Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0B026007.353ON27927914930.0
KAFR0L015007.353ON2792816271e-80
Skud_12.2637.353ON2742815541e-69
Suva_10.2947.353ON2752805541e-69
NCAS0E028507.353ON2812895523e-69
TDEL0C019507.353ON2732835401e-67
CAGL0A03993g7.353ON2722815375e-67
YLR199C (PBA1)7.353ON2762855375e-67
Kpol_530.287.353ON2742845332e-66
Smik_12.2587.353ON2742815262e-65
TPHA0F030007.353ON2822905176e-64
NDAI0E044507.353ON2212254752e-58
ZYRO0F11770g7.353ON2722824774e-58
TBLA0E020707.353ON2522874261e-50
KLTH0H01188g7.353ON2672873974e-46
SAKL0F11440g7.353ON2722863922e-45
Kwal_56.246507.353ON2522712796e-29
KLLA0D12276g7.353ON2582802527e-25
Ecym_47207.353ON2611751871e-15
ACL145W7.353ON2341571533e-11
TBLA0E028705.576ON341485760.50
AGR100W8.250ON47584740.81
KAFR0G023306.103ON34271711.7
KLTH0E07062g8.126ON149657712.2
TDEL0C044902.232ON250685684.7
KAFR0A051106.30ON12299636.1
NCAS0D021206.30ON12298636.7
Kpol_1037.216.30ON120101629.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0B02600
         (279 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0B02600 Chr2 complement(505952..506785,506899..506904) [840 ...   579   0.0  
KAFR0L01500 Chr12 (275836..275841,275908..276741) [840 bp, 279 a...   246   1e-80
Skud_12.263 Chr12 complement(494506..495168,495169..495330) [825...   218   1e-69
Suva_10.294 Chr10 complement(520639..521304,521305..521466) [828...   218   1e-69
NCAS0E02850 Chr5 complement(560339..561178,561273..561278) [846 ...   217   3e-69
TDEL0C01950 Chr3 complement(342242..343057,343116..343121) [822 ...   212   1e-67
CAGL0A03993g Chr1 (400841..400846,400992..401804) [819 bp, 272 a...   211   5e-67
YLR199C Chr12 complement(547853..548677,548764..548769) [831 bp,...   211   5e-67
Kpol_530.28 s530 complement(73093..73911,74024..74029) [825 bp, ...   209   2e-66
Smik_12.258 Chr12 complement(494861..495523,495524..495685) [825...   207   2e-65
TPHA0F03000 Chr6 (657195..657200,657311..658153) [849 bp, 282 aa...   203   6e-64
NDAI0E04450 Chr5 complement(1004080..1004745) [666 bp, 221 aa] {...   187   2e-58
ZYRO0F11770g Chr6 (961232..961237,961318..962130) [819 bp, 272 a...   188   4e-58
TBLA0E02070 Chr5 (504410..504415,504472..505224) [759 bp, 252 aa...   168   1e-50
KLTH0H01188g Chr8 complement(118222..119019,119088..119093) [804...   157   4e-46
SAKL0F11440g Chr6 (888319..888324,888382..889194) [819 bp, 272 a...   155   2e-45
Kwal_56.24650 s56 (1089568..1090326) [759 bp, 252 aa] {ON} YLR19...   112   6e-29
KLLA0D12276g Chr4 complement(1046970..1047737,1047816..1047824) ...   101   7e-25
Ecym_4720 Chr4 complement(1412286..1413065,1413130..1413135) [78...    77   1e-15
ACL145W Chr3 (93920..94624) [705 bp, 234 aa] {ON} Syntenic homol...    64   3e-11
TBLA0E02870 Chr5 complement(707480..717724) [10245 bp, 3414 aa] ...    34   0.50 
AGR100W Chr7 (925413..926840) [1428 bp, 475 aa] {ON} Syntenic ho...    33   0.81 
KAFR0G02330 Chr7 (485592..486620) [1029 bp, 342 aa] {ON} Anc_6.1...    32   1.7  
KLTH0E07062g Chr5 complement(648999..653489) [4491 bp, 1496 aa] ...    32   2.2  
TDEL0C04490 Chr3 complement(801727..809247) [7521 bp, 2506 aa] {...    31   4.7  
KAFR0A05110 Chr1 complement(1014087..1014455) [369 bp, 122 aa] {...    29   6.1  
NCAS0D02120 Chr4 complement(393640..394008) [369 bp, 122 aa] {ON...    29   6.7  
Kpol_1037.21 s1037 complement(44216..44578) [363 bp, 120 aa] {ON...    28   9.9  

>KNAG0B02600 Chr2 complement(505952..506785,506899..506904) [840 bp,
           279 aa] {ON} Anc_7.353 YLR199C
          Length = 279

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/279 (100%), Positives = 279/279 (100%)

Query: 1   MLFKHWNEFVEPRHHLDAPVMVPNQESLQALPLPTVTVPAGFDWGKVRDCDPDHKIMNPL 60
           MLFKHWNEFVEPRHHLDAPVMVPNQESLQALPLPTVTVPAGFDWGKVRDCDPDHKIMNPL
Sbjct: 1   MLFKHWNEFVEPRHHLDAPVMVPNQESLQALPLPTVTVPAGFDWGKVRDCDPDHKIMNPL 60

Query: 61  FNTSHTHAMTRGELVTSLQLNESVVSQAATELSQHWDYRENFPNEFDPASDTREDTKSIV 120
           FNTSHTHAMTRGELVTSLQLNESVVSQAATELSQHWDYRENFPNEFDPASDTREDTKSIV
Sbjct: 61  FNTSHTHAMTRGELVTSLQLNESVVSQAATELSQHWDYRENFPNEFDPASDTREDTKSIV 120

Query: 121 LRLPIVELNGMNTLLISVDENFLKVSPIFTNVVARKLRTLLNTQTKILLVGSSDKIYSTK 180
           LRLPIVELNGMNTLLISVDENFLKVSPIFTNVVARKLRTLLNTQTKILLVGSSDKIYSTK
Sbjct: 121 LRLPIVELNGMNTLLISVDENFLKVSPIFTNVVARKLRTLLNTQTKILLVGSSDKIYSTK 180

Query: 181 MVSLNECTLQPPEFITGFLGGMIDELVKNRFSNFKGFIVQSEGPTGFEKLSLESMDELID 240
           MVSLNECTLQPPEFITGFLGGMIDELVKNRFSNFKGFIVQSEGPTGFEKLSLESMDELID
Sbjct: 181 MVSLNECTLQPPEFITGFLGGMIDELVKNRFSNFKGFIVQSEGPTGFEKLSLESMDELID 240

Query: 241 FIIDEWSSYNINADAFRENCHKLWKLDGAAMSAQSGLYI 279
           FIIDEWSSYNINADAFRENCHKLWKLDGAAMSAQSGLYI
Sbjct: 241 FIIDEWSSYNINADAFRENCHKLWKLDGAAMSAQSGLYI 279

>KAFR0L01500 Chr12 (275836..275841,275908..276741) [840 bp, 279 aa]
           {ON} Anc_7.353 YLR199C
          Length = 279

