGL+          ENRFHPWDQSP   L
Sbjct: 8   RSSLRNSHCSLQ--------KRHIMGFVRNALGLDPPPSPDEPTPENRFHPWDQSPSPDL 59

Query: 68  RERAARIKTLAKCPVTGLNVEYTCPLSGIPTHHSREAWEQDTQYHATKRYETLKKVNIYE 127
           RERAA I+ LAKCPVTG  + YTCP SGIPTHHSREAWE+D  Y  +KR E LKKVNIYE
Sbjct: 60  RERAATIRALAKCPVTGREINYTCPKSGIPTHHSREAWEKDLDYQQSKRPEILKKVNIYE 119

Query: 128 HDLRSGRPFPEFDFPQEQGYDKVVNMTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTI 187
           HDLRSGRPFPEFDFP +Q +D++VN+TNWDLFFYTRGF+SMDTEFQLAAVTKMLSYP+TI
Sbjct: 120 HDLRSGRPFPEFDFPLDQDFDRMVNLTNWDLFFYTRGFFSMDTEFQLAAVTKMLSYPITI 179

Query: 188 ASLLAQFSPYSLNPKGPITLEGLKSLAAVRYTLYSQSFNNSARAGGVTTGGALKNRPMRL 247
            S+L QFSPYSLNPKGPITLEGLKSLAA+RYTLY    + + R   +      KN P+R+
Sbjct: 180 GSVLHQFSPYSLNPKGPITLEGLKSLAALRYTLYP---DQNRRVTSIA-----KNSPLRI 231

Query: 248 FVLGARAEAQLPGHVWKQLSYLFPEQSFEMVFIGPESYYDRARGQYVRSPTPVVEKVDET 307
           FVLGARAEAQLPGHVWKQL ++FPE   E+ F+GPESYYDR + +YV S  P++ +VDET
Sbjct: 232 FVLGARAEAQLPGHVWKQLQFMFPETQMEIHFVGPESYYDRNKREYVHSAAPIIRRVDET 291

Query: 308 LKFIHYTDYFHVLHESQXXXXXXXXXXXXXXXHPGFASPENRDTWLSNTLPALLDTKCAI 367
           L F+++TDYFHV HE+Q               HPGFA+PE+R+ W+  T+ ALL+TKCAI
Sbjct: 292 LNFVYHTDYFHVFHEAQDFFPYDPYTDIFFCFHPGFAAPESRENWMGKTMEALLETKCAI 351

Query: 368 FTTGFDRDDLMNDVALLNEKFGSEMDILMEPTKNVFGSTKWELNDLNPHEVYQFNMYIAG 427
           FTTGF+  DL  D+  +  ++G E+DI+M+P KN FGSTKWELND+NP EVYQFNM++AG
Sbjct: 352 FTTGFNEVDLQRDLDAVVAEYGKELDIIMDPAKNAFGSTKWELNDVNPQEVYQFNMFMAG 411

Query: 428 FRGKRYHTIK 437
           FRGKRYH I+
Sbjct: 412 FRGKRYHAIE 421

>NDAI0E04480 Chr5 complement(1007346..1008677) [1332 bp, 443 aa]
           {ON} Anc_7.346 YLR203C
          Length = 443

 Score =  568 bits (1465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/411 (63%), Positives = 321/411 (78%), Gaps = 8/411 (1%)

Query: 27  ARRQLMGFVRNALGLEXXXXXXXXXXENRFHPWDQSPVDALRERAARIKTLAKCPVTGLN 86
           + R LMGFVRNALGL+          ENRFHPWDQSP   LRERAA+I+TLA CPVT   
Sbjct: 40  SSRSLMGFVRNALGLDPKSSPDDPTPENRFHPWDQSPCQDLRERAAKIRTLAHCPVTNKE 99

Query: 87  VEYTCPLSGIPTHHSREAWEQDTQYHATKRYETLKKVNIYEHDLRSGRPFPEFDFPQEQG 146
           + YTCP+SGIPTHHS+ AWE D  YH+ K YE LKKVNIYEHDLRSGRPFPEF FPQ+Q 
Sbjct: 100 INYTCPISGIPTHHSKNAWEMDENYHSNKIYEILKKVNIYEHDLRSGRPFPEFVFPQDQD 159

