Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0B026107.352ON1191045316e-71
YLR200W (YKE2)7.352ON1141033762e-47
KAFR0L014907.352ON1071043674e-46
ZYRO0F11748g7.352ON1091043641e-45
Suva_10.2957.352ON1141033632e-45
Smik_12.2597.352ON1141033615e-45
NDAI0E044607.352ON1061023553e-44
Skud_12.2647.352ON1141033553e-44
TPHA0F029907.352ON1071043544e-44
NCAS0E028607.352ON1051043492e-43
Kpol_530.297.352ON1071023483e-43
TBLA0E004407.352ON115973484e-43
TDEL0C019607.352ON1071033441e-42
Ecym_47217.352ON107993405e-42
Kwal_56.246487.352ON113973381e-41
KLTH0H01210g7.352ON1131083381e-41
KLLA0D12298g7.352ON115983372e-41
SAKL0F11418g7.352ON1151003363e-41
ACL146C7.352ON107993353e-41
CAGL0A03971g7.352ON1061003345e-41
NCAS0A127302.567ON55253680.73
TBLA0A05520singletonON126976651.9
YEL003W (GIM4)7.139ON11181613.4
Kpol_1039.612.101ON129106614.1
TBLA0D031908.831ON168241624.6
KNAG0D035204.113ON103062616.0
KLLA0E04753g7.531ON33032608.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0B02610
         (119 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0B02610 Chr2 (507118..507477) [360 bp, 119 aa] {ON} Anc_7.35...   209   6e-71
YLR200W Chr12 (549012..549356) [345 bp, 114 aa] {ON}  YKE2Subuni...   149   2e-47
KAFR0L01490 Chr12 complement(275355..275678) [324 bp, 107 aa] {O...   145   4e-46
ZYRO0F11748g Chr6 complement(960734..961063) [330 bp, 109 aa] {O...   144   1e-45
Suva_10.295 Chr10 (521814..522158) [345 bp, 114 aa] {ON} YLR200W...   144   2e-45
Smik_12.259 Chr12 (496033..496377) [345 bp, 114 aa] {ON} YLR200W...   143   5e-45
NDAI0E04460 Chr5 (1005674..1005994) [321 bp, 106 aa] {ON} Anc_7....   141   3e-44
Skud_12.264 Chr12 (495654..495998) [345 bp, 114 aa] {ON} YLR200W...   141   3e-44
TPHA0F02990 Chr6 complement(656466..656789) [324 bp, 107 aa] {ON...   140   4e-44
NCAS0E02860 Chr5 (561551..561868) [318 bp, 105 aa] {ON} Anc_7.35...   139   2e-43
Kpol_530.29 s530 (74361..74684) [324 bp, 107 aa] {ON} (74361..74...   138   3e-43
TBLA0E00440 Chr5 (82880..83227) [348 bp, 115 aa] {ON} Anc_7.352 ...   138   4e-43
TDEL0C01960 Chr3 (343261..343584) [324 bp, 107 aa] {ON} Anc_7.35...   137   1e-42
Ecym_4721 Chr4 (1413362..1413685) [324 bp, 107 aa] {ON} similar ...   135   5e-42
Kwal_56.24648 s56 complement(1088138..1088479) [342 bp, 113 aa] ...   134   1e-41
KLTH0H01210g Chr8 (119243..119584) [342 bp, 113 aa] {ON} similar...   134   1e-41
KLLA0D12298g Chr4 (1048089..1048436) [348 bp, 115 aa] {ON} simil...   134   2e-41
SAKL0F11418g Chr6 complement(887825..888172) [348 bp, 115 aa] {O...   134   3e-41
ACL146C Chr3 complement(93269..93592) [324 bp, 107 aa] {ON} Synt...   133   3e-41
CAGL0A03971g Chr1 complement(400291..400611) [321 bp, 106 aa] {O...   133   5e-41
NCAS0A12730 Chr1 (2513595..2515253) [1659 bp, 552 aa] {ON} Anc_2...    31   0.73 
TBLA0A05520 Chr1 complement(1366145..1369954) [3810 bp, 1269 aa]...    30   1.9  
YEL003W Chr5 (148176..148194,148283..148599) [336 bp, 111 aa] {O...    28   3.4  
Kpol_1039.61 s1039 complement(169465..169854) [390 bp, 129 aa] {...    28   4.1  
TBLA0D03190 Chr4 complement(776722..781770) [5049 bp, 1682 aa] {...    28   4.6  
KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa] {...    28   6.0  
KLLA0E04753g Chr5 complement(423256..424248) [993 bp, 330 aa] {O...    28   8.4  