 Score =  246 bits (627), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 127/281 (45%), Positives = 183/281 (65%), Gaps = 4/281 (1%)

Query: 1   MLFKHWNEFVEPRHHLDAPVMVPNQESLQALPLPTVTVPAGFDWGKVRDCDPDHKIMNPL 60
           MLFK WNE VEPRH LD+PV++ N+ESLQ  PLP V +P+  ++   +      K+MNPL
Sbjct: 1   MLFKQWNELVEPRHQLDSPVILKNEESLQESPLPQVEIPSTVNFSDYKKIILTTKVMNPL 60

Query: 61  FNTSHTHAMTRGELVTSLQLNESVVSQAATELSQHWDYRENFPNEFDPASDTREDTKSIV 120
           F  +       G + T+L L ES ++         WD+ ENFPNEF+P+ ++     +  
Sbjct: 61  FPKNLLKMEDLGNIETTLLLTESKMTDDEQN-HYSWDFNENFPNEFNPSMESATGNNNFS 119

Query: 121 LRLPIVELNGMNTLLISVDENFLKVSPIFTNVVARKLRTLLNT-QTKILLVGSSDKIYST 179
            + PI  ++  +TLLIS+DENFLKVSPIF N++++KL + +N  ++ ILL+G+SDKI + 
Sbjct: 120 FKFPIYRISSTDTLLISIDENFLKVSPIFLNLISKKLTSSINNDKSSILLLGASDKISNN 179

Query: 180 -KMVSLNECTLQPPEFITGFLGGMIDELVKNRFSNFKGFIVQSEGPTGFEKLSLESMDEL 238
            K V+   C++ PPEFITGF+G ++ EL++    NF+  IV SEGP GFEKLSL +M+EL
Sbjct: 180 IKTVTNKNCSINPPEFITGFIGSLLYELLEIGTDNFECIIVPSEGPIGFEKLSLSTMEEL 239

Query: 239 IDFIIDEWSSYNINADAFRENCHKLWKLDGAAMSAQSGLYI 279
           I+    E  S  ++   + + CH+ WKL+G+A S QSGLYI
Sbjct: 240 INQFFHELGS-QMDFKTYYDECHRNWKLEGSATSTQSGLYI 279

>Skud_12.263 Chr12 complement(494506..495168,495169..495330) [825
           bp, 274 aa] {ON} YLR199C (REAL)
          Length = 274

 Score =  218 bits (554), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 116/281 (41%), Positives = 172/281 (61%), Gaps = 11/281 (3%)

Query: 3   FKHWNEFVEPRHHLDAPVMVPNQESLQALPLPTVTVPAGFDWGKVRDCDPDHKIMNPLFN 62
           FK WN+  EPRH LD P +  N +SL+  P+P V +P   +  +        KIMNPLF 
Sbjct: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEFCPIPRVELPQDLNVSQYSTVIITTKIMNPLFP 60

Query: 63  TSHTHAMTRGELVTSLQLNESVVSQAATELSQHWDYRENFPNEFDPASDTREDTKSIV-L 121
            +     + GE+ +SL +  S  +Q+    S  W+Y ENFPNE DP S++    ++    
Sbjct: 61  KNLLQLTSIGEVKSSLTVKNSSPTQSTDAYS--WNYDENFPNEVDPISESETSKETQYNF 118

Query: 122 RLPIVELNGMNTLLISVDENFLKVSPIFTNVVARKLRT-LLNTQTKILLVGSSDKIYSTK 180
             PI       TLL S++ENF+ +SPIF N+++R + + L+ T   I+++GSSD+I + K
Sbjct: 119 SFPIYSFG--ETLLFSIEENFINISPIFGNMISRSIVSQLIKTSPDIIVIGSSDRISNMK 176

Query: 181 MVSLNECTLQPPEFITGFLGGMIDELV--KNRFSNFKGFIVQSEGPTGFEKLSLESMDEL 238
            ++ +ECTLQPPEFITGF+G ++ +L+  +N+  NFK  IV SEGP GFEK+SL  M  L
Sbjct: 177 KMTKSECTLQPPEFITGFIGSVLTQLIIGENKGMNFKCLIVPSEGPNGFEKISLSDMGSL 236

Query: 239 IDFIIDEWSSYNINADAFRENCHKLWKLDGAAMSAQSGLYI 279
           ID +  +W  +  +   + + C++LW+ D AA+ AQSGLYI
Sbjct: 237 ID-VCSQWLGF--DHSKYSQECYRLWRCDSAAIGAQSGLYI 274

>Suva_10.294 Chr10 complement(520639..521304,521305..521466) [828
           bp, 275 aa] {ON} YLR199C (REAL)
          Length = 275

 Score =  218 bits (554), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 112/280 (40%), Positives = 168/280 (60%), Gaps = 8/280 (2%)

Query: 3   FKHWNEFVEPRHHLDAPVMVPNQESLQALPLPTVTVPAGFDWGKVRDCDPDHKIMNPLFN 62
           FK WN+  EPRH LD P +  N +SL+  P+P V +P   D  +        KIMNPLF 
Sbjct: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEVCPVPKVELPQDLDVSQYSRVVITTKIMNPLFP 60

Query: 63  TSHTHAMTRGELVTSLQLNESVVSQAATELSQHWDYRENFPNEFDPASDTREDTKSIVLR 122
            +    ++ GE+ TSL + E    Q     +  W+Y ENFPNE +P S T    +  +  
Sbjct: 61  KNLLKLISIGEIKTSLMVKELNPIQPTD--AHSWNYDENFPNEINPNSRTATSNEETLYN 118

Query: 123 LPIVELNGMNTLLISVDENFLKVSPIFTNVVARKLRT-LLNTQTKILLVGSSDKIYSTKM 181
                 +   TLL S++ENF+ +SPIF N+++R + + L+ T   ++++G+SD+I + K+
Sbjct: 119 FSFPIYSFGKTLLFSIEENFINISPIFGNMISRSIASQLVKTSPDVIIIGTSDRISNMKI 178

Query: 182 VSLNECTLQPPEFITGFLGGMIDELV--KNRFSNFKGFIVQSEGPTGFEKLSLESMDELI 239
           ++ +ECTLQPPEF+TGF+G ++ +L+   N+   FK  +V SEGP GFEK SL  M  LI
Sbjct: 179 MTEDECTLQPPEFVTGFIGSVLTQLITGANKGMKFKCLVVPSEGPNGFEKFSLSDMGSLI 238

Query: 240 DFIIDEWSSYNINADAFRENCHKLWKLDGAAMSAQSGLYI 279
           D +  +W  + ++   + E CH+LW+ D AA+ AQSGLYI
Sbjct: 239 D-VCSQW--FGLDHSKYSEECHRLWRCDSAAIGAQSGLYI 275

>NCAS0E02850 Chr5 complement(560339..561178,561273..561278) [846 bp,
           281 aa] {ON} Anc_7.353 YLR199C
          Length = 281

 Score =  217 bits (552), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 118/289 (40%), Positives = 172/289 (59%), Gaps = 18/289 (6%)

