Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0B026207.351ON26526513280.0
Suva_10.2967.351ON2602587511e-100
KAFR0L014807.351ON2642467431e-98
YLR201C (COQ9)7.351ON2602607387e-98
Kpol_530.307.351ON2602617318e-97
NDAI0E044707.351ON2642627222e-95
Skud_12.2657.351ON2602567187e-95
NCAS0E028707.351ON2612617134e-94
TDEL0C019707.351ON2602607134e-94
CAGL0A03949g7.351ON2682647041e-92
ZYRO0F11726g7.351ON2512536977e-92
TBLA0E004507.351ON2792466911e-90
TPHA0F029807.351ON2642576814e-89
Kwal_56.246447.351ON2582496534e-85
SAKL0F11396g7.351ON2542496482e-84
Smik_12.2607.351ON2602606381e-82
KLTH0H01232g7.351ON2572506371e-82
ACL147W7.351ON2462466064e-78
KLLA0D12320g7.351ON2502476004e-77
Ecym_47227.351ON2532465735e-73
SAKL0D12716gna 1ON990103731.1
CAGL0B03861g5.150ON29470721.1
Smik_4.837.331ON90472667.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0B02620
         (265 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0B02620 Chr2 complement(507597..508394) [798 bp, 265 aa] {ON...   516   0.0  
Suva_10.296 Chr10 complement(522345..523127) [783 bp, 260 aa] {O...   293   e-100
KAFR0L01480 Chr12 (274514..275308) [795 bp, 264 aa] {ON} Anc_7.3...   290   1e-98
YLR201C Chr12 complement(549511..550293) [783 bp, 260 aa] {ON}  ...   288   7e-98
Kpol_530.30 s530 complement(75011..75793) [783 bp, 260 aa] {ON} ...   286   8e-97
NDAI0E04470 Chr5 complement(1006109..1006903) [795 bp, 264 aa] {...   282   2e-95
Skud_12.265 Chr12 complement(496162..496944) [783 bp, 260 aa] {O...   281   7e-95
NCAS0E02870 Chr5 complement(561968..562753) [786 bp, 261 aa] {ON...   279   4e-94
TDEL0C01970 Chr3 complement(343645..344427) [783 bp, 260 aa] {ON...   279   4e-94
CAGL0A03949g Chr1 (399220..400026) [807 bp, 268 aa] {ON} similar...   275   1e-92
ZYRO0F11726g Chr6 (959943..960698) [756 bp, 251 aa] {ON} similar...   273   7e-92
TBLA0E00450 Chr5 complement(83483..84322) [840 bp, 279 aa] {ON} ...   270   1e-90
TPHA0F02980 Chr6 (655375..656169) [795 bp, 264 aa] {ON} Anc_7.35...   266   4e-89
Kwal_56.24644 s56 (1087270..1088046) [777 bp, 258 aa] {ON} YLR20...   256   4e-85
SAKL0F11396g Chr6 (886970..887734) [765 bp, 254 aa] {ON} similar...   254   2e-84
Smik_12.260 Chr12 complement(496547..497329) [783 bp, 260 aa] {O...   250   1e-82
KLTH0H01232g Chr8 complement(119673..120446) [774 bp, 257 aa] {O...   249   1e-82
ACL147W Chr3 (92477..93217) [741 bp, 246 aa] {ON} Syntenic homol...   238   4e-78
KLLA0D12320g Chr4 complement(1048556..1049308) [753 bp, 250 aa] ...   235   4e-77
Ecym_4722 Chr4 complement(1413860..1414621) [762 bp, 253 aa] {ON...   225   5e-73
SAKL0D12716g Chr4 complement(1058482..1061454) [2973 bp, 990 aa]...    33   1.1  
CAGL0B03861g Chr2 complement(382452..383336) [885 bp, 294 aa] {O...    32   1.1  
Smik_4.83 Chr4 (155104..157818) [2715 bp, 904 aa] {ON} YDL154W (...    30   7.1  

>KNAG0B02620 Chr2 complement(507597..508394) [798 bp, 265 aa] {ON}
           Anc_7.351 YLR201C
          Length = 265

 Score =  516 bits (1328), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/265 (93%), Positives = 249/265 (93%)

Query: 1   MSIRLLKNSVSRRALLSTRLYHPNPIEYANSTVVAPLTYTMDSPQSRILTHCLQNEVPHW 60
           MSIRLLKNSVSRRALLSTRLYHPNPIEYANSTVVAPLTYTMDSPQSRILTHCLQNEVPHW
Sbjct: 1   MSIRLLKNSVSRRALLSTRLYHPNPIEYANSTVVAPLTYTMDSPQSRILTHCLQNEVPHW 60

Query: 61  GFTERALLKSIQAVGYDSSMMSVLGASNSPSIFHSSPAVMELVKFNLVKKRHALTEXXXX 120
           GFTERALLKSIQAVGYDSSMMSVLGASNSPSIFHSSPAVMELVKFNLVKKRHALTE    
Sbjct: 61  GFTERALLKSIQAVGYDSSMMSVLGASNSPSIFHSSPAVMELVKFNLVKKRHALTESLAA 120

Query: 121 XXXXXXXXXXXXEHLLVKRLQMDVPLSKQLGDLFTQLALPSQFMVNVAVPELFRLSDDMI 180
                       EHLLVKRLQMDVPLSKQLGDLFTQLALPSQFMVNVAVPELFRLSDDMI
Sbjct: 121 AGLGSPAALPSLEHLLVKRLQMDVPLSKQLGDLFTQLALPSQFMVNVAVPELFRLSDDMI 180

Query: 181 YFSNEKDHFDTAWYSKRLGVSLAYTTSKLFMAQDNSLNCQDTIEFARDKLHRIMTLGEYY 240
           YFSNEKDHFDTAWYSKRLGVSLAYTTSKLFMAQDNSLNCQDTIEFARDKLHRIMTLGEYY
Sbjct: 181 YFSNEKDHFDTAWYSKRLGVSLAYTTSKLFMAQDNSLNCQDTIEFARDKLHRIMTLGEYY 240

Query: 241 NNVEEYAWYSIMTTVNRAKAGFSRH 265
           NNVEEYAWYSIMTTVNRAKAGFSRH
Sbjct: 241 NNVEEYAWYSIMTTVNRAKAGFSRH 265

>Suva_10.296 Chr10 complement(522345..523127) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  293 bits (751), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 145/258 (56%), Positives = 184/258 (71%), Gaps = 2/258 (0%)