>KNAG0B02610 Chr2 (507118..507477) [360 bp, 119 aa] {ON} Anc_7.352
           YLR200W
          Length = 119

 Score =  209 bits (531), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 104/104 (100%), Positives = 104/104 (100%)

Query: 1   MSNPAAKYQKAQSALEELIVARQKLETQLQENKIVIEEFDALKEDSKVYKLTGSVLLPVD 60
           MSNPAAKYQKAQSALEELIVARQKLETQLQENKIVIEEFDALKEDSKVYKLTGSVLLPVD
Sbjct: 1   MSNPAAKYQKAQSALEELIVARQKLETQLQENKIVIEEFDALKEDSKVYKLTGSVLLPVD 60

Query: 61  QDEARTNVDKRLEFINGEIDRCEENIKEKQETLEGLRSELMKLQ 104
           QDEARTNVDKRLEFINGEIDRCEENIKEKQETLEGLRSELMKLQ
Sbjct: 61  QDEARTNVDKRLEFINGEIDRCEENIKEKQETLEGLRSELMKLQ 104

>YLR200W Chr12 (549012..549356) [345 bp, 114 aa] {ON}  YKE2Subunit
           of the heterohexameric Gim/prefoldin protein complex
           involved in the folding of alpha-tubulin, beta-tubulin,
           and actin
          Length = 114

 Score =  149 bits (376), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 77/103 (74%), Positives = 88/103 (85%)

Query: 1   MSNPAAKYQKAQSALEELIVARQKLETQLQENKIVIEEFDALKEDSKVYKLTGSVLLPVD 60
           MS   AKYQ+ Q+ LEE IVARQKLETQLQENKIV EEFD L+ED+ VYKLTG+VLLPV+
Sbjct: 1   MSELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVE 60

Query: 61  QDEARTNVDKRLEFINGEIDRCEENIKEKQETLEGLRSELMKL 103
           Q EARTNVDKRLEFI  EI RCE+NI++KQE LE +RSEL+KL
Sbjct: 61  QSEARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIKL 103

>KAFR0L01490 Chr12 complement(275355..275678) [324 bp, 107 aa] {ON}
           Anc_7.352 YLR200W
          Length = 107

 Score =  145 bits (367), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 89/104 (85%)

Query: 1   MSNPAAKYQKAQSALEELIVARQKLETQLQENKIVIEEFDALKEDSKVYKLTGSVLLPVD 60
           MS  AA+YQK QS LEELIVARQKLETQLQENKIV +EF +LKE+++VYKLTG+VLLP++
Sbjct: 1   MSELAAQYQKLQSELEELIVARQKLETQLQENKIVNDEFKSLKEETQVYKLTGNVLLPIE 60

Query: 61  QDEARTNVDKRLEFINGEIDRCEENIKEKQETLEGLRSELMKLQ 104
           QDEAR NVDKRLEFI  EI RCE NIK KQ  +E +R+EL+KL+
Sbjct: 61  QDEARGNVDKRLEFIEKEITRCEGNIKSKQTEIENIRNELVKLR 104

>ZYRO0F11748g Chr6 complement(960734..961063) [330 bp, 109 aa] {ON}
           highly similar to uniprot|P52553 Saccharomyces
           cerevisiae YLR200W YKE2 Yeast nuclear gene
          Length = 109

 Score =  144 bits (364), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 86/104 (82%)

Query: 1   MSNPAAKYQKAQSALEELIVARQKLETQLQENKIVIEEFDALKEDSKVYKLTGSVLLPVD 60
           MS  AA+YQK Q  LE  IVARQKLETQLQENKIV +EF+ LK DSKVYKLTG+VLLPV+
Sbjct: 1   MSELAAQYQKLQGELENFIVARQKLETQLQENKIVDDEFNGLKSDSKVYKLTGNVLLPVE 60

Query: 61  QDEARTNVDKRLEFINGEIDRCEENIKEKQETLEGLRSELMKLQ 104
           QD+ARTNV KRLEFI  EIDRCE NIK KQE  E +++EL+KL+
Sbjct: 61  QDDARTNVSKRLEFIQTEIDRCENNIKGKQEEQERVKAELIKLR 104