Query: 1   MLFKHWNEFVEPRHHLDAPVMVPNQESLQALPLPTVTVPAGFDWGKVRDCDPDHKIMNPL 60
           MLFK WNEF+EPRH LD P++  N ESLQA P+P V  P+   +          ++MNPL
Sbjct: 1   MLFKQWNEFIEPRHQLDFPILSKNDESLQASPIPKVLFPS-IAFQNYEKIIITTQLMNPL 59

Query: 61  FNTSHTHAMTRGELVTSLQLNESVVSQAATELSQHWDYRENFPNEFDPASDTREDTK-SI 119
           F      +   G++ T L L E     A  E    W++ ENFPNEFDP ++ RE+ + + 
Sbjct: 60  FPEKLIESKNLGKIETQLTLTED--QNAVNEDGHSWNFNENFPNEFDPDNEDRENQQQAF 117

Query: 120 VLRLPIVELNGMNTLLISVDENFLKVSPIFTNVVARKLRTLLNTQTKILLVGSSDKIYST 179
               P+  +  +  ++IS+ +NFLK+SPIF+N++++KL   L    K L++GSSD+I S 
Sbjct: 118 NFEFPVFAVGKV--VIISIQDNFLKISPIFSNIISKKLIEQLPRTIKPLILGSSDRIASV 175

Query: 180 KMVSLNECTLQPPEFITGFLGGMIDELV---------KNRFSNFKGFIVQSEGPTGFEKL 230
           K ++ + CTL PPEFITGF+  ++ EL          +N+F  F   +V SEGP GFEKL
Sbjct: 176 KEINDHTCTLVPPEFITGFIASLLTELTIHNETLQNGENKFQ-FDAILVPSEGPLGFEKL 234

Query: 231 SLESMDELIDFIIDEWSSYNINADAFRENCHKLWKLDGAAMSAQSGLYI 279
           +L  + +LID   +EW   N++   + E  ++ WKL G+ + AQSGLYI
Sbjct: 235 NLTVIQDLIDLFKEEWP--NLDPKVYAEESYRNWKLAGSVLGAQSGLYI 281

>TDEL0C01950 Chr3 complement(342242..343057,343116..343121) [822 bp,
           273 aa] {ON} Anc_7.353 YLR199C
          Length = 273

 Score =  212 bits (540), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 123/283 (43%), Positives = 168/283 (59%), Gaps = 14/283 (4%)

Query: 1   MLFKHWNEFVEPRHHLDAPVMVPNQESLQALPLPTVTVPAGFDWGKVRDCDPDHKIMNPL 60
           MLFK WNE  EPRH LD+PV++ N+ +LQ   LP VT+P   D            IMNPL
Sbjct: 1   MLFKQWNEIAEPRHQLDSPVIIANEGTLQTSVLPQVTLPP-IDLQNFSRVILTSAIMNPL 59

Query: 61  FNTSHTHAMTRGELVTSLQLNESVVSQAATELSQH-WDYRENFPNEFDPASDTREDTKSI 119
           F      +   G+L   L L+     + A +   H W++ ENFPNE DPA    E +K+ 
Sbjct: 60  FPEKLLKSTILGDLKVILDLSS---GKMALDHPMHSWNFDENFPNEVDPAYVVEERSKTF 116

Query: 120 VLRLPIVELNGMNTLLISVDENFLKVSPIFTNVVARKLRTLLNT---QTKILLVGSSDKI 176
            L  PIV      TLLISV ENFLK SPIF N +A+ +   L     + +++++G+SD+I
Sbjct: 117 ELCAPIVSFG--RTLLISVKENFLKTSPIFLNQIAKSVVCKLAQGAFEGEVVVLGTSDQI 174

Query: 177 YSTKMVSLNECTLQPPEFITGFLGGMIDELVKNRFSNFKGFIVQSEGPTGFEKLSLESMD 236
              K VS  E TL PPEF+T F+G +I +L++     F+G I  SEGP GFEKL+L +M+
Sbjct: 175 TELKPVSDKETTLNPPEFVTSFVGAVITQLIEKSLP-FQGLIAPSEGPVGFEKLNLVTME 233

Query: 237 ELIDFIIDEWSSYNINADAFRENCHKLWKLDGAAMSAQSGLYI 279
           ELI  +  +W   + N + +R  C++ W+LDGAA+ AQSGLYI
Sbjct: 234 ELIT-LCHQW--VDSNKEIYRNECYRRWRLDGAALGAQSGLYI 273

>CAGL0A03993g Chr1 (400841..400846,400992..401804) [819 bp, 272 aa]
           {ON} similar to uniprot|Q05778 Saccharomyces cerevisiae
           YLR199c
          Length = 272

 Score =  211 bits (537), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 119/281 (42%), Positives = 168/281 (59%), Gaps = 11/281 (3%)

Query: 1   MLFKHWNEFVEPRHHLDAPVMVPNQESLQALPLPTVTVPAG-FDWGKVRDCDPDHKIMNP 59
           MLFK WNE  EPR+HLDAP +V N ESLQ LPLP V +P   F+ G V+      K M+ 
Sbjct: 1   MLFKQWNELSEPRNHLDAPNLVNNTESLQLLPLPDVHIPDELFEGGNVKRVILTTKTMDT 60

Query: 60  LFNTSHTHAMTR-GELVTSLQLNESVVSQAATELSQHWDYRENFPNEFDPASDTREDTKS 118
            F    T  + +  ++  SL++ +++ +  AT     WD+ ENFPNE +P  D  E+ ++
Sbjct: 61  FFLLDKTMKVKKLADITCSLEIPKNLQTHEAT---HTWDFGENFPNEVEPLQD--EEQRT 115

Query: 119 IVLRLPIVELNGMNTLLISVDENFLKVSPIFTNVVARKLRTLLNTQTKILLVGSSDKIYS 178
             LR PI  L    TL +S+DENFL VSPIFT  ++  +   LN   +I+++G SD+I  
Sbjct: 116 FSLRFPIYLLEDQ-TLYVSIDENFLTVSPIFTAQISDVISKKLNRGHEIVILGCSDRIED 174

Query: 179 TKMVSLNECTLQPPEFITGFLGGMIDELVKNRFSNFKGFIVQSEGPTGFEKLSLESMDEL 238
           TK+ + N C+L PPEF+TGFLG ++ +L K     F   I  SEGP GFEKLS  ++D +
Sbjct: 175 TKICTNNNCSLVPPEFVTGFLGSLMSDLTKTNDQLFTAAIFPSEGPQGFEKLSSTTVDSI 234

Query: 239 IDFIIDEWSSYNINADAFRENCHKLWKLDGAAMSAQSGLYI 279
           IDF     S+   +   + E C+K WK + ++  AQSGLY+
Sbjct: 235 IDFCSQLVST---DKSRYTEECYKRWKRNASSNGAQSGLYL 272

>YLR199C Chr12 complement(547853..548677,548764..548769) [831 bp,
           276 aa] {ON}  PBA1Protein involved in 20S proteasome
           assembly; forms a heterodimer with Add66p that binds to
           proteasome precursors; similar to human PAC1 constituent
           of the PAC1-PAC2 complex involved in proteasome assembly
          Length = 276