Query: 7   KNSVSRRALLSTRLYHPNPIEYANSTVVAPLTYTMDSPQSRILTHCLQNEVPHWGFTERA 66
           +N+V R+A  S RLYH NPIE+ N   + PL Y   SPQ ++L+  LQ  VP  GFTER+
Sbjct: 4   RNAV-RKASASLRLYHSNPIEHVNPLHIKPLAYGKQSPQYKVLSLALQEYVPKHGFTERS 62

Query: 67  LLKSIQAVGYDSSMMSVLGASNSPSIFHSSPAVMELVKFNLVKKRHALTEXXXXXXXXXX 126
           +++S+  +GY SSM+S +GASNSPS  HSS AVMEL+KF LV KR+ LTE          
Sbjct: 63  IVESLNKLGYPSSMISSIGASNSPSFVHSSTAVMELLKFQLVDKRYRLTEGINPDVTPHY 122

Query: 127 XXXXXXEHLLVKRLQMDVPLSKQLGDLFTQLALPSQFMVNVAVPELFRLSDDMIYFSNEK 186
                 EHLL+KRL+MD P+ +QL DL +QLA+PS F+   A+PEL RLSDDMIYFSNEK
Sbjct: 123 KLPSL-EHLLLKRLEMDKPVGEQLTDLMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEK 181

Query: 187 DHFDTAWYSKRLGVSLAYTTSKLFMAQDNSLNCQDTIEFARDKLHRIMTLGEYYNNVEEY 246
           DH D+AWY+KRL VS  Y  S+LFMAQD S +  +T  FA+DKLHR+M LGEYYNN EE+
Sbjct: 182 DHHDSAWYAKRLAVSSTYIGSQLFMAQDKSHDFHETFAFAKDKLHRVMRLGEYYNNTEEF 241

Query: 247 AWYSIMTTVNRAKAGFSR 264
           AWY++M+TVN  K+  +R
Sbjct: 242 AWYTLMSTVNLVKSQLAR 259

>KAFR0L01480 Chr12 (274514..275308) [795 bp, 264 aa] {ON} Anc_7.351
           YLR201C
          Length = 264

 Score =  290 bits (743), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 144/246 (58%), Positives = 182/246 (73%), Gaps = 6/246 (2%)

Query: 19  RLYHPNPIEYANSTVVAPLTYTMDSPQSRILTHCLQNEVPHWGFTERALLKSIQAVGYDS 78
           RLYHP   EY N T ++PLTY+MDS QS+IL+H L+  VP  GF E+++LKSI  +GY S
Sbjct: 24  RLYHPASNEYVNPTTISPLTYSMDSIQSKILSHSLKEYVPTSGFNEKSILKSINDLGYSS 83

Query: 79  SMMSVLGASNSPSIFHSSPAVMELVKFNLVKKRHALTEXXXXXXXXXXXXXXXXEHLLVK 138
           SMMSV+GASNSPS  HSSPAV+EL+K+NLV KR  LT+                    +K
Sbjct: 84  SMMSVIGASNSPSFAHSSPAVLELIKYNLVSKRIELTKDTNDNTTTTLKELL------LK 137

Query: 139 RLQMDVPLSKQLGDLFTQLALPSQFMVNVAVPELFRLSDDMIYFSNEKDHFDTAWYSKRL 198
           RL+MD+P+S QL  LF QLA P +FM +V++PELF+L+DDMI+FSNEKDH D AWYSKRL
Sbjct: 138 RLEMDIPISSQLRGLFAQLATPGKFMFDVSLPELFQLADDMIFFSNEKDHHDMAWYSKRL 197

Query: 199 GVSLAYTTSKLFMAQDNSLNCQDTIEFARDKLHRIMTLGEYYNNVEEYAWYSIMTTVNRA 258
            VS+AY TSK+FM QD S N Q T++FA DK+ R+M LGEYYNNVEEYAW+++M ++N  
Sbjct: 198 AVSMAYVTSKMFMIQDTSNNFQMTMDFASDKVDRVMNLGEYYNNVEEYAWFTLMNSINLV 257

Query: 259 KAGFSR 264
           K+ FSR
Sbjct: 258 KSQFSR 263

>YLR201C Chr12 complement(549511..550293) [783 bp, 260 aa] {ON}
           COQ9Protein required for ubiquinone (coenzyme Q)
           biosynthesis and respiratory growth; localizes to the
           matrix face of the mitochondrial inner membrane in a
           large complex with ubiquinone biosynthetic enzymes
          Length = 260

 Score =  288 bits (738), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 141/260 (54%), Positives = 180/260 (69%), Gaps = 1/260 (0%)

Query: 5   LLKNSVSRRALLSTRLYHPNPIEYANSTVVAPLTYTMDSPQSRILTHCLQNEVPHWGFTE 64
           +L  + +R      RLYH NPIE+     + PLTY  +SPQ ++L+  LQ  VP  GF+E
Sbjct: 1   MLCRNTARTGCKFFRLYHSNPIEHVKPIHIKPLTYGKESPQYKVLSLALQKFVPEHGFSE 60

Query: 65  RALLKSIQAVGYDSSMMSVLGASNSPSIFHSSPAVMELVKFNLVKKRHALTEXXXXXXXX 124
           R++++S+  +GY SSM+S +GA NSPS FHSS AVMEL+KF LV KR+ LTE        
Sbjct: 61  RSIVESLNELGYPSSMISSIGAPNSPSFFHSSTAVMELIKFQLVDKRYRLTEGINPDVTP 120

Query: 125 XXXXXXXXEHLLVKRLQMDVPLSKQLGDLFTQLALPSQFMVNVAVPELFRLSDDMIYFSN 184
                   EHLL+KRL+MD P+   L +L +QLA+PS F+   A+PEL RLSDDMIYFSN
Sbjct: 121 QYKLPSL-EHLLLKRLEMDKPIGGHLSELMSQLAIPSAFLFETAIPELHRLSDDMIYFSN 179

Query: 185 EKDHFDTAWYSKRLGVSLAYTTSKLFMAQDNSLNCQDTIEFARDKLHRIMTLGEYYNNVE 244
           EKDH D+AWY+KRL VS  Y  SKLFMAQD S N ++T  FA+DKLHR+M LGEYYNN E
Sbjct: 180 EKDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHNYKETFTFAKDKLHRVMRLGEYYNNTE 239