>Suva_10.295 Chr10 (521814..522158) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  144 bits (363), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 76/103 (73%), Positives = 85/103 (82%)

Query: 1   MSNPAAKYQKAQSALEELIVARQKLETQLQENKIVIEEFDALKEDSKVYKLTGSVLLPVD 60
           MS   AKYQ  QS LEE IVARQKLETQLQENKIV EEFD LKED+ VYKLTG+VLLPV+
Sbjct: 1   MSELGAKYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNVLLPVE 60

Query: 61  QDEARTNVDKRLEFINGEIDRCEENIKEKQETLEGLRSELMKL 103
           Q EAR NV+KRLEFI  EI RCE+NI+ KQE LE +R+EL+KL
Sbjct: 61  QSEARGNVEKRLEFIETEIKRCEKNIRGKQEELEQVRNELVKL 103

>Smik_12.259 Chr12 (496033..496377) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  143 bits (361), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 74/103 (71%), Positives = 84/103 (81%)

Query: 1   MSNPAAKYQKAQSALEELIVARQKLETQLQENKIVIEEFDALKEDSKVYKLTGSVLLPVD 60
           MS    KYQ  Q  LEE IVARQKLETQLQENKIV EEFD L+E++ VYKLTG+VLLPVD
Sbjct: 1   MSELGTKYQHLQGELEEFIVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNVLLPVD 60

Query: 61  QDEARTNVDKRLEFINGEIDRCEENIKEKQETLEGLRSELMKL 103
           Q EAR NVDKRLEFI  EI RCE+NIK+KQE LE +R++L+KL
Sbjct: 61  QSEARGNVDKRLEFIEAEITRCEKNIKDKQEQLEKVRNDLIKL 103

>NDAI0E04460 Chr5 (1005674..1005994) [321 bp, 106 aa] {ON} Anc_7.352
           YLR200W
          Length = 106

 Score =  141 bits (355), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 70/102 (68%), Positives = 85/102 (83%)

Query: 2   SNPAAKYQKAQSALEELIVARQKLETQLQENKIVIEEFDALKEDSKVYKLTGSVLLPVDQ 61
           SN  +KYQ  Q  LE+LI+ARQKLETQLQENKIVIEEF+ L  +S+VYKLTG+VLLPVDQ
Sbjct: 3   SNLPSKYQVLQGELEDLIMARQKLETQLQENKIVIEEFNQLPSESQVYKLTGNVLLPVDQ 62

Query: 62  DEARTNVDKRLEFINGEIDRCEENIKEKQETLEGLRSELMKL 103
           +EA +NVDKRLEFI  EI RCE NIK KQ+ L+ +RSE++K+
Sbjct: 63  EEAHSNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEILKM 104

>Skud_12.264 Chr12 (495654..495998) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  141 bits (355), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 73/103 (70%), Positives = 84/103 (81%)

Query: 1   MSNPAAKYQKAQSALEELIVARQKLETQLQENKIVIEEFDALKEDSKVYKLTGSVLLPVD 60
           MS   A+YQ  QS LEE IVARQKLETQLQENKIV EEFD + +D+ VYKLTG+VLLPV+
Sbjct: 1   MSELGAEYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVE 60

Query: 61  QDEARTNVDKRLEFINGEIDRCEENIKEKQETLEGLRSELMKL 103
           Q EAR NVDKRLEFI  EI RCE NI+EKQ+ LE +R+EL+KL
Sbjct: 61  QSEARGNVDKRLEFIETEIKRCERNIREKQDELEKVRNELIKL 103

>TPHA0F02990 Chr6 complement(656466..656789) [324 bp, 107 aa] {ON}
           Anc_7.352 YLR200W
          Length = 107

 Score =  140 bits (354), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 87/104 (83%)

Query: 1   MSNPAAKYQKAQSALEELIVARQKLETQLQENKIVIEEFDALKEDSKVYKLTGSVLLPVD 60
           MS+ AAKYQ  Q  LEELI+ARQKLETQLQENKIV +EF+ L ED+ +YKLTG+V+LP++
Sbjct: 1   MSDVAAKYQSVQGELEELIIARQKLETQLQENKIVNDEFNDLNEDTPIYKLTGNVMLPIE 60