 Score =  211 bits (537), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 117/285 (41%), Positives = 168/285 (58%), Gaps = 15/285 (5%)

Query: 1   MLFKHWNEFVEPRHHLDAPVMVPNQESLQALPLPTVTVPAGFDWGKVRDCDPDHKIMNPL 60
           MLFK WN+  EP+H LD P +  N +SL+  P+P V  P   D  +        KIMNPL
Sbjct: 1   MLFKQWNDLPEPKHLLDLPEISKNLQSLEVCPVPKVEFPQDLDVPQYSTAVITTKIMNPL 60

Query: 61  FNTSHTHAMTRGELVTSLQLNESVVSQAATELSQHWDYRENFPNEFDPASDTREDTKSIV 120
           F  +     + GE+ T+L +    + Q++ + S  W+Y ENFPNE DP  D + DT    
Sbjct: 61  FPKNLLQLTSIGEIKTTLTVKSPSLPQSSGKHS--WNYDENFPNEVDP--DQKNDTADET 116

Query: 121 L---RLPIVELNGMNTLLISVDENFLKVSPIFTNVVARKL-RTLLNTQTKILLVGSSDKI 176
           +     PI       TLL S++ENF+ +SPIF N+++R +   L      I+++G+SDKI
Sbjct: 117 VYGFSFPIYSFG--KTLLFSMEENFISISPIFGNMISRSIISQLAQFSPDIIVIGTSDKI 174

Query: 177 YSTKMVSLNECTLQPPEFITGFLGGMIDELV--KNRFSNFKGFIVQSEGPTGFEKLSLES 234
            S K+++ NECTLQPPEFITGF+G ++ +L+   ++   FK  +  SEGP GFEKLSL  
Sbjct: 175 ASMKVMTENECTLQPPEFITGFIGSVLTQLIVGPSKGLKFKCLVAPSEGPNGFEKLSLSD 234

Query: 235 MDELIDFIIDEWSSYNINADAFRENCHKLWKLDGAAMSAQSGLYI 279
           M  L+D +  +W  +      + E C++LW+ D AA+ AQSGLYI
Sbjct: 235 MGSLVD-LCGQWLGF--EPSRYSEECYRLWRCDSAAIGAQSGLYI 276

>Kpol_530.28 s530 complement(73093..73911,74024..74029) [825 bp, 274
           aa] {ON} complement(73093..73911,74024..74029) [825 nt,
           275 aa]
          Length = 274

 Score =  209 bits (533), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 114/284 (40%), Positives = 174/284 (61%), Gaps = 15/284 (5%)

Query: 1   MLFKHWNEFVEPRHHLDAPVMVPNQESLQALPLPTVTVPAGFDWGKVRDCDPDHKIMNPL 60
           MLFK WNEFV PRH LD+P++  N +SLQ L LP V +P   D  K ++     KIM+PL
Sbjct: 1   MLFKQWNEFVAPRHELDSPIIARNDDSLQLLSLPEVHMPET-DLSKYKNVVLTTKIMDPL 59

Query: 61  FNTSHTHAMTRGELVTSLQLNESVVSQAATELSQH-WDYRENFPNEFDPASDTREDTKSI 119
           F +    A    ++ T+L+++ES   Q   E   H WDY ENFPNE     D+  + + +
Sbjct: 60  FPSKLLSAEKIADITTTLKIDES---QDVGESENHSWDYEENFPNEVGFKRDSN-NRRLL 115

Query: 120 VLRLPIVELNGMNTLLISVDENFLKVSPIFTNVVARKLRTLL----NTQTKILLVGSSDK 175
               PI      +T++I ++ENF+K+S IF+NV+A ++   L    N     + +G+SD+
Sbjct: 116 SFSSPIFAFK--DTIIIMIEENFIKMSAIFSNVIAEQVINHLLINGNPDLNFIAIGTSDR 173

Query: 176 IYSTKMVSLNECTLQPPEFITGFLGGMIDELVKNRFSNFKGFIVQSEGPTGFEKLSLESM 235
           I + K ++ + C+L+PPEF+TGF+G ++ +L+    + F G +  SEGP GFEK++L+ +
Sbjct: 174 ILNIKKLTQDHCSLEPPEFVTGFIGSILTQLISKEVNVFTGILAPSEGPIGFEKMTLDVI 233

Query: 236 DELIDFIIDEWSSYNINADAFRENCHKLWKLDGAAMSAQSGLYI 279
            ELID I  E    +I +  +  +C ++W+LDGAA+ AQSGLYI
Sbjct: 234 KELID-ICQEL--LDIKSTEYSVDCQRMWRLDGAAIGAQSGLYI 274

>Smik_12.258 Chr12 complement(494861..495523,495524..495685) [825
           bp, 274 aa] {ON} YLR199C (REAL)
          Length = 274

 Score =  207 bits (526), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 113/281 (40%), Positives = 168/281 (59%), Gaps = 11/281 (3%)

Query: 3   FKHWNEFVEPRHHLDAPVMVPNQESLQALPLPTVTVPAGFDWGKVRDCDPDHKIMNPLFN 62
           FK WNE  EPRH LD P +  N  SL+A P+P V +P   D  +        KIMNPLF 
Sbjct: 1   FKQWNEIPEPRHLLDFPEISKNLHSLEACPVPKVELPQDLDVSQYSTVVITTKIMNPLFP 60

Query: 63  TSHTHAMTRGELVTSLQLNESVVSQAATELSQHWDYRENFPNEFDPA-SDTREDTKSIVL 121
            +    +  G++ T+L +  S   Q+  + S  W++ ENFPNE DP       D      
Sbjct: 61  KNLLQLIAVGKIETTLTVVNSGSVQSTGDHS--WNFDENFPNEVDPVPRGAMSDETKYDF 118

Query: 122 RLPIVELNGMNTLLISVDENFLKVSPIFTNVVARKLRT-LLNTQTKILLVGSSDKIYSTK 180
             PI       TLL S++ENFL +SPIF N+++R + + L+ +  +I+++G+SDKI + K
Sbjct: 119 SFPIYSFG--KTLLFSIEENFLSISPIFGNMISRCIVSRLVESSPEIIVIGTSDKIANMK 176

Query: 181 MVSLNECTLQPPEFITGFLGGMIDELVK--NRFSNFKGFIVQSEGPTGFEKLSLESMDEL 238
           +++ +EC+L+PPEFITGF+G ++ +LV   N+   FK  +V SEGP G+EKLSL  M  L
Sbjct: 177 VMTKDECSLKPPEFITGFIGSVLTQLVGGVNKGMKFKCLVVPSEGPNGYEKLSLSDMGSL 236

Query: 239 IDFIIDEWSSYNINADAFRENCHKLWKLDGAAMSAQSGLYI 279
           +  +  +W  +  +  ++ E C++LW+ D AA+ AQSGLYI
Sbjct: 237 VS-LCGQWLGF--DHSSYHEECYRLWRCDSAAIGAQSGLYI 274