Query: 245 EYAWYSIMTTVNRAKAGFSR 264
           E+AWY++M+TVN  K+   R
Sbjct: 240 EFAWYTLMSTVNLIKSQLVR 259

>Kpol_530.30 s530 complement(75011..75793) [783 bp, 260 aa] {ON}
           complement(75011..75793) [783 nt, 261 aa]
          Length = 260

 Score =  286 bits (731), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 140/261 (53%), Positives = 179/261 (68%), Gaps = 3/261 (1%)

Query: 5   LLKNSVSRRALLS-TRLYHPNPIEYANSTVVAPLTYTMDSPQSRILTHCLQNEVPHWGFT 63
           +LKN V +R     TR YHPNP EY     + PL Y  DS Q +IL+H L   VP +GF 
Sbjct: 1   MLKNFVPKRTAFGLTRFYHPNPKEYVPQLTLPPLLYGKDSKQYKILSHSLDVSVPEFGFN 60

Query: 64  ERALLKSIQAVGYDSSMMSVLGASNSPSIFHSSPAVMELVKFNLVKKRHALTEXXXXXXX 123
           ERA++ SI  +GY SS++SV+G+SN+PS  HSS A+MEL+KFNLV KR+ L+E       
Sbjct: 61  ERAIVNSINLLGYPSSILSVIGSSNTPSFLHSSTALMELLKFNLVAKRYQLSEDIPLDTP 120

Query: 124 XXXXXXXXXEHLLVKRLQMDVPLSKQLGDLFTQLALPSQFMVNVAVPELFRLSDDMIYFS 183
                    E LL+KRL+MDVP+   L  L  QL++P  F+ + ++PEL RL+DDMIYFS
Sbjct: 121 VEELPSL--EDLLIKRLKMDVPIGPHLSQLIAQLSIPGPFLTDTSLPELHRLADDMIYFS 178

Query: 184 NEKDHFDTAWYSKRLGVSLAYTTSKLFMAQDNSLNCQDTIEFARDKLHRIMTLGEYYNNV 243
           +EKDH D AWY+KR+GVS AY +SKLFMAQD S    DT EFA+DKL RIM LG+YYNN 
Sbjct: 179 SEKDHPDFAWYAKRMGVSTAYMSSKLFMAQDRSPGYVDTFEFAKDKLKRIMKLGDYYNNA 238

Query: 244 EEYAWYSIMTTVNRAKAGFSR 264
           EEYAWY +M ++N AK+  +R
Sbjct: 239 EEYAWYVLMNSINMAKSKAAR 259

>NDAI0E04470 Chr5 complement(1006109..1006903) [795 bp, 264 aa] {ON}
           Anc_7.351 YLR201C
          Length = 264

 Score =  282 bits (722), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 142/262 (54%), Positives = 180/262 (68%), Gaps = 2/262 (0%)

Query: 5   LLKNSVSRRALLS-TRLYHPNPIEYANSTVVAPLTYTMDSPQSRILTHCLQNEVPHWGFT 63
           LL   +S+   LS  R +H N +EYA +  ++PLTY  DS Q +IL++ L   VP  GFT
Sbjct: 2   LLNRILSKNVKLSINRAFHSNTLEYAKAATLSPLTYNKDSVQYKILSNALNKWVPKKGFT 61

Query: 64  ERALLKSIQAVGYDSSMMSVLGASNSPSIFHS-SPAVMELVKFNLVKKRHALTEXXXXXX 122
           + A+  S+  +   SS+ SVLG+SNSPSIF S SPAVMEL+KF LV KR+ LTE      
Sbjct: 62  DEAITSSLNELDLSSSLFSVLGSSNSPSIFRSISPAVMELLKFQLVSKRYQLTENITPYI 121

Query: 123 XXXXXXXXXXEHLLVKRLQMDVPLSKQLGDLFTQLALPSQFMVNVAVPELFRLSDDMIYF 182
                     E LL++RL+MD PL+ QL  LF QL +PS  + NVA+PELF LSDD+IYF
Sbjct: 122 ETAKDKLPSLETLLIERLKMDQPLNNQLSSLFNQLIIPSPLLFNVALPELFNLSDDLIYF 181

Query: 183 SNEKDHFDTAWYSKRLGVSLAYTTSKLFMAQDNSLNCQDTIEFARDKLHRIMTLGEYYNN 242
           SNEKDH D AWY+KRLGVS AY +SKL+M ++N  N   TI+FA+DKLHRIM LGEYYNN
Sbjct: 182 SNEKDHHDMAWYAKRLGVSCAYVSSKLYMVKNNGENFDKTIDFAKDKLHRIMNLGEYYNN 241

Query: 243 VEEYAWYSIMTTVNRAKAGFSR 264
            EEYAWY++M ++N  KA  +R
Sbjct: 242 TEEYAWYTLMVSMNLVKARLAR 263

>Skud_12.265 Chr12 complement(496162..496944) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  281 bits (718), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 138/256 (53%), Positives = 179/256 (69%), Gaps = 1/256 (0%)

Query: 9   SVSRRALLSTRLYHPNPIEYANSTVVAPLTYTMDSPQSRILTHCLQNEVPHWGFTERALL 68
           +V+R      RLYH NPIE+     + PLTY   SPQ ++L+  L   VP  GF+ER+++
Sbjct: 5   NVARNGCKFHRLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSERSIV 64

Query: 69  KSIQAVGYDSSMMSVLGASNSPSIFHSSPAVMELVKFNLVKKRHALTEXXXXXXXXXXXX 128
           +S+  +GY SSM+S +GASNSPS FHSS AVMELVKF LV KR+ LTE            
Sbjct: 65  ESLNKLGYPSSMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTSRYKL 124

Query: 129 XXXXEHLLVKRLQMDVPLSKQLGDLFTQLALPSQFMVNVAVPELFRLSDDMIYFSNEKDH 188
               EHLL+KRL+MD  +  QL DL +QLA+PS+ +   A+PEL RLSDDMIYFSNE+DH
Sbjct: 125 PSL-EHLLLKRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNEEDH 183

Query: 189 FDTAWYSKRLGVSLAYTTSKLFMAQDNSLNCQDTIEFARDKLHRIMTLGEYYNNVEEYAW 248
            D+AWY+KRL VS  Y  SKLFMAQD S + ++T  FA++KLH++M LGEYYNN EE+AW
Sbjct: 184 HDSAWYAKRLAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEEFAW 243