Query: 61  QDEARTNVDKRLEFINGEIDRCEENIKEKQETLEGLRSELMKLQ 104
           Q EA++NV+KRLEFI  EI RCEENIK KQ+ L+ LR ELMK++
Sbjct: 61  QFEAKSNVEKRLEFIENEIKRCEENIKTKQDELDKLRGELMKMR 104

>NCAS0E02860 Chr5 (561551..561868) [318 bp, 105 aa] {ON} Anc_7.352
           YLR200W
          Length = 105

 Score =  139 bits (349), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 90/104 (86%)

Query: 1   MSNPAAKYQKAQSALEELIVARQKLETQLQENKIVIEEFDALKEDSKVYKLTGSVLLPVD 60
           M++  A+YQ  QS LE  I+ARQKLETQLQENKIV++EF+ L +++KVYKLTG+VLLPV+
Sbjct: 1   MADLPAQYQSLQSELESFIIARQKLETQLQENKIVMDEFEQLVDETKVYKLTGNVLLPVE 60

Query: 61  QDEARTNVDKRLEFINGEIDRCEENIKEKQETLEGLRSELMKLQ 104
           QDEAR+NV+KRLEFI  EI +CE+NIK+KQE LE +R+E++K++
Sbjct: 61  QDEARSNVEKRLEFIQSEITKCEKNIKQKQEELEKVRAEIIKMR 104

>Kpol_530.29 s530 (74361..74684) [324 bp, 107 aa] {ON}
           (74361..74684) [324 nt, 108 aa]
          Length = 107

 Score =  138 bits (348), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 72/102 (70%), Positives = 85/102 (83%)

Query: 1   MSNPAAKYQKAQSALEELIVARQKLETQLQENKIVIEEFDALKEDSKVYKLTGSVLLPVD 60
           MS+ A KYQK Q  LEE+IVAR++LETQLQENKIV EEF+ LKED++VYKLTG+VLLPV+
Sbjct: 1   MSDLANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQVYKLTGNVLLPVE 60

Query: 61  QDEARTNVDKRLEFINGEIDRCEENIKEKQETLEGLRSELMK 102
           Q EAR+NV+KRLEFI  EI +CE+NIK KQ  L  LR ELMK
Sbjct: 61  QFEARSNVEKRLEFIEAEIKKCEDNIKSKQTELNKLRDELMK 102

>TBLA0E00440 Chr5 (82880..83227) [348 bp, 115 aa] {ON} Anc_7.352
           YLR200W
          Length = 115

 Score =  138 bits (348), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 82/97 (84%)

Query: 5   AAKYQKAQSALEELIVARQKLETQLQENKIVIEEFDALKEDSKVYKLTGSVLLPVDQDEA 64
           A KYQ  Q+ LE  IV RQKLETQLQENKIV +EF+ LKE++KV+KLTG+VLLP++QDEA
Sbjct: 7   ATKYQTFQNELEGFIVTRQKLETQLQENKIVNDEFEKLKEETKVFKLTGNVLLPIEQDEA 66

Query: 65  RTNVDKRLEFINGEIDRCEENIKEKQETLEGLRSELM 101
           R+N+DKRLEFI  EIDRCE+NIK KQ  +E +RSELM
Sbjct: 67  RSNIDKRLEFIQTEIDRCEKNIKAKQAEMEKIRSELM 103

>TDEL0C01960 Chr3 (343261..343584) [324 bp, 107 aa] {ON} Anc_7.352
           YLR200W
          Length = 107

 Score =  137 bits (344), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 71/103 (68%), Positives = 83/103 (80%)

Query: 1   MSNPAAKYQKAQSALEELIVARQKLETQLQENKIVIEEFDALKEDSKVYKLTGSVLLPVD 60
           MS+ AA YQ  QS LE L++ARQKLETQLQENKIV EEF  LKED++VYKLTG+VLLPV+
Sbjct: 1   MSDLAAAYQALQSELEVLVIARQKLETQLQENKIVSEEFSELKEDTQVYKLTGNVLLPVE 60

Query: 61  QDEARTNVDKRLEFINGEIDRCEENIKEKQETLEGLRSELMKL 103
           Q EA +NV KRLEFI  EI RCE N+K KQ+  E LR+EL+KL
Sbjct: 61  QSEANSNVAKRLEFIQTEIGRCENNLKAKQQEQEKLRAELIKL 103

>Ecym_4721 Chr4 (1413362..1413685) [324 bp, 107 aa] {ON} similar to
           Ashbya gossypii ACL146C
          Length = 107