>TPHA0F03000 Chr6 (657195..657200,657311..658153) [849 bp, 282 aa]
           {ON} Anc_7.353 YLR199C
          Length = 282

 Score =  203 bits (517), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 118/290 (40%), Positives = 166/290 (57%), Gaps = 19/290 (6%)

Query: 1   MLFKHWNEFVEPRHHLDAPVMVPNQESLQALPLPTVTVPAGFDWGKVRDCDPDHKIMNPL 60
           MLFK WN+  EPRH L +P +  N ESLQ   +P V++     +    +     K MN L
Sbjct: 1   MLFKQWNDLAEPRHQLMSPSLSTNIESLQLQNIPEVSM-TNLKYEDFENVIVTTKTMNAL 59

Query: 61  FNTSHTHAMTRGELVTSLQLNESVVSQAATELSQHWDYRENFPNEFDPASDT-------R 113
           F     +    GEL +SL LNE+   +  T     WDY+ENFPNE D  S          
Sbjct: 60  FPNKTLNLTKVGELSSSLVLNEN--EKVPTAEHYSWDYKENFPNEVDIYSQEAIESEIGS 117

Query: 114 EDTKSIVLRLPIVELNGMNTLLISVDENFLKVSPIFTNVVARKLR----TLLNTQTKILL 169
            ++K    ++PI+  +   TLLIS++ENF+K+SPIF+N+ A K+     T  N+   IL 
Sbjct: 118 NESKKYNFQIPIMAYD--KTLLISIEENFIKMSPIFSNLTAEKILKVILTFCNSNIGILT 175

Query: 170 VGSSDKIYSTKMVSLNECTLQPPEFITGFLGGMIDELVKNRFSNFKGFIVQSEGPTGFEK 229
           +G+SD++ + + ++    TL  PEFITGF+G  I +LV     N+K  IV SEGP GFEK
Sbjct: 176 LGTSDRVAAIRKLTPENSTLVAPEFITGFVGSFISQLVILEVPNYKAVIVPSEGPIGFEK 235

Query: 230 LSLESMDELIDFIIDEWSSYNINADAFRENCHKLWKLDGAAMSAQSGLYI 279
           LS+E++ ELID   +   + NIN   +    H+LWK+ G+AM AQ+GLYI
Sbjct: 236 LSIETISELIDICKE---NLNINDPKYSNESHRLWKVAGSAMGAQTGLYI 282

>NDAI0E04450 Chr5 complement(1004080..1004745) [666 bp, 221 aa] {ON}
           Anc_7.353 YLR199C
          Length = 221

 Score =  187 bits (475), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 101/225 (44%), Positives = 141/225 (62%), Gaps = 6/225 (2%)

Query: 57  MNPLFNTSHTHAMTRGELVTSLQLNESVVSQAATELSQHWDYRENFPNEFDPA-SDTRED 115
           MNPLF       ++   + T+L LN   +     E    W+Y ENFPNEFDP+  D +  
Sbjct: 1   MNPLFPEDLLPLVSVSNISTTLTLNPDQL--MGNEGKHSWNYNENFPNEFDPSDKDMKSS 58

Query: 116 TKSIVLRLPIVELNGMNTLLISVDENFLKVSPIFTNVVARKLRTLLNTQTKILLVGSSDK 175
            KS     PI  ++   TL+IS+ ENFLK+SPIF+NV+++ L   L    +IL++G+SD+
Sbjct: 59  EKSYDFNFPIFAID--RTLVISIQENFLKISPIFSNVISQTLVQALPLNKEILILGTSDR 116

Query: 176 IYSTKMVSLNECTLQPPEFITGFLGGMIDEL-VKNRFSNFKGFIVQSEGPTGFEKLSLES 234
           +   + +S    TL+PPEF+TGF+G +I EL + N   NF   IV SEGPTGFEKL+L  
Sbjct: 117 VAVMRKISNEIDTLEPPEFVTGFIGSLITELNLHNAKYNFDAIIVPSEGPTGFEKLNLTI 176

Query: 235 MDELIDFIIDEWSSYNINADAFRENCHKLWKLDGAAMSAQSGLYI 279
           M +LID   +EW+  NI++  + E C++ WKL GAA+ AQSGLYI
Sbjct: 177 MQDLIDIFKNEWNYLNIDSKVYTEQCYRHWKLAGAAIGAQSGLYI 221

>ZYRO0F11770g Chr6 (961232..961237,961318..962130) [819 bp, 272 aa]
           {ON} weakly similar to uniprot|Q05778 Saccharomyces
           cerevisiae YLR199C Hypothetical ORF
          Length = 272

 Score =  188 bits (477), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 114/282 (40%), Positives = 164/282 (58%), Gaps = 13/282 (4%)

Query: 1   MLFKHWNEFVEPRHHLDAPVMVP-NQESLQALPLPTVTVPAGFDWGKVRDCDPDHKIMNP 59
           MLFK WNE  EPRHHLD+P+ V  + ESLQ   LP V +P   +W K         IM+P
Sbjct: 1   MLFKQWNEIAEPRHHLDSPLAVGIDDESLQKGSLPLVELP-NINWNKFHKIFLTTGIMDP 59

Query: 60  LFNTSHTHAMTRGELVTSLQLNESVVSQAATELSQHWDYRENFPNEFDPASDTREDTKSI 119
           LF       M  G++ T+L ++ +   Q        W++ ENFPNE +       D    
Sbjct: 60  LFPKELLGVMKLGDIRTTLTIDRN---QQHENGEYSWNFEENFPNEVNLNGGQDNDDGQS 116

Query: 120 VLRLPIVELNGMNTLLISVDENFLKVSPIFTNVVARKLRTLLN-TQTKILLVGSSDKIYS 178
           +  +  VE  G + LL+ V ENFLKVSPI  N +A+ L ++ + T  ++ ++G+SD+I  
Sbjct: 117 LTFVTTVEAFG-DCLLVGVKENFLKVSPIIYNRIAQVLLSVFDGTHHELKVLGTSDRITE 175

Query: 179 TKMVSLNECTLQPPEFITGFLGGMIDEL-VKNRFSNFKGFIVQSEGPTGFEKLSLESMDE 237
            K +S     LQPPEF+TGF+G ++ +L VKN    F+GFI  SEG  GFEK+S+ +M E
Sbjct: 176 LKSISHLRSDLQPPEFVTGFIGSILTQLTVKN--IPFEGFIAPSEGAIGFEKMSMNTMPE 233

Query: 238 LIDFIIDEWSSYNINADAFRENCHKLWKLDGAAMSAQSGLYI 279
           LID I  +W   N N++ +R  C++ W+LD  A+ + SGLY+
Sbjct: 234 LID-ICGQW--INGNSEKYRSECYRHWRLDSGAVGSLSGLYV 272

>TBLA0E02070 Chr5 (504410..504415,504472..505224) [759 bp, 252 aa]
           {ON} Anc_7.353 YLR199C
          Length = 252

 Score =  168 bits (426), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 106/287 (36%), Positives = 153/287 (53%), Gaps = 43/287 (14%)