Query: 249 YSIMTTVNRAKAGFSR 264
           Y++M+TVN  K+  +R
Sbjct: 244 YTLMSTVNLVKSQLAR 259

>NCAS0E02870 Chr5 complement(561968..562753) [786 bp, 261 aa] {ON}
           Anc_7.351 YLR201C
          Length = 261

 Score =  279 bits (713), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 141/261 (54%), Positives = 181/261 (69%), Gaps = 2/261 (0%)

Query: 5   LLKNSVSRRALLSTRLYHPNPIEYANSTVVAPLTYTMDSPQSRILTHCLQNEVPHWGFTE 64
           +L  S+ ++ L S R YHP+  EY     ++PLTY  +S Q +IL++ L   VP  GF E
Sbjct: 1   MLNRSILKKGLFSYRSYHPSLKEYVKPATLSPLTYNKESVQYKILSNALTKWVPKHGFKE 60

Query: 65  RALLKSIQAVGYDSSMMSVLGASNSPSIFHS-SPAVMELVKFNLVKKRHALTEXXXXXXX 123
           +A+  S+  +G+ SS++SV+GASNSP+IF S SPAVMEL+KF LV KR+ LTE       
Sbjct: 61  KAITDSLNELGFSSSLLSVIGASNSPAIFRSISPAVMELIKFQLVSKRYELTENLCPDTT 120

Query: 124 XXXXXXXXXEHLLVKRLQMDVPLSKQLGDLFTQLALPSQFMVNVAVPELFRLSDDMIYFS 183
                      LL+KRL+MD  + KQ+  LF +LA PS F+ +VA+PEL RLSDDMIYFS
Sbjct: 121 PKNELPSLES-LLLKRLEMDKAIGKQIPHLFAELATPSSFLFDVALPELHRLSDDMIYFS 179

Query: 184 NEKDHFDTAWYSKRLGVSLAYTTSKLFMAQDNSLNCQDTIEFARDKLHRIMTLGEYYNNV 243
           NEKDH D AWY+KRLGVS AY +SKL+MAQDNS + +DT+ FA+DKLHRIM LGEYYNN 
Sbjct: 180 NEKDHHDMAWYTKRLGVSCAYVSSKLYMAQDNSRDFEDTLSFAKDKLHRIMKLGEYYNNT 239

Query: 244 EEYAWYSIMTTVNRAKAGFSR 264
           EEYAWY  M + N  +A  +R
Sbjct: 240 EEYAWYMFMVSTNLVRARLAR 260

>TDEL0C01970 Chr3 complement(343645..344427) [783 bp, 260 aa] {ON}
           Anc_7.351 YLR201C
          Length = 260

 Score =  279 bits (713), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 135/260 (51%), Positives = 183/260 (70%), Gaps = 7/260 (2%)

Query: 10  VSRRALLSTRL----YHPNPIEYANS-TVVAPLTYTMDSPQSRILTHCLQNEVPHWGFTE 64
           +S+R +  +R+    Y P   EY N      PL Y  DSPQ ++L+H L   VP +GF E
Sbjct: 2   ISKRLIAGSRIFARGYRPAGFEYINPINSRGPLKYGKDSPQYKVLSHTLAKSVPMYGFNE 61

Query: 65  RALLKSIQAVGYDSSMMSVLGASNSPSIFHSSPAVMELVKFNLVKKRHALTEXXXXXXXX 124
           RA++ S+  +GY S+M+SV+G+SN PS FHSSPA+MEL+KF+LV KR  LTE        
Sbjct: 62  RAIVNSLNELGYPSTMLSVIGSSNGPSFFHSSPALMELLKFHLVDKRLNLTENISLETPV 121

Query: 125 XXXXXXXXEHLLVKRLQMDVPLSKQLGDLFTQLALPSQFMVNVAVPELFRLSDDMIYFSN 184
                   EHL++KRL+M+VP++K L  L +QL++P  F+V+ ++PEL RLSDDMIYFS 
Sbjct: 122 DQLPSL--EHLVIKRLEMNVPVAKHLSQLLSQLSIPGPFLVDYSMPELHRLSDDMIYFST 179

Query: 185 EKDHFDTAWYSKRLGVSLAYTTSKLFMAQDNSLNCQDTIEFARDKLHRIMTLGEYYNNVE 244
           EKDH D AWYSKRL VS AY +S+LFMAQD S + ++T EFAR+KLHR+ TLGEYYNN E
Sbjct: 180 EKDHNDFAWYSKRLAVSCAYVSSELFMAQDRSPDYKETFEFAREKLHRVSTLGEYYNNTE 239

Query: 245 EYAWYSIMTTVNRAKAGFSR 264
           E+AWY++++T+N  K+  +R
Sbjct: 240 EFAWYTLLSTINLVKSQLAR 259

>CAGL0A03949g Chr1 (399220..400026) [807 bp, 268 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201c
          Length = 268

 Score =  275 bits (704), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 132/264 (50%), Positives = 180/264 (68%), Gaps = 3/264 (1%)

Query: 2   SIRLLKNSVSRRALLST-RLYHPNPIEYANSTVVAPLTYTMDSPQSRILTHCLQNEVPHW 60
           ++RL+        LLS  R YHP   EY N  V  PLTYT +SP+ ++L+H ++N VP  
Sbjct: 6   NLRLVTRQKQVSGLLSAVRRYHPTSNEYVNPKVWEPLTYTPESPEFKLLSHTMENSVPQH 65

Query: 61  GFTERALLKSIQAVGYDSSMMSVLGASNSPSIFHSSPAVMELVKFNLVKKRHALTEXXXX 120
           GFTE+A++ S+ A+   S M++ +GASNS +  HSSPAVMEL+KF LV+KRH + E    
Sbjct: 66  GFTEKAIVNSLNAMKMPSGMLTTIGASNSATFLHSSPAVMELIKFQLVEKRHRMVEGITE 125

Query: 121 XXXXXXXXXXXXEHLLVKRLQMDVPLSKQLGDLFTQLALPSQFMVNVAVPELFRLSDDMI 180
                       E LL+KRL+MDVP++  L  +  QL +PS FM NV++PEL RL+DDMI
Sbjct: 126 IAEASKLPSL--ESLLLKRLKMDVPIASHLTQMTAQLMVPSSFMTNVSLPELERLADDMI 183