 Score =  135 bits (340), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 70/99 (70%), Positives = 79/99 (79%)

Query: 5   AAKYQKAQSALEELIVARQKLETQLQENKIVIEEFDALKEDSKVYKLTGSVLLPVDQDEA 64
           AAKY + Q  LE+LIV RQKLETQLQENKIV EE  +LKED +VYKLTG VLLPV+ +EA
Sbjct: 7   AAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLPVEHEEA 66

Query: 65  RTNVDKRLEFINGEIDRCEENIKEKQETLEGLRSELMKL 103
            +NV KRLEFI GEIDRCE NIK KQ+ LE  R EL+KL
Sbjct: 67  NSNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDELIKL 105

>Kwal_56.24648 s56 complement(1088138..1088479) [342 bp, 113 aa]
           {ON} YLR200W (YKE2) - Polypeptide 6 of a Yeast
           Non-native Actin Binding Complex, homolog of a component
           of the bovine NABC complex [contig 161] FULL
          Length = 113

 Score =  134 bits (338), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 81/97 (83%)

Query: 8   YQKAQSALEELIVARQKLETQLQENKIVIEEFDALKEDSKVYKLTGSVLLPVDQDEARTN 67
           Y  AQ  LEEL+ ARQ+LETQLQENKIV +EFD+LKE+++VYKLTG VLLPV+Q EA++N
Sbjct: 12  YTTAQQELEELVTARQRLETQLQENKIVQDEFDSLKEETQVYKLTGKVLLPVEQFEAKSN 71

Query: 68  VDKRLEFINGEIDRCEENIKEKQETLEGLRSELMKLQ 104
           V KRLEFIN EI RCE+NIK KQ  LE LR+EL++ Q
Sbjct: 72  VSKRLEFINTEIKRCEDNIKNKQSLLEKLRAELLQAQ 108

>KLTH0H01210g Chr8 (119243..119584) [342 bp, 113 aa] {ON} similar to
           uniprot|P52553 Saccharomyces cerevisiae YLR200W YKE2
           Yeast nuclear gene
          Length = 113

 Score =  134 bits (338), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 69/108 (63%), Positives = 86/108 (79%), Gaps = 4/108 (3%)

Query: 1   MSNPA----AKYQKAQSALEELIVARQKLETQLQENKIVIEEFDALKEDSKVYKLTGSVL 56
           MS+ A      Y  +Q  LEEL++ARQKLETQLQENKIV +EFD L+E+++VYKLTG+VL
Sbjct: 1   MSSSAQDLTMNYNTSQHELEELVIARQKLETQLQENKIVQDEFDGLREETQVYKLTGNVL 60

Query: 57  LPVDQDEARTNVDKRLEFINGEIDRCEENIKEKQETLEGLRSELMKLQ 104
           LPV+Q EA++NV KRLEFI  EI+RCEENIK KQ  LE LR+EL++ Q
Sbjct: 61  LPVEQFEAKSNVSKRLEFITAEINRCEENIKTKQGLLEKLRAELLQTQ 108

>KLLA0D12298g Chr4 (1048089..1048436) [348 bp, 115 aa] {ON} similar
           to uniprot|P52553 Saccharomyces cerevisiae YLR200W YKE2
           Yeast nuclear gene
          Length = 115

 Score =  134 bits (337), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 80/98 (81%)

Query: 7   KYQKAQSALEELIVARQKLETQLQENKIVIEEFDALKEDSKVYKLTGSVLLPVDQDEART 66
           KY K Q  LEELIVARQKLETQLQENKIV +EF +LK+D+ VYKLTG VLLPV+Q EA+ 
Sbjct: 9   KYTKLQGELEELIVARQKLETQLQENKIVSDEFSSLKDDATVYKLTGGVLLPVEQFEAKG 68

Query: 67  NVDKRLEFINGEIDRCEENIKEKQETLEGLRSELMKLQ 104
           NV+KRLEFI  EI RCE NIK KQ+ LE  RSELMKL+
Sbjct: 69  NVEKRLEFIEIEIKRCETNIKSKQQELEVARSELMKLR 106

>SAKL0F11418g Chr6 complement(887825..888172) [348 bp, 115 aa] {ON}
           similar to uniprot|P52553 Saccharomyces cerevisiae
           YLR200W YKE2 Yeast nuclear gene
          Length = 115