Query: 147 YDKVVNMTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIASLLAQFSPYSLNPKGPIT 206
           +D+++NMTNWDLF YTR FYSMDTEFQ+AAVTKMLSYP+TI S+L QFSPYSL PKGPIT
Sbjct: 160 FDRMINMTNWDLFLYTRSFYSMDTEFQMAAVTKMLSYPITIGSILHQFSPYSLQPKGPIT 219

Query: 207 LEGLKSLAAVRYTLYSQSFNNSARAGGVTTGGALKNRPMRLFVLGARAEAQLPGHVWKQL 266
           LEGLKS+AA+RYTLY   F+N +           KNRPMR+F+LGARAEAQLPGH+WKQL
Sbjct: 220 LEGLKSMAALRYTLY--PFHNKSFM------TLTKNRPMRIFLLGARAEAQLPGHIWKQL 271

Query: 267 SYLFPEQSFEMVFIGPESYYDRARGQYVRSPTPVVEKVDETLKFIHYTDYFHVLHESQXX 326
            YLFPEQ FE+ FIGPE+YYD+ + QY++   P+++ +D+TLK    T+YFH LHESQ  
Sbjct: 272 QYLFPEQKFELFFIGPEAYYDKEKKQYLKLDKPLIQTIDDTLKLTFITEYFHTLHESQDL 331

Query: 327 XXXXXXXXXXXXXHPGFASPENRDTWLSNTLPALLDTKCAIFTTGFDRDDLMNDVALLNE 386
                        HPGF++ E  + W+++T+ +LL+T+CAIF TGF R+D++ND+ +L+E
Sbjct: 332 FPYDPYMDVFFIFHPGFSAIETTEHWMNDTMKSLLETQCAIFNTGFSRNDMLNDMNILDE 391

Query: 387 KFGSEMDILMEPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHTIK 437
           K+ +++DILM+P KNVFGSTKWELNDLNP +VYQFNMYIAGFRGKRY T++
Sbjct: 392 KYKNDLDILMKPVKNVFGSTKWELNDLNPQDVYQFNMYIAGFRGKRYPTVE 442

>TBLA0E00500 Chr5 (91769..93082) [1314 bp, 437 aa] {ON} Anc_7.346
           YLR203C
          Length = 437

 Score =  553 bits (1424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/410 (61%), Positives = 311/410 (75%), Gaps = 4/410 (0%)

Query: 27  ARRQLMGFVRNALGLEXXXXXXXXXXENRFHPWDQSPVDALRERAARIKTLAKCPVTGLN 86
           ++R LMGFVR+ LGL+          ENRFHPW+ SP D LRERAARIKT+AKCPV+ L+
Sbjct: 23  SKRNLMGFVRSTLGLDPPPSPNDPTPENRFHPWETSPCDDLRERAARIKTMAKCPVSNLD 82

Query: 87  VEYTCPLSGIPTHHSREAWEQDTQYHATKRYETLKKVNIYEHDLRSGRPFPEFDFPQEQG 146
           + YTCP+SGIPTHHSR+ WE DT YH     + LKKVNIYEHDLRSGRPFPEFDFP+EQ 
Sbjct: 83  INYTCPISGIPTHHSRKEWEMDTNYHKNHIADILKKVNIYEHDLRSGRPFPEFDFPREQE 142

Query: 147 YDKVVNMTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIASLLAQFSPYSLNPKGPIT 206
           YD V+N+ NWDL+FYTR F+SMDTEFQLAAVTKMLSYP+TIAS+L QFSPYSL PKGP+T
Sbjct: 143 YDTVINLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYPMTIASVLHQFSPYSLTPKGPVT 202

Query: 207 LEGLKSLAAVRYTLYSQSFNN--SARAGGVTTGGALKNRPMRLFVLGARAEAQLPGHVWK 264
           LEGLKSLAA+RYTL + S ++  S  +   T     KNRPMR+F+LGARAEAQLP HVWK
Sbjct: 203 LEGLKSLAALRYTLNNNSLSDTSSGNSDSTTITATSKNRPMRIFILGARAEAQLPPHVWK 262