Query: 1   MLFKHWNEFVEPRHHLDAPVMVP----NQESLQALPLPTVTVPAGF-DWGKVRDCDPDHK 55
           MLFK W+E+ EPRHH+D+   +P    N +SLQ  PLP V VP    D           +
Sbjct: 1   MLFKQWDEWAEPRHHVDSLAAIPPNHRNADSLQEAPLPLVKVPDTLQDITIYEQIIVATR 60

Query: 56  IMNPLFNTSHTHAMTRGELVTSLQLNESVVSQAATELSQHWDYRENFPNEFDPASDTRED 115
           ++ PLF     +  + G +   ++LN   VS+A   L                       
Sbjct: 61  VLMPLFPKEILNFTSLGNI--EVKLN---VSEATAHL----------------------- 92

Query: 116 TKSIVLRLPIVELNGMNTLLISVDENFLKVSPIFTNVVARKLRTLLNTQTKILLVGSSDK 175
                ++ PI + N   TL+I VDEN ++V PIF NV+++ + T+   Q K L+ G+SD+
Sbjct: 93  -----VKTPIYKCNE-RTLIIIVDENVMQVCPIFLNVISKTICTMFGNQLKFLIFGTSDR 146

Query: 176 IYSTKMVSLNECTLQPPEFITGFLGGMIDELVKNRFSNFKGFIVQSEGPTGFEKLSLESM 235
           I   K ++   CTL PPEFITGF+G +I +L     S F GF+V SEGP GFEKL+LE+M
Sbjct: 147 ISKIKTINHLNCTLIPPEFITGFIGSIISDLSLTANSKFNGFLVPSEGPLGFEKLTLETM 206

Query: 236 DELID---FIIDEWSSYNINADAFRENCHKLWKLDGAAMSAQSGLYI 279
           + LI     I+    S N+N + + + C++ W+L G  +  QSGLYI
Sbjct: 207 EFLIKEGGRIVKTIDS-NLNLELYEKECYRNWRLTGTTIGTQSGLYI 252

>KLTH0H01188g Chr8 complement(118222..119019,119088..119093) [804
           bp, 267 aa] {ON} similar to uniprot|Q05778 Saccharomyces
           cerevisiae YLR199C Hypothetical ORF
          Length = 267

 Score =  157 bits (397), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 102/287 (35%), Positives = 153/287 (53%), Gaps = 28/287 (9%)

Query: 1   MLFKHWNEFVEPRHHLDAPVMV-PNQESLQALPLPTVTVPAGFDWGKVRDCDPDHKIMNP 59
           MLFK WNE+ EPRHHLDAP+    + +SLQ  PLP V +    D    +       I+  
Sbjct: 1   MLFKQWNEYSEPRHHLDAPLEENTDLDSLQPAPLPEVMLEKPIDTAGFKRA----FIVTN 56

Query: 60  LFNTSHTHAMTRGELVTSLQLNESVVSQAATELSQHWDYRENFPNEFDPASDTREDTKSI 119
           +F +     + R E ++S      VV        QH  YRE++  +     D+R   ++ 
Sbjct: 57  IFRSLFEDRLARAEQISSF-----VVVWQTKGREQHL-YREDYQTQ----EDSRSTDETK 106

Query: 120 VLRLPIVELNGMNTLLISVDENFLKVSPIFTNVVARKLRTLLNTQTKILLVGSSDKIYST 179
            L  P+ +L+   TL I V E+FL V PI  N+++R++  L     ++LL GSSD++   
Sbjct: 107 RLEFPVHKLDD-GTLFICVREDFLHVPPISINLLSREIAKLCGG-LEVLLFGSSDRVERV 164

Query: 180 KMVSLNECT------LQPPEFITGFLGGMIDELVKNRFSNFKGFIVQSEGPTGFEKLSLE 233
           K V            L PPE IT F   ++ +L+ N+   F G++  SEGP+G+EKLS+E
Sbjct: 165 KYVGFPGNVGKGLPLLTPPELITNFTASIMTQLLSNKV-RFDGYVAPSEGPSGYEKLSME 223

Query: 234 SMDELIDFIIDEWSSYNI-NADAFRENCHKLWKLDGAAMSAQSGLYI 279
           +MD LID     WS     N + + ++CH+ W+L+G  M AQ+GLY+
Sbjct: 224 TMDLLIDLC---WSEVRFGNREDYVKSCHRNWRLNGTVMGAQTGLYL 267

>SAKL0F11440g Chr6 (888319..888324,888382..889194) [819 bp, 272 aa]
           {ON} similar to uniprot|Q05778 Saccharomyces cerevisiae
           YLR199c
          Length = 272

 Score =  155 bits (392), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 100/286 (34%), Positives = 153/286 (53%), Gaps = 21/286 (7%)

Query: 1   MLFKHWNEFVEPRHHLDAPVMVPN--QESLQALPLPTVTVPAGFDWGKVRDCDPDHKIMN 58
           MLFKHWNE  EPRH LD P   PN   ESLQ  PLPTV +    D  +        K++ 
Sbjct: 1   MLFKHWNEQAEPRHQLDTP-YAPNVNYESLQKTPLPTVILTEPIDISQFNQIVLCTKVLR 59

Query: 59  PLFNTSHTHAMTRGELVTSLQLNESVVSQAATELSQHWDY-RENFPNEFDPASDTREDTK 117
           PLF ++     T  E   ++    + + +A        DY +E+ P++           +
Sbjct: 60  PLFPSTICPMTTISEFQVTIPPQPTAIKKAHGSSYGDEDYEQESLPDK---------KPE 110

Query: 118 SIVLRLPIVELNGMNTLLISVDENFLKVSPIFTNVVARKLRTLLNTQTKI--LLVGSSDK 175
            I++   + + N +  L I ++ENFL VSPI  N++++++  L  ++  +  +++G+SD+
Sbjct: 111 EIIVSFQVEKFNDI--LFICIEENFLHVSPIAWNLLSQQIIRLCKSKNTLQTIVLGTSDR 168

Query: 176 IYSTKMV--SLNECTLQPPEFITGFLGGMIDELVKNRFSNFKGFIVQSEGPTGFEKLSLE 233
           I + K V  +L    L+PPEF+T     +I  L+ +    FK  I  SEGP+GFEKLSL 
Sbjct: 169 ITTLKSVGSTLGLPDLEPPEFVTNCTASLITTLILHDLP-FKSLIAPSEGPSGFEKLSLV 227

Query: 234 SMDELIDFIIDEWSSYNINADAFRENCHKLWKLDGAAMSAQSGLYI 279
           SMD+L +   +       N  ++ E CH+ W+L G AM AQ+GLYI
Sbjct: 228 SMDQLAESCFELVKPVE-NVSSYIEECHRAWRLQGTAMGAQTGLYI 272

>Kwal_56.24650 s56 (1089568..1090326) [759 bp, 252 aa] {ON} YLR199C
           - Hypothetical ORF [contig 161] FULL
          Length = 252

 Score =  112 bits (279), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 82/271 (30%), Positives = 139/271 (51%), Gaps = 26/271 (9%)