 Score =  134 bits (336), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 85/100 (85%)

Query: 5   AAKYQKAQSALEELIVARQKLETQLQENKIVIEEFDALKEDSKVYKLTGSVLLPVDQDEA 64
           + +Y   QS LE+L++ARQKLETQLQENKIV +EFD L+++S+VYKLTG VLLPV+Q+EA
Sbjct: 10  SMQYTTMQSELEDLVIARQKLETQLQENKIVQDEFDTLRDESQVYKLTGGVLLPVEQEEA 69

Query: 65  RTNVDKRLEFINGEIDRCEENIKEKQETLEGLRSELMKLQ 104
           + NV+KRL+FI  EI RCEENIKEKQ  LE LR+EL++L+
Sbjct: 70  KGNVEKRLQFIKNEITRCEENIKEKQTQLERLRNELVRLR 109

>ACL146C Chr3 complement(93269..93592) [324 bp, 107 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR200W
           (YKE2)
          Length = 107

 Score =  133 bits (335), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 67/99 (67%), Positives = 80/99 (80%)

Query: 5   AAKYQKAQSALEELIVARQKLETQLQENKIVIEEFDALKEDSKVYKLTGSVLLPVDQDEA 64
           A KY + Q  LEEL+V RQKLETQLQENKIV EE  AL+ +++VYKLTG VLLPV+Q+EA
Sbjct: 7   ATKYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLLPVEQEEA 66

Query: 65  RTNVDKRLEFINGEIDRCEENIKEKQETLEGLRSELMKL 103
             NV KRLEFI GEI RCE+NIK+KQE +EG R+ L+KL
Sbjct: 67  EGNVSKRLEFIEGEIRRCEQNIKQKQEEMEGARAALVKL 105

>CAGL0A03971g Chr1 complement(400291..400611) [321 bp, 106 aa] {ON}
           similar to uniprot|P52553 Saccharomyces cerevisiae
           YLR200w YKE2 Gim complex component
          Length = 106

 Score =  133 bits (334), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 80/100 (80%)

Query: 5   AAKYQKAQSALEELIVARQKLETQLQENKIVIEEFDALKEDSKVYKLTGSVLLPVDQDEA 64
            AKYQ  Q+ LEEL+ ARQKLETQLQENKIV EEF  LKED+ VYKLTG+VLLPV+ D+A
Sbjct: 6   GAKYQSLQNELEELVTARQKLETQLQENKIVNEEFATLKEDTVVYKLTGNVLLPVEHDDA 65

Query: 65  RTNVDKRLEFINGEIDRCEENIKEKQETLEGLRSELMKLQ 104
           + NVDKRLEFI  EI RCE+NI+ KQ+ LE +R +L+  Q
Sbjct: 66  KNNVDKRLEFIGEEIKRCEDNIRSKQQELETIRGQLISQQ 105

>NCAS0A12730 Chr1 (2513595..2515253) [1659 bp, 552 aa] {ON}
           Anc_2.567 YMR020W
          Length = 552

 Score = 30.8 bits (68), Expect = 0.73,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 3/53 (5%)

Query: 32  NKIVIEEFDALKEDSKV-YKLTGSVLLPVDQDEART--NVDKRLEFINGEIDR 81
           N + +EE +A+K+DSK  +    S  + +D    R   + D  LEF++ EID+
Sbjct: 115 NPLFLEEAEAMKKDSKKRFVFEDSQFIYIDDQRGRIDHDPDMSLEFVDAEIDK 167

>TBLA0A05520 Chr1 complement(1366145..1369954) [3810 bp, 1269 aa]
           {ON} 
          Length = 1269

 Score = 29.6 bits (65), Expect = 1.9,   Method: Composition-based stats.
 Identities = 19/76 (25%), Positives = 35/76 (46%), Gaps = 8/76 (10%)

Query: 8   YQKAQSALEELIVARQKLETQLQENKIVIEEFDALKEDSKVYKLTGSVLLPVDQDEARTN 67
           Y K+ ++L +L   +  +  ++   K+V  E         +Y++T S + P        N
Sbjct: 247 YSKSPNSLGKLCKLKTVMANKVSNCKLVFNE--------SLYEITYSYVAPDKLKNVIDN 298