Query: 181 YFSNEKDHFDTAWYSKRLGVSLAYTTSKLFMAQDNSLNCQDTIEFARDKLHRIMTLGEYY 240
           Y+SNEKDH D AWY+KR  ++  Y  SK FMAQD S N  +T+EFA+DKLH++MTLG+YY
Sbjct: 184 YYSNEKDHHDFAWYTKRAALATTYLASKAFMAQDKSHNFMETMEFAQDKLHKVMTLGDYY 243

Query: 241 NNVEEYAWYSIMTTVNRAKAGFSR 264
           NNVEE+ W+++M+ VN  K+  +R
Sbjct: 244 NNVEEFGWFTLMSAVNLTKSQMAR 267

>ZYRO0F11726g Chr6 (959943..960698) [756 bp, 251 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201C FMP53
          Length = 251

 Score =  273 bits (697), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 130/253 (51%), Positives = 179/253 (70%), Gaps = 6/253 (2%)

Query: 12  RRALLSTRLYHPNPIEYANSTVVAPLTYTMDSPQSRILTHCLQNEVPHWGFTERALLKSI 71
           R   +S R YHP+  E+ NS+ + PL Y +DSPQ  +L+H L+  VP  GF ERA++ S+
Sbjct: 4   RLCQVSLRRYHPSKGEHLNSSRLGPLNYGLDSPQYAVLSHALKVSVPVVGFNERAIVHSL 63

Query: 72  QAVGYDSSMMSVLGASNSPSIFHSSPAVMELVKFNLVKKRHALTEXXXXXXXXXXXXXXX 131
             + Y S+M+SV+GASNSPS+ HSSPAVMELVKF+LV+KR  L++               
Sbjct: 64  NQLNYPSTMLSVIGASNSPSLLHSSPAVMELVKFHLVQKRLQLSQDLSSEEKPSL----- 118

Query: 132 XEHLLVKRLQMDVPLSKQLGDLFTQLALPSQFMVNVAVPELFRLSDDMIYFSNEKDHFDT 191
            E L +KRL+++VP++  L  L + +++P  F V+ A+PEL RLSDD+IY+SNEKDH D 
Sbjct: 119 -EDLFIKRLELNVPIAGHLSQLLSHVSVPGPFTVDTALPELHRLSDDLIYYSNEKDHHDF 177

Query: 192 AWYSKRLGVSLAYTTSKLFMAQDNSLNCQDTIEFARDKLHRIMTLGEYYNNVEEYAWYSI 251
           AWYSKRLG+S AY +S+LFMAQD S N ++T +FARDKL R M LGEYYNN EE+ WY++
Sbjct: 178 AWYSKRLGISCAYVSSELFMAQDKSHNYEETFQFARDKLQRTMQLGEYYNNTEEWLWYTL 237

Query: 252 MTTVNRAKAGFSR 264
           + ++N AK+  +R
Sbjct: 238 LNSINLAKSQMAR 250

>TBLA0E00450 Chr5 complement(83483..84322) [840 bp, 279 aa] {ON}
           Anc_7.351 YLR201C
          Length = 279

 Score =  270 bits (691), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 129/246 (52%), Positives = 173/246 (70%), Gaps = 4/246 (1%)

Query: 19  RLYHPNPIEYANSTVVAPLTYTMDSPQSRILTHCLQNEVPHWGFTERALLKSIQAVGYDS 78
           R Y+    +   S  + PL Y  DS Q RIL   +QN VP +GFTERA++ SI  +GY+S
Sbjct: 37  RTYYSVSNDVKKSDHLEPLLYGKDSAQYRILEDAVQNSVPTFGFTERAIINSINKLGYNS 96

Query: 79  SMMSVLGASNSPSIFHSSPAVMELVKFNLVKKRHALTEXXXXXXXXXXXXXXXXEHLLVK 138
           SM+SVLG+SN+ +I HSSPAV+EL+KFNLV KR  L+E                E+LL+K
Sbjct: 97  SMISVLGSSNTHNILHSSPAVLELLKFNLVSKRLKLSEGIDPETKDLPSL----EYLLLK 152

Query: 139 RLQMDVPLSKQLGDLFTQLALPSQFMVNVAVPELFRLSDDMIYFSNEKDHFDTAWYSKRL 198
           RLQMD  +  +L ++ T+L++P  F+   ++PELFRLSDDMIYFSNEKDH D AWYSKRL
Sbjct: 153 RLQMDKAIQSRLNEMITKLSIPGTFLAETSIPELFRLSDDMIYFSNEKDHHDMAWYSKRL 212

Query: 199 GVSLAYTTSKLFMAQDNSLNCQDTIEFARDKLHRIMTLGEYYNNVEEYAWYSIMTTVNRA 258
            VS  Y  S++FMAQD S++C  T+EFA+DKL+++M LGEYYNN EE+ W+++MT+VN  
Sbjct: 213 AVSTTYIASQIFMAQDTSVDCYKTLEFAQDKLNKVMNLGEYYNNTEEFLWFTLMTSVNIV 272

Query: 259 KAGFSR 264
           K+  +R
Sbjct: 273 KSQLAR 278

>TPHA0F02980 Chr6 (655375..656169) [795 bp, 264 aa] {ON} Anc_7.351
           YLR201C
          Length = 264

 Score =  266 bits (681), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 128/257 (49%), Positives = 182/257 (70%), Gaps = 3/257 (1%)

Query: 10  VSRRALLSTRLYHPNPIEYANSTVVAPLTYTMDSPQSRILTHCLQNEVPHWGFTERALLK 69
           + R++ ++ R +HP   EY     ++P TYT DSPQ +IL+H + N V  +GF+ERA+++
Sbjct: 8   IFRKSGVNARFFHPATDEYVLPNKLSPCTYTKDSPQFKILSHAIDNTVTKFGFSERAIIE 67

Query: 70  SIQAVGYD--SSMMSVLGASNSPSIFHSSPAVMELVKFNLVKKRHALTEXXXXXXXXXXX 127
           +++ +  +  S+M+S +G+SNSPS  HSSP+VMEL+KFNLV KR+ + E           
Sbjct: 68  AMKELKIENQSTMLSAIGSSNSPSFLHSSPSVMELLKFNLVLKRYRMIEGLDPLTMQQEE 127

Query: 128 XXXXXEHLLVKRLQMDVPLSKQLGDLFTQLALPSQFMVNVAVPELFRLSDDMIYFSNEKD 187
                  LL+KRL+MD+P+ K +    +QL +P  F+++ A+PEL RL+DDMIYFSNEKD
Sbjct: 128 LPSLES-LLLKRLEMDIPIGKHISAFMSQLVIPGPFLLDSALPELHRLADDMIYFSNEKD 186