Query: 16  LDAPV-MVPNQESLQALPLPTVTVPAGFDWGKVRDCDPDHKIMNPLFNTSHTHAMTRGEL 74
           +DAP+  + +  SLQ  PLP V +         +      +I   LF          G+L
Sbjct: 1   MDAPLGEIFDSNSLQLAPLPEVRLTEPLKSNSFKRVFIITEIFRSLF---------VGKL 51

Query: 75  VTSLQLNESVVSQAATELSQHWDYRENFPNEFDPASDTREDTKSIVLRLPIVELNGMNTL 134
             + Q++   V        QH  YRE+F  +     D  ++ +S  L +P+++++  +T 
Sbjct: 52  AHAEQISTFEVKWQTKGREQHL-YREDFQVQ----EDCTKENESCGLSIPVLKID-EDTF 105

Query: 135 LISVDENFLKVSPIFTNVVARKLRTLLNTQTKILLVGSSDKIYSTKMVSLNECT------ 188
           L+ V E+FL V PI  N++++++  L     ++L++G+SD+I   K V   +        
Sbjct: 106 LLCVAEDFLHVPPIVGNLLSQEMAKLCR-DLRVLVIGTSDRIEEVKYVGSAQNGRNGVPP 164

Query: 189 LQPPEFITGFLGGMIDELVKNRFSNFKGFIVQSEGPTGFEKLSLESMDELIDFIIDEWSS 248
           L PPE IT F   +  +L+  +   F G++  SEGP+G+EKLS+E+MD+LID    E S+
Sbjct: 165 LTPPELITSFTASITTQLLLCKVP-FDGYVAPSEGPSGYEKLSMETMDKLIDLCWSEIST 223

Query: 249 YNINADAFRENCHKLWKLDGAAMSAQSGLYI 279
              N D + +  H+ W+L G +   Q+GLY+
Sbjct: 224 G--NRDEYVKETHRNWRLHGTSTGTQTGLYL 252

>KLLA0D12276g Chr4 complement(1046970..1047737,1047816..1047824)
           [777 bp, 258 aa] {ON} similar to uniprot|Q05778
           Saccharomyces cerevisiae YLR199C Hypothetical ORF
          Length = 258

 Score =  101 bits (252), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 85/280 (30%), Positives = 125/280 (44%), Gaps = 24/280 (8%)

Query: 1   MLFKHWNEFVEPRHHLDAPVMVPNQESLQALPLPTVTV-PAGFDWGKVRDCDPDHKIMNP 59
           + FK W     PRH +D PV+  +  SL     PTVT+ P   D      C      +  
Sbjct: 2   LTFKQWQNDQVPRHQID-PVVQSDPYSLVNKTTPTVTIEPESLDISPYNHCIVLPTSLKW 60

Query: 60  LFNTSHTHAMTRGELVTSLQLNESVVSQAATELSQHWDYRENFPNEFDPASDTREDTKSI 119
           L   S  + +  G           ++S   + +++ W+  +  P  +D        T+  
Sbjct: 61  LLPKSIINLVHIG-----------IISGTLSNMNE-WESMKPVPGMYDTEEHMINSTEQF 108

Query: 120 VLRLPIVELNGMNTLLISVDENFLKVSPIFTNVVARKLRTLLNTQTKILLVGSSDKIYST 179
           V+   +  L   +TL+  +DEN +K   I TN + R L  LL     I ++ +SDKI   
Sbjct: 109 VIHYNLWRLE--DTLIAIIDENEVKYPAIVTNFMTRNLAQLLRDIKDITILVNSDKITEL 166

Query: 180 KMVSLNECTLQPPEFITGFLGGMIDELVKNRFSNFKGFIVQSEGPTGFEKLSLESMDELI 239
           K +S     L PPEFITG +   I  L +      K  +V SEGP GFEK +  ++D L+
Sbjct: 167 KQLSY----LVPPEFITGSITNFILALPRKEL---KVIVVPSEGPIGFEKYNFPTVDALV 219

Query: 240 DFIIDEWSSYNINADAFRENCHKLWKLDGAAMSAQSGLYI 279
           D +     SY    + +   C KLWKLD    + Q GLYI
Sbjct: 220 DEMSKLLCSYPSQTEYYVSECLKLWKLDECT-TTQGGLYI 258

>Ecym_4720 Chr4 complement(1412286..1413065,1413130..1413135) [786
           bp, 261 aa] {ON} similar to Ashbya gossypii ACL145W
           1-intron
          Length = 261

 Score = 76.6 bits (187), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 61/175 (34%), Positives = 97/175 (55%), Gaps = 18/175 (10%)

Query: 111 DTREDTKSIVLRLPIVELNGMNTLLISVDENFLKVSPIFTNVVARKLRTLLNTQT-KILL 169
           D +  TK +    PI EL+  +TL++ + E+ L+  PI  N +A  L  +L T   K+ L
Sbjct: 99  DVKPSTKEVRASYPIYELDD-HTLVVLIKEDELQHPPILHNFLAIALAKVLRTAIQKVYL 157

Query: 170 VGSSDKIYSTKMVSLNECTLQPPEFITGFLGGMIDELVKNRFSNFKGF-----IVQSEGP 224
           + +SDKI   K  SL+E  LQPPEFI G L  ++  L  N  S+ K F     +VQSEGP
Sbjct: 158 LINSDKIIGFK--SLSE--LQPPEFIAGALAAIVTAL--NSQSSSKEFQHEIMVVQSEGP 211

Query: 225 TGFEKLSLESMDELIDFIIDEWSSYNINADAFRENCHKLWKLDGAAMSAQSGLYI 279
            G+E  ++  +D L++++     S    ++ +  + ++ WK + A+   QSGLY+
Sbjct: 212 RGYEIHNITVVDLLVEYM----KSTLGYSEEYVTSAYRRWKSNSASQ-FQSGLYL 261

>ACL145W Chr3 (93920..94624) [705 bp, 234 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR199C
          Length = 234

 Score = 63.5 bits (153), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 80/157 (50%), Gaps = 22/157 (14%)

Query: 129 NGMNTLLISVDENFLKVSPIFTNVVARKLRTLL---NTQTKILLVGSSDKIYSTKMVSLN 185
            G   L++ V+EN LK  PI  N +A++L   L     +T +L+  +SDK  ST +  L 
Sbjct: 94  RGPGQLVVVVEENDLKYPPIVHNRLAQQLAEKLRAVGAETTVLV--NSDK--STGVKDLE 149

Query: 186 ECTLQPPEFITGFLGGMIDELVKNRFSNFKGFIVQSEGPTGFEKLSLESMDELIDF---I 242
           E  L PPEFITG L  ++  L  +        +VQSEGP GFEK +L  +D L++    I
Sbjct: 150 E--LVPPEFITGALAALVCALAPSGAGRV--LVVQSEGPHGFEKHNLTVVDALVERVRQI 205

Query: 243 IDEWSSYNINADAFRENCHKLWKLDGAAMSAQSGLYI 279
           +D+   Y          C + WKL  A    Q GLY+
Sbjct: 206 LDQPPEYVA-------ACTRHWKLQ-AGSQFQGGLYL 234