Query: 265 QLSYLFPEQSFEMVFIGPESYYDRARGQYVRSPTPVVEKVDETLKFIHYTDYFHVLHESQ 324
           QL YLFP  +FE+ FIGPES   + +  YV S TP+ +++D+++  +++TDYFHV H++Q
Sbjct: 263 QLQYLFPNSNFEIHFIGPESLLSKDKSHYVTSTTPITKRIDDSMSLVYHTDYFHVYHKAQ 322

Query: 325 XXXXXXXXXXXXXXXHPGFASPENRDTWLSNTLPALLDTKCAIFTTGFDRDDLMNDVALL 384
                          HPG A+   ++TWL+ T+  LLD+KC IF TGF   D+  D+++L
Sbjct: 323 DFYPYDPYFDIFFMFHPGLAA--TKETWLNETMQGLLDSKCPIFMTGFHEKDITADISVL 380

Query: 385 NEKFGSEMDILMEPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYH 434
           N+ F  +MDILM+P KNVFGSTKWELND NP EVYQFNMYIAG+RGKRYH
Sbjct: 381 NKNFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFNMYIAGYRGKRYH 430

>ACL152W Chr3 (85701..86987) [1287 bp, 428 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR203C (MSS51)
          Length = 428

 Score =  551 bits (1421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/413 (66%), Positives = 319/413 (77%), Gaps = 10/413 (2%)

Query: 25  CIARRQLMGFVRNALGLEXXXXXXXXXXENRFHPWDQSPVDALRERAARIKTLAKCPVTG 84
           C  RR +MGFVRNALGL+          ENRFH W+QSP   LRERAARI+ LA+CPVTG
Sbjct: 25  CGQRRPIMGFVRNALGLDPPASPDEPTDENRFHVWEQSPSPDLRERAARIRALARCPVTG 84

Query: 85  LNVEYTCPLSGIPTHHSREAWEQDTQYHATKRYETLKKVNIYEHDLRSGRPFPEFDFPQE 144
            ++ Y+C  SGIPTHHSREAWEQD +YH +KR+ TL+KVN+YEHDLRSGRPF EFDFPQE
Sbjct: 85  KDIRYSCERSGIPTHHSREAWEQDEEYHRSKRWATLRKVNVYEHDLRSGRPFAEFDFPQE 144

Query: 145 QGYDKVVNMTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIASLLAQFSPYSLNPKGP 204
           QG D++VNM NWDLF YTR FYSMDT+FQLAAVTKMLSYP+TI SLL QFSPY+L P+GP
Sbjct: 145 QGRDRMVNMLNWDLFLYTRQFYSMDTDFQLAAVTKMLSYPITIGSLLHQFSPYALEPRGP 204

Query: 205 ITLEGLKSLAAVRYTLYSQSFNNSARAGGVTTGGALKNRPMRLFVLGARAEAQLPGHVWK 264
           ITLEGLKSLAA+RYTLY +S   SAR        A++++PMR+F+LGARAEAQLPGHVWK
Sbjct: 205 ITLEGLKSLAALRYTLYPES--ESAR--------AVRSKPMRIFILGARAEAQLPGHVWK 254

Query: 265 QLSYLFPEQSFEMVFIGPESYYDRARGQYVRSPTPVVEKVDETLKFIHYTDYFHVLHESQ 324
           QL YLFP  + E+ FIGPE+ YDR R +YV S TPV ++VD TLK +H+TDY HV HE+Q
Sbjct: 255 QLQYLFPGSNMEIHFIGPEALYDRQRKEYVHSSTPVSKRVDGTLKLVHHTDYLHVFHEAQ 314

Query: 325 XXXXXXXXXXXXXXXHPGFASPENRDTWLSNTLPALLDTKCAIFTTGFDRDDLMNDVALL 384
                          HPGFAS E R +W+  T+PALL+TKCAIF TGF RDD+  D   L
Sbjct: 315 DFFPYDPYNDVFFCFHPGFASAEGRSSWMDKTVPALLETKCAIFVTGFHRDDMFGDFEAL 374

Query: 385 NEKFGSEMDILMEPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHTIK 437
                +EMD+LM PTKN+FGSTKWELND+NPHEVYQFNMYIAGFRGKRYH I+
Sbjct: 375 RASHDAEMDVLMHPTKNIFGSTKWELNDMNPHEVYQFNMYIAGFRGKRYHAIQ 427

>NCAS0A14120 Chr1 (2777017..2778300) [1284 bp, 427 aa] {ON}
           Anc_7.346 YLR203C
          Length = 427

 Score =  540 bits (1392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/411 (61%), Positives = 305/411 (74%), Gaps = 12/411 (2%)

Query: 27  ARRQLMGFVRNALGLEXXXXXXXXXXENRFHPWDQSPVDALRERAARIKTLAKCPVTGLN 86
           + R L+GFV+NALG++           NRF+PWD+SP  A+RERAARIK  AKCPVTG  
Sbjct: 28  SHRTLVGFVKNALGIDPPPLPTEPVFANRFYPWDESPSPAIRERAARIKAQAKCPVTGKE 87

Query: 87  VEYTCPLSGIPTHHSREAWEQDTQYHATKRYETLKKVNIYEHDLRSGRPFPEFDFPQEQG 146
           + +TCPLSGIPTH+S+EAWE DT YH  K YE L+KVNIYEHDLRSGRPFPEFDFP EQ 
Sbjct: 88  IRFTCPLSGIPTHYSKEAWENDTNYHKNKIYEKLRKVNIYEHDLRSGRPFPEFDFPGEQA 147

Query: 147 YDKVVNMTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIASLLAQFSPYSLNPKGPIT 206
            D  VNMTNWDLFFYTR FYSMDTEFQLA VTKMLSYP+TI S+L ++SPY+L PKGP+T
Sbjct: 148 RDSTVNMTNWDLFFYTRQFYSMDTEFQLATVTKMLSYPITIGSILYKYSPYNLIPKGPVT 207

Query: 207 LEGLKSLAAVRYTLYSQSFNNSARAGGVTTGGALKNRPMRLFVLGARAEAQLPGHVWKQL 266
           LEGLKSLAA+RYTL + +F               K RPMR+F+LGARAE+QLP H+WKQL
Sbjct: 208 LEGLKSLAALRYTLRNNAF------------ATTKTRPMRIFILGARAESQLPIHIWKQL 255

Query: 267 SYLFPEQSFEMVFIGPESYYDRARGQYVRSPTPVVEKVDETLKFIHYTDYFHVLHESQXX 326
            +LFP Q+FE+ FIGPE         Y+ S + +V++VDE+L   +Y DYF   H++Q  
Sbjct: 256 QFLFPAQAFEINFIGPECSLLEQDSNYLSSDSRIVKRVDESLTLAYYPDYFDKFHKAQDF 315

Query: 327 XXXXXXXXXXXXXHPGFASPENRDTWLSNTLPALLDTKCAIFTTGFDRDDLMNDVALLNE 386
                        HPGFASPE+  TW+ +T+ ALLDTKCAIFTTGF +DD+M D+  + +
Sbjct: 316 FPYDPYNDIFFTFHPGFASPESSKTWMGDTMKALLDTKCAIFTTGFSQDDIMKDITSVQD 375

Query: 387 KFGSEMDILMEPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHTIK 437
            +G E+D+LM P KNVFGSTKWELNDLNP +VYQFNMYIAGFRGKRYHT+K
Sbjct: 376 TYGEEVDMLMNPIKNVFGSTKWELNDLNPQQVYQFNMYIAGFRGKRYHTVK 426

>KNAG0C03750 Chr3 (740426..741700) [1275 bp, 424 aa] {ON} Anc_7.346
           YLR203C
          Length = 424

 Score =  528 bits (1360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/437 (58%), Positives = 307/437 (70%), Gaps = 14/437 (3%)