Query: 188 HFDTAWYSKRLGVSLAYTTSKLFMAQDNSLNCQDTIEFARDKLHRIMTLGEYYNNVEEYA 247
           H D AWYSKRLGVS AY +SKLFMAQDNS N ++T++FA+DKL ++M LG+YYNN EEYA
Sbjct: 187 HHDFAWYSKRLGVSSAYISSKLFMAQDNSCNYKETLQFAKDKLEKVMRLGDYYNNTEEYA 246

Query: 248 WYSIMTTVNRAKAGFSR 264
           WY ++ +VN  K+  SR
Sbjct: 247 WYVLLNSVNMVKSRMSR 263

>Kwal_56.24644 s56 (1087270..1088046) [777 bp, 258 aa] {ON} YLR201C
           - Hypothetical ORF [contig 161] FULL
          Length = 258

 Score =  256 bits (653), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 122/249 (48%), Positives = 166/249 (66%)

Query: 16  LSTRLYHPNPIEYANSTVVAPLTYTMDSPQSRILTHCLQNEVPHWGFTERALLKSIQAVG 75
           L  R Y PNP+EY  +T +APL Y   S Q ++L H L+N VP +GF ERAL+ S+  +G
Sbjct: 9   LGRRFYQPNPLEYQLTTKLAPLAYGTQSIQFKVLDHALKNHVPSYGFNERALVASLNDLG 68

Query: 76  YDSSMMSVLGASNSPSIFHSSPAVMELVKFNLVKKRHALTEXXXXXXXXXXXXXXXXEHL 135
             S ++S +GA NSP + +SSPAV+ELVKF+LV KR+ALT+                E L
Sbjct: 69  LGSQVLSSIGAPNSPPLLNSSPAVLELVKFHLVTKRYALTKDLDIARCASPAEPPALETL 128

Query: 136 LVKRLQMDVPLSKQLGDLFTQLALPSQFMVNVAVPELFRLSDDMIYFSNEKDHFDTAWYS 195
             KRL++++P+++ +  L   LA+P +F++  A+PEL RLSDDMIYFS E D  D AWYS
Sbjct: 129 FHKRLELNIPIAQHMTQLLAILAMPGEFLLQSALPELHRLSDDMIYFSKEPDANDFAWYS 188

Query: 196 KRLGVSLAYTTSKLFMAQDNSLNCQDTIEFARDKLHRIMTLGEYYNNVEEYAWYSIMTTV 255
           KR  +S A+ +S+LFMAQD S N  DT EFA DKLH +  LG+YY N EEY WY+++ +V
Sbjct: 189 KRAAISCAFVSSELFMAQDKSPNYADTFEFAADKLHNVTKLGQYYTNTEEYMWYTLLMSV 248

Query: 256 NRAKAGFSR 264
           N AK+  +R
Sbjct: 249 NLAKSQITR 257

>SAKL0F11396g Chr6 (886970..887734) [765 bp, 254 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201C FMP53
          Length = 254

 Score =  254 bits (648), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 132/249 (53%), Positives = 180/249 (72%), Gaps = 4/249 (1%)

Query: 16  LSTRLYHPNPIEYANSTVVAPLTYTMDSPQSRILTHCLQNEVPHWGFTERALLKSIQAVG 75
           ++ R YHPN +E+A+S V+ PL Y+ DSPQ +IL + L  +VP +GF ERAL  S   +G
Sbjct: 9   IARRGYHPNNLEHASSKVLPPLIYSKDSPQWKILANALDEQVPKYGFNERALTSSCSDLG 68

Query: 76  YDSSMMSVLGASNSPSIFHSSPAVMELVKFNLVKKRHALTEXXXXXXXXXXXXXXXXEHL 135
           Y SS +SVLGASNSPS F+SSPAV+EL+KF+LV KR++LT+                E+L
Sbjct: 69  YSSSFLSVLGASNSPSFFNSSPAVLELLKFHLVSKRYSLTDGVADGTLESPSL----ENL 124

Query: 136 LVKRLQMDVPLSKQLGDLFTQLALPSQFMVNVAVPELFRLSDDMIYFSNEKDHFDTAWYS 195
            +KRL+M+ P++  L  L + LALP  F+   A+PEL RLSDDM+YFSNE DH D AWYS
Sbjct: 125 FLKRLEMNKPIAAHLSQLLSCLALPGAFLAEYAIPELHRLSDDMVYFSNEPDHNDFAWYS 184

Query: 196 KRLGVSLAYTTSKLFMAQDNSLNCQDTIEFARDKLHRIMTLGEYYNNVEEYAWYSIMTTV 255
           KRL +S AY +S+LFMAQD S++ QDT++FA++KL  I  LGE YNNVEEYAWY++++++
Sbjct: 185 KRLAISTAYVSSELFMAQDKSIDYQDTVKFAKEKLKNIKQLGEAYNNVEEYAWYTLLSSI 244

Query: 256 NRAKAGFSR 264
           + AK+  +R
Sbjct: 245 SLAKSQMTR 253

>Smik_12.260 Chr12 complement(496547..497329) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  250 bits (638), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 139/260 (53%), Positives = 182/260 (70%), Gaps = 1/260 (0%)

Query: 5   LLKNSVSRRALLSTRLYHPNPIEYANSTVVAPLTYTMDSPQSRILTHCLQNEVPHWGFTE 64
           +L  ++ R+   S RLYHPNPIE+  S  + PLTY  +SPQ ++L+  L+  VP  GF+E
Sbjct: 1   MLCRNILRKGCTSFRLYHPNPIEHVKSHHIKPLTYGKESPQYKVLSLALEQYVPKHGFSE 60

Query: 65  RALLKSIQAVGYDSSMMSVLGASNSPSIFHSSPAVMELVKFNLVKKRHALTEXXXXXXXX 124
           R++++S+  +GY SSM+S + ASNSPS FHSS AVMEL+KF LV KR+ LTE        
Sbjct: 61  RSIVESLNELGYPSSMISSISASNSPSFFHSSTAVMELIKFQLVDKRYRLTEAINPDVTP 120

Query: 125 XXXXXXXXEHLLVKRLQMDVPLSKQLGDLFTQLALPSQFMVNVAVPELFRLSDDMIYFSN 184
                     LL++RL+MD P+   L +L +QLA+PS F+   A+PEL RLSDDMIYFSN
Sbjct: 121 QYKLPSLEH-LLLRRLEMDKPIGGCLSELMSQLAIPSGFLFETAIPELHRLSDDMIYFSN 179