>TBLA0E02870 Chr5 complement(707480..717724) [10245 bp, 3414 aa]
           {ON} Anc_5.576 YDR457W
          Length = 3414

 Score = 33.9 bits (76), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 42/85 (49%), Gaps = 6/85 (7%)

Query: 75  VTSLQLNESVVSQAATELSQHW-DY--RENFPNEFDPASDTREDTKSIVLRLPIVELNGM 131
           V+SL L E          S HW DY  + N    F   SD  +D +++++RL  V +  +
Sbjct: 349 VSSLSLQELYNKGMENLPSSHWFDYSIKINIVKSFSNDSDENKDLRNLIIRLKFVSIALI 408

Query: 132 NTLLI--SVDENFLKVSP-IFTNVV 153
           NT++I   V     ++ P IF N++
Sbjct: 409 NTIIIPPQVSSKLFEIDPYIFNNLI 433

>AGR100W Chr7 (925413..926840) [1428 bp, 475 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR105C (TMS1)
          Length = 475

 Score = 33.1 bits (74), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 39/84 (46%), Gaps = 7/84 (8%)

Query: 51  DPDHKIMNPLFNTSHTH--AMTRGELVTSLQLNESVVSQAATELSQHWDY-RENFPN--- 104
           +PD K+ NPL  +S T   ++  G L+T + +  +    AA    Q  +  R + P    
Sbjct: 280 EPDDKLCNPLVRSSGTRRFSVVLGALITFIAIAYTTTRAAANSAFQASNSGRVHLPADDY 339

Query: 105 -EFDPASDTREDTKSIVLRLPIVE 127
            E+D  S TR   +   LR  ++E
Sbjct: 340 IEYDGVSGTRSQLRQEALRQAVLE 363

>KAFR0G02330 Chr7 (485592..486620) [1029 bp, 342 aa] {ON} Anc_6.103
           YBR211C
          Length = 342

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 36/71 (50%), Gaps = 7/71 (9%)

Query: 91  ELSQHWDYRENFPNEFDPASDTREDTKSIVLRLPIVELNGMNTLLISVDENFLK----VS 146
           EL++++D  E    ++D  SD   + +   L LP  +  G+    + V  NF++    V 
Sbjct: 110 ELTRNYDIDEE---DYDTQSDIHHEKQHEALVLPQFDFTGLKDKQLRVTNNFIRSIESVD 166

Query: 147 PIFTNVVARKL 157
            +F NV+ +KL
Sbjct: 167 RVFQNVIDKKL 177

>KLTH0E07062g Chr5 complement(648999..653489) [4491 bp, 1496 aa] {ON}
            similar to uniprot|P22147 Saccharomyces cerevisiae
            YGL173C KEM1 5'-3' exonuclease involved in mRNA decay
            evolutionarily conserved component of cytoplasmic
            processing (P) bodies plays a role in
            microtubule-mediated processes filamentous growth and
            ribosomal RNA maturation
          Length = 1496

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 7/57 (12%)

Query: 97   DYRENFPNEFDPASDTREDTKSIVLRLPIVELNGMNTL-------LISVDENFLKVS 146
            +Y+ NFP+ F   SD   D  SI    P V+ N +  L       L +V +NF+ VS
Sbjct: 1055 EYKRNFPDLFSKLSDAGRDVPSISKLYPGVDANDLRKLIDDVSSWLKNVRQNFVTVS 1111

>TDEL0C04490 Chr3 complement(801727..809247) [7521 bp, 2506 aa] {ON}
            Anc_2.232 YIL129C
          Length = 2506

 Score = 30.8 bits (68), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 39/85 (45%), Gaps = 11/85 (12%)

Query: 141  NFLKVSPIFTNVVARKLRTLLNTQTKILLVGSSDKIYSTK-----MVSLNECTLQPPEFI 195
            N L+ S I  N  +R L  L++   + L   +     S +     M+SL+E   QP    
Sbjct: 1945 NLLQDSRILANSDSRLLFALISNLPRFLNAMTRKDFTSIQGAVDSMISLSEAYKQPS--- 2001

Query: 196  TGFLGGMIDELVKNRFSNFKGFIVQ 220
               L  +ID L KN+F + K F+ Q
Sbjct: 2002 ---LSRLIDSLSKNKFRSKKDFMSQ 2023

>KAFR0A05110 Chr1 complement(1014087..1014455) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score = 28.9 bits (63), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 43/99 (43%), Gaps = 7/99 (7%)

Query: 51  DPDHKIMNPLFNTSHTHAMTRGELVTSLQLNESVVSQAATELSQ----HWDYRENFPNEF 106
           DPD K  N +  T      T G L+ +  LN++ V  AA ++       +  R      +
Sbjct: 22  DPDTKSPNAVVITFEKEDHTLGNLIRAELLNDTKVLFAAYKVEHPFFARFKLRVQTIEGY 81

Query: 107 DPASDTREDTKSIVLRLPIVELN---GMNTLLISVDENF 142
           DP    +    SI+ +L I++ N     N   ++ DENF
Sbjct: 82  DPKEALKNACNSIINKLGILKTNFETEWNLQTLASDENF 120

>NCAS0D02120 Chr4 complement(393640..394008) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score = 28.9 bits (63), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 42/98 (42%), Gaps = 7/98 (7%)

Query: 51  DPDHKIMNPLFNTSHTHAMTRGELVTSLQLNESVVSQAATELSQ----HWDYRENFPNEF 106
           DPD K  N +  T      T G L+ S  LN+S V  AA ++       +  R      +
Sbjct: 22  DPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAAYKVEHPFFARFKLRIQTVEGY 81

Query: 107 DPASDTREDTKSIVLRLPIVELN---GMNTLLISVDEN 141
           DP    +    SI+ +L +++ N     N   ++ DEN
Sbjct: 82  DPKDALKNACNSIISKLGVLKGNFETEWNLQTLAADEN 119

>Kpol_1037.21 s1037 complement(44216..44578) [363 bp, 120 aa] {ON}
           complement(44216..44578) [363 nt, 121 aa]
          Length = 120

 Score = 28.5 bits (62), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 44/101 (43%), Gaps = 7/101 (6%)

Query: 49  DCDPDHKIMNPLFNTSHTHAMTRGELVTSLQLNESVVSQAATELSQ----HWDYRENFPN 104
           + +PD K  N +  T      T G L+ S  LN+S V  AA ++       +  R     
Sbjct: 20  NIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSKVLFAAYKVEHPLFARFKLRIQTVE 79

Query: 105 EFDPASDTREDTKSIVLRLPIVELN---GMNTLLISVDENF 142
            +DP    +    +I+ +L I++ N     N   ++ DENF
Sbjct: 80  NYDPKDALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,527,778
Number of extensions: 1314897
Number of successful extensions: 4067
Number of sequences better than 10.0: 45
Number of HSP's gapped: 4115
Number of HSP's successfully gapped: 46
Length of query: 279
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 171
Effective length of database: 41,097,471
Effective search space: 7027667541
Effective search space used: 7027667541
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)