Query: 1   MLCTWTLRPGVRSAHRALRASGLPCIARRQLMGFVRNALGLEXXXXXXXXXXENRFHPWD 60
           ML +  L  G  + + +     +     R +MG+VRNA GLE           NRFHPW+
Sbjct: 1   MLLSRVLTLGKHAPYESFHTEIVRYTFHRTIMGYVRNAFGLEPRDSPDTPQISNRFHPWE 60

Query: 61  QSPVDALRERAARIKTLAKCPVTGLNVEYTCPLSGIPTHHSREAWEQDTQYHATKRYETL 120
           +SP   LR+RAARIKTLA+CPVTG N+ YTCP+SGIPTHHSR+AWE DT YH  K YE L
Sbjct: 61  ESPCADLRDRAARIKTLARCPVTGKNINYTCPISGIPTHHSRKAWEDDTDYHKNKTYEKL 120

Query: 121 KKVNIYEHDLRSGRPFPEFDFPQEQGYDKVVNMTNWDLFFYTRGFYSMDTEFQLAAVTKM 180
           KKVNIYEHDLRSGR FPEFDFP EQG D+ VN+ NWDLF YTR FYSMDTEF LA VTKM
Sbjct: 121 KKVNIYEHDLRSGRSFPEFDFPAEQGRDRAVNLQNWDLFLYTRQFYSMDTEFHLATVTKM 180

Query: 181 LSYPVTIASLLAQFSPYSLNPKGPITLEGLKSLAAVRYTLYSQSFNNSARAGGVTTGGAL 240
           LSYP+TIAS+L +FSPY L P+GP+TLEGLKS+AA+RYTLY +    S            
Sbjct: 181 LSYPITIASVLHEFSPYKLQPRGPVTLEGLKSIAALRYTLYPKLGKTSLS---------- 230

Query: 241 KNRPMRLFVLGARAEAQLPGHVWKQLSYLFPEQSFEMVFIGPESYYDRARGQYVRSPTPV 300
            N PMR+F++G RAE+QLPGHVWKQL YLF E+ FE+ FIGPE      +     + TP+
Sbjct: 231 NNSPMRIFIVGTRAESQLPGHVWKQLQYLFSERIFEIHFIGPECQLKEPKN----TSTPL 286

Query: 301 VEKVDETLKFIHYTDYFHVLHESQXXXXXXXXXXXXXXXHPGFASPENRDTWLSNTLPAL 360
           ++KVD+TL  I++  YFH LH+S                HPGFA P+ R  WL  T+P L
Sbjct: 287 IKKVDDTLSLIYHPQYFHELHKSGDLFPYNPYKDVFFIFHPGFAYPDTRKLWLDETIPNL 346

Query: 361 LDTKCAIFTTGFDRDDLMNDVALLNEKFGSEMDILMEPTKNVFGSTKWELNDLNPHEVYQ 420
           L+TKCAIF TGF+  D+ NDV L+++ + +E+D+LM+P KNVFGS KWELND+NP EVYQ
Sbjct: 347 LETKCAIFHTGFNEGDITNDVTLIDKCYRNEIDVLMKPIKNVFGSVKWELNDINPQEVYQ 406

Query: 421 FNMYIAGFRGKRYHTIK 437
           FNMYIAGFRGKRYH IK
Sbjct: 407 FNMYIAGFRGKRYHPIK 423

>KAFR0B00840 Chr2 (159480..160760) [1281 bp, 426 aa] {ON} Anc_7.346
           YLR203C
          Length = 426

 Score =  525 bits (1352), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/412 (59%), Positives = 302/412 (73%), Gaps = 8/412 (1%)

Query: 26  IARRQLMGFVRNALGLEXXXXXXXXXXENRFHPWDQSPVDALRERAARIKTLAKCPVTGL 85
           +  R L+GFVRNALGLE           NRF+PWDQSP   LRERAA+IK +A+CP+TG 
Sbjct: 22  VLSRTLVGFVRNALGLEPPPTPDEPRVSNRFYPWDQSPSPELRERAAKIKAMARCPITGK 81

