Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0B009503.454ON41841822420.0
TDEL0F033903.454ON42443212891e-176
KAFR0I019703.454ON41142112671e-173
ZYRO0C06270g3.454ON43043212601e-172
KLTH0E13948g3.454ON43838312571e-171
Kpol_1035.93.454ON42742512461e-170
Ecym_24653.454ON43838812241e-166
SAKL0B06116g3.454ON43142012081e-164
ABL019W3.454ON43141912061e-164
NDAI0G010903.454ON45639212041e-163
Kwal_27.123173.454ON43542712001e-163
Suva_7.3953.454ON45141011921e-161
Skud_7.4153.454ON45240911911e-161
YGR110W (CLD1)3.454ON44540211871e-161
Smik_6.2003.454ON44539911841e-160
NCAS0E008603.454ON44043311811e-160
TPHA0O013103.454ON43837610721e-143
CAGL0L04686g3.454ON45141010541e-140
KLLA0B12914g3.454ON4263819681e-128
TBLA0F034603.454ON4414089061e-118
KLTH0C01254gna 1ON4344034343e-48
SAKL0G19074gna 1ON4323954116e-45
Ecym_5577singletonON4334113452e-35
Kwal_14.985na 1ON4351882431e-21
YLR099C (ICT1)8.284ON3943371773e-13
AGR062C8.284ON3843301683e-12
Kpol_543.498.284ON4293421675e-12
Skud_12.1678.284ON3943371666e-12
Suva_10.1838.284ON3943381641e-11
Smik_12.1588.284ON3943231595e-11
TDEL0F041008.284ON4343341524e-10
KNAG0G021408.284ON4083321516e-10
CAGL0B01969g8.284ON4233381507e-10
TPHA0A016908.284ON4053561498e-10
YDR125C (ECM18)8.284ON4533671453e-09
Kwal_56.237028.284ON4163281427e-09
Ecym_42858.284ON4053511401e-08
Skud_4.3868.284ON4463651391e-08
NDAI0J012108.284ON4163421392e-08
KAFR0B053808.284ON4113401364e-08
KLLA0F19624g8.284ON4093401364e-08
Smik_4.3718.284ON4353351354e-08
NDAI0J01200singletonON4273551355e-08
SAKL0H16500g8.284ON4193411338e-08
Suva_2.2888.284ON4353591311e-07
ZYRO0D06666g8.284ON3803391302e-07
NCAS0B051208.284ON3963391275e-07
NCAS0B037108.284ON4303451142e-05
CAGL0M11462g8.284ON3864171123e-05
KLTH0G13178g8.284ON4153551123e-05
ZYRO0F09064g8.524ON3492991089e-05
TDEL0B032508.524ON3483001071e-04
NDAI0C054308.524ON3621551052e-04
TBLA0H014008.284ON4211401034e-04
KNAG0H031208.284ON4343541026e-04
KAFR0B028308.284ON391184980.001
KNAG0A037708.524ON356117880.028
TPHA0L016008.524ON372126870.038
KAFR0G031804.233ON312172820.11
NCAS0B022608.524ON363293810.18
Kwal_27.119758.524ON336110731.7
ZYRO0A01276g2.232ON257642732.5
KAFR0I023001.415ON484114722.6
TBLA0B062004.348ON88450723.1
KLLA0E00705g4.14ON312457705.4
KAFR0K021007.435ON83969696.3
TBLA0A090404.113ON111040687.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0B00950
         (418 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0B00950 Chr2 (173167..174423) [1257 bp, 418 aa] {ON} Anc_3.4...   868   0.0  
TDEL0F03390 Chr6 (624579..625853) [1275 bp, 424 aa] {ON} Anc_3.4...   501   e-176
KAFR0I01970 Chr9 (401907..403142) [1236 bp, 411 aa] {ON}              492   e-173
ZYRO0C06270g Chr3 (475283..476575) [1293 bp, 430 aa] {ON} simila...   489   e-172
KLTH0E13948g Chr5 complement(1231122..1232438) [1317 bp, 438 aa]...   488   e-171