Query: 185 EKDHFDTAWYSKRLGVSLAYTTSKLFMAQDNSLNCQDTIEFARDKLHRIMTLGEYYNNVE 244
           EKDH D+AWY+KRL VS  Y  SKLFMAQD S N +DT +FA+ KL+R+M LGEYYNN E
Sbjct: 180 EKDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHNYKDTFDFAKHKLNRVMRLGEYYNNTE 239

Query: 245 EYAWYSIMTTVNRAKAGFSR 264
           E+AWY++M+TVN  K+   R
Sbjct: 240 EFAWYTLMSTVNLVKSQLVR 259

>KLTH0H01232g Chr8 complement(119673..120446) [774 bp, 257 aa] {ON}
           similar to uniprot|Q05779 Saccharomyces cerevisiae
           YLR201C FMP53
          Length = 257

 Score =  249 bits (637), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 119/250 (47%), Positives = 168/250 (67%)

Query: 15  LLSTRLYHPNPIEYANSTVVAPLTYTMDSPQSRILTHCLQNEVPHWGFTERALLKSIQAV 74
           +L+ RLYHP+ +E+  +   APLTY   S Q ++L H L   VP +GF ERAL+ S+  +
Sbjct: 7   ILARRLYHPSALEHQLAHSFAPLTYGPGSTQFKVLEHALNKHVPSYGFNERALVASLNDL 66

Query: 75  GYDSSMMSVLGASNSPSIFHSSPAVMELVKFNLVKKRHALTEXXXXXXXXXXXXXXXXEH 134
               S++SV+GASNSPS  ++SPAV+EL+KF+LV KR+ALT+                E 
Sbjct: 67  DLGPSLLSVIGASNSPSFLNASPAVLELIKFHLVTKRYALTKELDPARTSSPAEPPALET 126

Query: 135 LLVKRLQMDVPLSKQLGDLFTQLALPSQFMVNVAVPELFRLSDDMIYFSNEKDHFDTAWY 194
           L  +RL+++ P++  L  L + L++P +F+V  A+PEL RLSDDM+YFS E D  D AWY
Sbjct: 127 LFHRRLELNKPIAPHLTQLLSSLSIPGEFLVQTALPELHRLSDDMVYFSKEPDANDFAWY 186

Query: 195 SKRLGVSLAYTTSKLFMAQDNSLNCQDTIEFARDKLHRIMTLGEYYNNVEEYAWYSIMTT 254
           SKR+ +S A+ +S+LFMAQD S N  DT EFA +KLH +  LG+YYNN EEY WY+++ +
Sbjct: 187 SKRIALSCAFVSSELFMAQDRSANYADTFEFAAEKLHNVSKLGQYYNNTEEYMWYTLLMS 246

Query: 255 VNRAKAGFSR 264
           VN AK+  +R
Sbjct: 247 VNLAKSQLTR 256

>ACL147W Chr3 (92477..93217) [741 bp, 246 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR201C
          Length = 246

 Score =  238 bits (606), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 113/246 (45%), Positives = 163/246 (66%), Gaps = 7/246 (2%)

Query: 19  RLYHPNPIEYANSTVVAPLTYTMDSPQSRILTHCLQNEVPHWGFTERALLKSIQAVGYDS 78
           RLYHPN +E+A    + PL Y  DSPQ ++L   L+  VP  GF ERA++++   +GY S
Sbjct: 7   RLYHPNTLEHAVGNRLRPLAYEQDSPQYKVLQRALEAHVPVLGFNERAIVRAAGDLGYGS 66

Query: 79  SMMSVLGASNSPSIFHSSPAVMELVKFNLVKKRHALTEXXXXXXXXXXXXXXXXEHLLVK 138
           +++S L A NSP++ +   AV+ELVKF+LV KR AL +                E L ++
Sbjct: 67  AVLSALAAPNSPALLNVPSAVLELVKFHLVTKRVALADAAAQGNVSM-------EQLFLQ 119

Query: 139 RLQMDVPLSKQLGDLFTQLALPSQFMVNVAVPELFRLSDDMIYFSNEKDHFDTAWYSKRL 198
           R++ D PL+ QL  L + L+LP +F+VN A+PELFRLSDD+IY+S EKDH D AWYSKR 
Sbjct: 120 RVEADRPLAGQLTQLLSILSLPGEFLVNTAMPELFRLSDDLIYYSGEKDHPDLAWYSKRA 179

Query: 199 GVSLAYTTSKLFMAQDNSLNCQDTIEFARDKLHRIMTLGEYYNNVEEYAWYSIMTTVNRA 258
            V++AY ++ LFMA+D S   ++T+ FAR +L ++ +LG  YNNVEE+AWY ++  +N  
Sbjct: 180 AVAMAYVSTNLFMARDRSPALEETLHFARRRLQQVDSLGTAYNNVEEFAWYQLLMAMNLV 239

Query: 259 KAGFSR 264
           K+  +R
Sbjct: 240 KSQLTR 245

>KLLA0D12320g Chr4 complement(1048556..1049308) [753 bp, 250 aa]
           {ON} similar to uniprot|Q05779 Saccharomyces cerevisiae
           YLR201C FMP53,
          Length = 250

 Score =  235 bits (600), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 111/247 (44%), Positives = 172/247 (69%), Gaps = 3/247 (1%)

Query: 18  TRLYHPNPIEYANSTVVAPLTYTMDSPQSRILTHCLQNEVPHWGFTERALLKSIQAVGYD 77
           TRLYHPN +E+A   ++ PLTY  DS Q ++L++ L   VP +GF ERA+++S+  +G  
Sbjct: 6   TRLYHPNNLEHALPKIIKPLTYGTDSVQFKVLSNALNKHVPQYGFNERAIVQSLNELGMG 65

Query: 78  SSMMSVLGASNSPSIFHSSPAVMELVKFNLVKKRHALTEXXXXXXXXXXXXXXXXEHLLV 137
           SS +SVLG+SNSPS F+ SP+V+ELVKF+LV KR+ L                  + L +
Sbjct: 66  SSYLSVLGSSNSPSFFNVSPSVLELVKFHLVSKRNQLI---TDLPLDSDKPLPDLKTLFL 122