Query: 86  NVEYTCPLSGIPTHHSREAWEQDTQYHATKRYETLKKVNIYEHDLRSGRPFPEFDFPQEQ 145
            + YTCP+SGIPTHHSREAWEQD  YH  K  + LKKVNIYEHDLRSGR FPEFDFP +Q
Sbjct: 82  EINYTCPISGIPTHHSREAWEQDEAYHRNKIPDILKKVNIYEHDLRSGRSFPEFDFPSDQ 141

Query: 146 GYDKVVNMTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIASLLAQFSPYSLNPKGPI 205
            +D+ VN+ NWDL+FYTR FYSMDTEFQLA VTKMLSYP+TIAS+L Q+SPYSL P GPI
Sbjct: 142 TFDRAVNLANWDLYFYTRSFYSMDTEFQLATVTKMLSYPITIASVLHQYSPYSLYPHGPI 201

Query: 206 TLEGLKSLAAVRYTLYSQSFNNSARAGGVTTGGALKNRPMRLFVLGARAEAQLPGHVWKQ 265
           TLEGLKS+AA+RY+LY     +S            K RPMR+F+LGARAE+QLPGHVWKQ
Sbjct: 202 TLEGLKSIAALRYSLYPSQHKSSRSVLN-------KTRPMRIFILGARAESQLPGHVWKQ 254

Query: 266 LSYLFPEQSFEMVFIGPESYYDRARGQYVRSPTPVVEKVDETLKFIHYTDYFHVLHESQX 325
             YLFP Q+FE++FIGPE    R     V     +V+++D+T+  +++   FH +H++Q 
Sbjct: 255 FQYLFPLQTFEIIFIGPECQL-REPSNSVGGANNIVKRIDDTISLVYHPKLFHDIHKAQD 313

Query: 326 XXXXXXXXXXXXXXHPGFASPENRDTWLSNTLPALLDTKCAIFTTGFDRDDLMNDVALLN 385
                         HPGFASPE ++ W+++T+ ALLDTKCA+F TGF + DL NDV LLN
Sbjct: 314 FFPYDPYNDVFFVFHPGFASPETKELWMNDTVKALLDTKCAVFHTGFSKKDLSNDVKLLN 373

Query: 386 EKFGSEMDILMEPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHTIK 437
           + +G ++D LM P KN+FGSTKWELNDLNP EVYQFNMYI+ FRGKRYH I+
Sbjct: 374 KMYGDKLDTLMTPVKNLFGSTKWELNDLNPQEVYQFNMYISAFRGKRYHPIE 425

>NDAI0A01930 Chr1 complement(430531..431883) [1353 bp, 450 aa] {ON}
           Anc_7.346 YLR203C
          Length = 450

 Score =  520 bits (1339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/425 (57%), Positives = 302/425 (71%), Gaps = 26/425 (6%)

Query: 27  ARRQLMGFVRNALGLEXXXXXXXXXXENRFHPWDQSPVDALRERAARIKTLAKCPVTGLN 86
           + R  +GFV+NALG+E          ENRFHPWDQSP   LRERAARI+ LAKCPVTG  
Sbjct: 37  SNRHFVGFVKNALGMEPPPSPNEPAFENRFHPWDQSPSPDLRERAARIRALAKCPVTGKE 96

Query: 87  VEYTCPLSGIPTHHSREAWEQDTQYHATKRYETLKKVNIYEHDLRSGRPFPEFDFPQEQG 146
           + YTCP+SGIPTHHS+EAWE DT YH  K Y+ LKKVN++EHDLRSGR FPEF+FPQ Q 
Sbjct: 97  INYTCPISGIPTHHSKEAWENDTNYHQNKIYDILKKVNVFEHDLRSGRSFPEFEFPQSQD 156

Query: 147 YDKVVNMTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIASLLAQFSPYSLNPKGPIT 206
           +D  V+M NWD+FFYTR F SMD+EFQLA VTKMLSYP+TIAS+L ++ PY+L P GPIT
Sbjct: 157 HDCAVSMNNWDMFFYTRQFVSMDSEFQLATVTKMLSYPITIASILHKYCPYALEPNGPIT 216