Query: 68  VDKRLEFINGEIDRCE 83
           V   L ++NG +D CE
Sbjct: 299 VKPLLVYVNGLVDACE 314

>YEL003W Chr5 (148176..148194,148283..148599) [336 bp, 111 aa]
          {ON}  GIM4Subunit of the heterohexameric cochaperone
          prefoldin complex which binds specifically to cytosolic
          chaperonin and transfers target proteins to it
          Length = 111

 Score = 28.1 bits (61), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 38/81 (46%)

Query: 6  AKYQKAQSALEELIVARQKLETQLQENKIVIEEFDALKEDSKVYKLTGSVLLPVDQDEAR 65
          AKY + +  LEEL     +L     E+ IVI+     +   K Y++ G  L+  D   + 
Sbjct: 10 AKYNEYKQILEELQTKIIELGHDKDEHTIVIKTLKDAEPTRKCYRMIGGALVESDVQTSL 69

Query: 66 TNVDKRLEFINGEIDRCEENI 86
            ++ + E I G I + +E +
Sbjct: 70 PILETKKENIEGTISKMKETL 90

>Kpol_1039.61 s1039 complement(169465..169854) [390 bp, 129 aa] {ON}
           complement(169465..169854) [390 nt, 130 aa]
          Length = 129

 Score = 28.1 bits (61), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 53/106 (50%), Gaps = 7/106 (6%)

Query: 2   SNPAAKYQKAQSALEELIVARQKLETQLQ---ENKIVIE----EFDALKEDSKVYKLTGS 54
           +N + K Q+  +   +LI+ +  +E QL    E K  +E    E + + ED  V+   G 
Sbjct: 12  TNVSYKDQQLINEFSKLIMRKDSIEEQLNLQNEEKSYLEDVSLEIELIDEDQLVHYKIGD 71

Query: 55  VLLPVDQDEARTNVDKRLEFINGEIDRCEENIKEKQETLEGLRSEL 100
           V L + Q+E    ++   E I+ +ID  + +  E  + L+ L+++L
Sbjct: 72  VFLMLPQEEVVNLLESDTEVIDSKIDNLQNSKSEIDDRLKELKAQL 117

>TBLA0D03190 Chr4 complement(776722..781770) [5049 bp, 1682 aa] {ON}
            Anc_8.831 YMR273C
          Length = 1682

 Score = 28.5 bits (62), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 2/41 (4%)

Query: 10   KAQSALEELIVARQKLETQLQENKIVIEEFDALKEDSKVYK 50
            KAQ  +  LI+    LE+ +   KIVI EF+ + + SK +K
Sbjct: 1215 KAQLTMNNLIL--NGLESNIHNEKIVIPEFENMNDYSKEFK 1253

>KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa] {ON}
           Anc_4.113 YGL013C
          Length = 1030

 Score = 28.1 bits (61), Expect = 6.0,   Method: Composition-based stats.
 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 3/62 (4%)

Query: 26  ETQLQENKIVIEEFDALKEDSKVYKLTGSVLLPVDQDEARTNVDKRLEFINGEIDRCEEN 85
           + Q++E +++    D L   S+VYK    +L PV Q     +V K L+ +     +CEEN
Sbjct: 855 QLQVKEPQLIACTRDILDTKSQVYKY---LLTPVQQSGFHISVRKLLKDLGVVGQQCEEN 911

Query: 86  IK 87
            K
Sbjct: 912 EK 913

>KLLA0E04753g Chr5 complement(423256..424248) [993 bp, 330 aa] {ON}
           similar to uniprot|P52919 Saccharomyces cerevisiae
           YLR457C NBP1 Component of the mitotic apparatus
           containing a coiled-coil domain essential for the G2/M
           transition
          Length = 330

 Score = 27.7 bits (60), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 22/32 (68%)

Query: 9   QKAQSALEELIVARQKLETQLQENKIVIEEFD 40
           Q+   A+EEL++ ++KLE   Q+N ++ E FD
Sbjct: 179 QRLSDAVEELVITKKKLEFVQQKNNLLEELFD 210

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.128    0.326 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 10,294,034
Number of extensions: 418750
Number of successful extensions: 2472
Number of sequences better than 10.0: 222
Number of HSP's gapped: 2455
Number of HSP's successfully gapped: 239
Length of query: 119
Length of database: 53,481,399
Length adjustment: 88
Effective length of query: 31
Effective length of database: 43,390,791
Effective search space: 1345114521
Effective search space used: 1345114521
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 59 (27.3 bits)