Query: 138 KRLQMDVPLSKQLGDLFTQLALPSQFMVNVAVPELFRLSDDMIYFSNEKDHFDTAWYSKR 197
           +RL+++  ++  L  L + +++P +F+ + A+ EL +L+DDMI++SNE+DH D AWYSKR
Sbjct: 123 QRLKLNEHVAPHLSQLLSIMSVPGEFLASTALSELHKLTDDMIFYSNEQDHNDFAWYSKR 182

Query: 198 LGVSLAYTTSKLFMAQDNSLNCQDTIEFARDKLHRIMTLGEYYNNVEEYAWYSIMTTVNR 257
           + +S AY +S+LFMAQD S N Q+T+EFA+ KL+++  LG  YNN EEY W+++++++N 
Sbjct: 183 IALSTAYVSSELFMAQDKSHNFQETMEFAQSKLNKVSQLGSMYNNTEEYLWFTLLSSINL 242

Query: 258 AKAGFSR 264
           AK+  +R
Sbjct: 243 AKSQITR 249

>Ecym_4722 Chr4 complement(1413860..1414621) [762 bp, 253 aa] {ON}
           similar to Ashbya gossypii ACL147W
          Length = 253

 Score =  225 bits (573), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 108/246 (43%), Positives = 162/246 (65%), Gaps = 8/246 (3%)

Query: 19  RLYHPNPIEYANSTVVAPLTYTMDSPQSRILTHCLQNEVPHWGFTERALLKSIQAVGYDS 78
           R YH N  EYA    + PL Y   SPQ ++L   L+  VP  GF + A++ +   +GY+S
Sbjct: 15  RFYHVNSAEYAVGNTLRPLIYGRCSPQYKVLNCALEKYVPFKGFKDSAIVDAANELGYNS 74

Query: 79  SMMSVLGASNSPSIFHSSPAVMELVKFNLVKKRHALTEXXXXXXXXXXXXXXXXEHLLVK 138
           ++++ +GA+NSP++F+ S +V ELVKF+LV KR+ L E                E L +K
Sbjct: 75  AVLAAIGANNSPAMFNVSTSVQELVKFHLVTKRYGLQEDQEGTKTL--------EELFLK 126

Query: 139 RLQMDVPLSKQLGDLFTQLALPSQFMVNVAVPELFRLSDDMIYFSNEKDHFDTAWYSKRL 198
           RL+ +  L   L ++ + LA+P  F+VN  +PELF+L+DDMIY+S EKD  D AWYSKRL
Sbjct: 127 RLEANKSLGPHLKEVLSILAIPGDFLVNTGLPELFQLADDMIYYSTEKDFNDLAWYSKRL 186

Query: 199 GVSLAYTTSKLFMAQDNSLNCQDTIEFARDKLHRIMTLGEYYNNVEEYAWYSIMTTVNRA 258
            VS+AY +++LFMA+D+S N Q T+EFA+ ++++I  +G  YNN+EE+AW+ ++TTVN A
Sbjct: 187 AVSMAYISTELFMAKDSSPNFQATMEFAKGRINQIDEMGTAYNNIEEFAWFQLLTTVNLA 246

Query: 259 KAGFSR 264
           ++   R
Sbjct: 247 RSQLVR 252

>SAKL0D12716g Chr4 complement(1058482..1061454) [2973 bp, 990 aa]
           {ON} similar to gnl|GLV|KLLA0B13838g Kluyveromyces
           lactis KLLA0B13838g gi|28565042|gb|AAO32604.1
           Kluyveromyces lactis YJR061W hypothetical start
           KLLA0B13838g|KLLA-IPF6935|KLLA-CDS0443.1 and weakly
           similar to YJR061W uniprot|P40355 Saccharomyces
           cerevisiae YJR061W Hypothetical ORF
          Length = 990

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 50/103 (48%), Gaps = 15/103 (14%)

Query: 161 SQFMVNVA-VPELFRLSDDMIYFSNEKDHFD-TAWYSKRLGVSLAYTTSKLFMAQDNSLN 218
           S F+ N A +PEL    D  +YFSN    F+ T +  K LG  L Y +S  F+++D  L 
Sbjct: 809 SVFLHNAAKIPEL---EDTFVYFSNT---FEITLFRQKELG--LMYDSS--FLSEDKQLL 858

Query: 219 CQDTIEFARDKLHRIMTLGEYYNNVEEYAWYSIMTTVNRAKAG 261
                EF RD+    +    + N +E   WY+++  +  +  G
Sbjct: 859 LN---EFVRDRTFNGVFKDVFQNKLETTIWYNLLNNMPNSYKG 898

>CAGL0B03861g Chr2 complement(382452..383336) [885 bp, 294 aa] {ON}
           similar to uniprot|P47086 Saccharomyces cerevisiae
           YJR011c
          Length = 294

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 34/70 (48%), Gaps = 11/70 (15%)

Query: 20  LYHPNPIEY------ANSTVVAPLTYTMDSPQSRILTHCLQNE-VPHWGFTERALLKSIQ 72
           L H N + Y       N     P    +D+ +++ L HC++NE +P W    R +L+  +
Sbjct: 145 LGHRNIVNYWEKMSIVNDRDQDPEQEALDAIKTKTLLHCIKNELLPSW----RKVLEDYK 200

Query: 73  AVGYDSSMMS 82
           A  +D+ M S
Sbjct: 201 AACFDAVMQS 210

>Smik_4.83 Chr4 (155104..157818) [2715 bp, 904 aa] {ON} YDL154W
           (REAL)
          Length = 904

 Score = 30.0 bits (66), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 32/72 (44%), Gaps = 4/72 (5%)

Query: 149 QLGDLFTQLALPSQFMVN---VAVPELFRLSDDMIYFSNEKDHFDTAWYSKRLGVSLAYT 205
           QLG L T   L   F+VN   +   E+FR SD+ IYF NEK       Y    G    Y 
Sbjct: 486 QLGYLVTVSTLLEPFLVNTPDLEWEEIFRSSDN-IYFKNEKVLELDETYGDIYGAISDYE 544

Query: 206 TSKLFMAQDNSL 217
              LF  Q+  L
Sbjct: 545 IEVLFSLQEQIL 556

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.131    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,907,338
Number of extensions: 956505
Number of successful extensions: 2451
Number of sequences better than 10.0: 25
Number of HSP's gapped: 2470
Number of HSP's successfully gapped: 25
Length of query: 265
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 157
Effective length of database: 41,097,471
Effective search space: 6452302947
Effective search space used: 6452302947
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 65 (29.6 bits)