Query: 207 LEGLKSLAAVRYTLYSQSFNNSARAGGVTTGGALKNRPMRLFVLGARAEAQLPGHVWKQL 266
           LEGLKS+AA++Y+L    F  +            K RPMR+F+LGARAE+QLP H+WKQ 
Sbjct: 217 LEGLKSIAALKYSLRHNEFETT------------KERPMRIFILGARAESQLPEHIWKQF 264

Query: 267 SYLFPEQSFEMVFIGPESYY-------------DRARGQYVR-SPTPVVEKVDETLKFIH 312
           SYLFP Q+FE+ FIGPE                    G      P  +V+++DE L  ++
Sbjct: 265 SYLFPFQNFEINFIGPECSVLMNNNNMNAEETNTTTSGSMTEIRPNRIVKRIDERLNLVY 324

Query: 313 YTDYFHVLHESQXXXXXXXXXXXXXXXHPGFASPENRDTWLSNTLPALLDTKCAIFTTGF 372
           +TD+FH LH ++               HPGFASPEN  +W+  T+ ALLDTKCAIFTTGF
Sbjct: 325 HTDFFHTLHNARDFFPYDSYNDVFFTFHPGFASPENTKSWMGETMKALLDTKCAIFTTGF 384

Query: 373 DRDDLMNDVALLNEKFGSEMDILMEPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKR 432
           ++ DL+ D+ ++ E +G E+D+LM+PTKNVFGSTKWELND++P EVYQ+NMYIAGFRGKR
Sbjct: 385 NKQDLLKDIDIVQETYGKEVDMLMKPTKNVFGSTKWELNDMDPQEVYQYNMYIAGFRGKR 444

Query: 433 YHTIK 437
           YH +K
Sbjct: 445 YHAVK 449

>SAKL0G10714g Chr7 complement(908030..908929) [900 bp, 299 aa] {ON}
           highly similar to uniprot|P38710 Saccharomyces
           cerevisiae YHR046C INM1 Inositol monophosphatase
           involved in biosynthesis of inositol and in
           phosphoinositide second messenger signaling INM1
           expression increases in the presence of inositol and
           decreases upon exposure to antibipolar drugs lithium and
           valproate
          Length = 299

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 32/58 (55%), Gaps = 5/58 (8%)

Query: 255 EAQLPGHVWKQLSYLFPEQSFEMVFIGPESYYDRARGQYVRSPTPVVEKVDETLKFIH 312
           + Q+   +W++L   FP+  FE  FIG ESY  +   +    PT +V+ +D T  F+H
Sbjct: 56  DKQVEKIIWQELKTHFPQ--FE--FIGEESYV-KGVTKITDEPTFIVDPIDGTTNFVH 108

>NDAI0D01500 Chr4 complement(361232..362197) [966 bp, 321 aa] {ON}
           Anc_1.521 YJR070C
          Length = 321

 Score = 34.3 bits (77), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 27/60 (45%)

Query: 348 NRDTWLSNTLPALLDTKCAIFTTGFDRDDLMNDVALLNEKFGSEMDILMEPTKNVFGSTK 407
           N+D+ LSN   AL + KC       +  D    V  + E FG + ++L      V G TK
Sbjct: 27  NKDSVLSNRFRALFNLKCVAEQFKINPSDAKKAVDYMAETFGDKSELLKHEVAYVLGQTK 86

>KLLA0C07557g Chr3 complement(661000..662187) [1188 bp, 395 aa] {ON}
           similar to uniprot|P38969 Saccharomyces cerevisiae
           YOR266W PNT1 Involved in targeting of proteins to the
           mitochondrial inner membrane Pentamidine resistance
           protein involved in pentamidine resistance protein
          Length = 395

 Score = 33.9 bits (76), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%)

Query: 79  KCPVTGLNVEYTCPLSGIPTHHSREAWEQD 108
           KCP T LNV  T P++ IPT    +A +QD
Sbjct: 60  KCPETNLNVSATLPVTHIPTTKITDAVKQD 89

>NCAS0G03470 Chr7 complement(646978..647943) [966 bp, 321 aa] {ON}
           Anc_1.521 YJR070C
          Length = 321

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 27/60 (45%)

Query: 348 NRDTWLSNTLPALLDTKCAIFTTGFDRDDLMNDVALLNEKFGSEMDILMEPTKNVFGSTK 407
           ++D+ LSN   AL + KC       D  D    V  + E FG + ++L      V G TK
Sbjct: 27  SKDSALSNRFRALFNLKCVAEKFAVDPVDANKAVNYMAETFGDDSELLKHEVAYVLGQTK 86

>KNAG0B04880 Chr2 complement(936276..937163) [888 bp, 295 aa] {ON} 
          Length = 295

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 5/58 (8%)

Query: 255 EAQLPGHVWKQLSYLFPEQSFEMVFIGPESYYDRARGQYVRSPTPVVEKVDETLKFIH 312
           + QL   +W  L   +P  +F+  FIG ESY  +   +   SPT +V+ +D T  F+H
Sbjct: 50  DKQLEKLIWDSLVEKYP--TFK--FIGEESYI-KGVTKVTDSPTFIVDPIDGTTNFVH 102

>TDEL0E03410 Chr5 complement(641975..642862) [888 bp, 295 aa] {ON}
           Anc_5.286 YHR046C
          Length = 295

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 9/69 (13%)

Query: 246 RLFVLGARAEAQLPGHVWKQLSYLFPEQSFEMVFIGPESYYDRARGQYVRS--PTPVVEK 303
           R   L    + Q+   +WK L   +P+      F+G ESY    +G+ V +  PT +V+ 
Sbjct: 41  RAVDLVTAIDKQVESLIWKTLREKYPD----FRFVGEESY---VKGETVITDEPTFIVDP 93

Query: 304 VDETLKFIH 312
           +D T  F+H
Sbjct: 94  IDGTTNFVH 102

>NCAS0D04510 Chr4 (856025..857755) [1731 bp, 576 aa] {ON} Anc_6.329
           YCR061W
          Length = 576

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 28/54 (51%)

Query: 199 LNPKGPITLEGLKSLAAVRYTLYSQSFNNSARAGGVTTGGALKNRPMRLFVLGA 252
           LNP+G IT+E L+S     Y + +    + A AGG  T   L++  +    +GA
Sbjct: 341 LNPEGMITMEALESFLIFFYGITNVFLEHLAGAGGAWTPKDLQHVSIAFIYIGA 394

>NCAS0A06560 Chr1 complement(1298997..1299887) [891 bp, 296 aa] {ON}
           Anc_5.286
          Length = 296

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 5/58 (8%)

Query: 255 EAQLPGHVWKQLSYLFPEQSFEMVFIGPESYYDRARGQYVRSPTPVVEKVDETLKFIH 312
           + Q+   +W +L   +P+      FIG ESY  +   +    PT +V+ +D T  F+H
Sbjct: 51  DKQVEKLIWGELRAEYPD----FKFIGEESYM-KGVTRITEEPTFIVDPIDGTTNFVH 103

>Skud_3.116 Chr3 complement(178920..181703) [2784 bp, 927 aa] {ON}
           YCR037C (REAL)
          Length = 927

 Score = 30.8 bits (68), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 7/55 (12%)

Query: 375 DDLMND------VALLNEKFGSEMDILMEPTKNVFGSTKWELNDLNPHEVYQFNM 423
           D+L+ND      V  +NE FG EM+ L  P +++  ST       NP+EV+  N+
Sbjct: 189 DNLVNDLEKEGIVTRVNETFGPEMEDL-PPLRDIVSSTSQIQASNNPYEVHSSNL 242

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,431,992
Number of extensions: 1833574
Number of successful extensions: 3797
Number of sequences better than 10.0: 33
Number of HSP's gapped: 3836
Number of HSP's successfully gapped: 33
Length of query: 438
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 325
Effective length of database: 40,524,141
Effective search space: 13170345825
Effective search space used: 13170345825
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)