Kpol_1035.9 s1035 complement(19721..21004) [1284 bp, 427 aa] {ON...   484   e-170
Ecym_2465 Chr2 complement(908173..909489) [1317 bp, 438 aa] {ON}...   476   e-166
SAKL0B06116g Chr2 complement(519929..521224) [1296 bp, 431 aa] {...   469   e-164
ABL019W Chr2 (361560..362855) [1296 bp, 431 aa] {ON} Non-synteni...   469   e-164
NDAI0G01090 Chr7 (230932..232302) [1371 bp, 456 aa] {ON} Anc_3.454    468   e-163
Kwal_27.12317 s27 complement(1173365..1174672) [1308 bp, 435 aa]...   466   e-163
Suva_7.395 Chr7 (684763..686118) [1356 bp, 451 aa] {ON} YGR110W ...   463   e-161
Skud_7.415 Chr7 (692655..694013) [1359 bp, 452 aa] {ON} YGR110W ...   463   e-161
YGR110W Chr7 (713709..715046) [1338 bp, 445 aa] {ON}  CLD1Mitoch...   461   e-161
Smik_6.200 Chr6 (329969..331306) [1338 bp, 445 aa] {ON} YGR110W ...   460   e-160
NCAS0E00860 Chr5 (157521..158843) [1323 bp, 440 aa] {ON} Anc_3.454    459   e-160
TPHA0O01310 Chr15 complement(258745..260061) [1317 bp, 438 aa] {...   417   e-143
CAGL0L04686g Chr12 (539203..540558) [1356 bp, 451 aa] {ON} simil...   410   e-140
KLLA0B12914g Chr2 (1126975..1128255) [1281 bp, 426 aa] {ON} simi...   377   e-128
TBLA0F03460 Chr6 (853280..854605) [1326 bp, 441 aa] {ON}              353   e-118
KLTH0C01254g Chr3 complement(113435..114739) [1305 bp, 434 aa] {...   171   3e-48
SAKL0G19074g Chr7 (1646858..1648156) [1299 bp, 432 aa] {ON} cons...   162   6e-45
Ecym_5577 Chr5 (1185997..1187298) [1302 bp, 433 aa] {ON} similar...   137   2e-35
Kwal_14.985 s14 complement(142781..144088) [1308 bp, 435 aa] {ON...    98   1e-21
YLR099C Chr12 complement(339744..340928) [1185 bp, 394 aa] {ON} ...    73   3e-13
AGR062C Chr7 complement(833212..834366) [1155 bp, 384 aa] {ON} S...    69   3e-12
Kpol_543.49 s543 complement(108945..110234) [1290 bp, 429 aa] {O...    69   5e-12
Skud_12.167 Chr12 complement(322870..324054) [1185 bp, 394 aa] {...    69   6e-12
Suva_10.183 Chr10 complement(344549..345733) [1185 bp, 394 aa] {...    68   1e-11
Smik_12.158 Chr12 complement(319660..320844) [1185 bp, 394 aa] {...    66   5e-11
TDEL0F04100 Chr6 complement(756762..758066) [1305 bp, 434 aa] {O...    63   4e-10
KNAG0G02140 Chr7 complement(484440..485666) [1227 bp, 408 aa] {O...    63   6e-10
CAGL0B01969g Chr2 complement(181406..182677) [1272 bp, 423 aa] {...    62   7e-10
TPHA0A01690 Chr1 (344521..345738) [1218 bp, 405 aa] {ON} Anc_8.2...    62   8e-10
YDR125C Chr4 complement(701397..702758) [1362 bp, 453 aa] {ON}  ...    60   3e-09
Kwal_56.23702 s56 complement(668862..670112) [1251 bp, 416 aa] {...    59   7e-09
Ecym_4285 Chr4 (612053..613270) [1218 bp, 405 aa] {ON} similar t...    59   1e-08
Skud_4.386 Chr4 complement(673125..674465) [1341 bp, 446 aa] {ON...    58   1e-08
NDAI0J01210 Chr10 (282384..283634) [1251 bp, 416 aa] {ON} Anc_8....    58   2e-08
KAFR0B05380 Chr2 (1107049..1108284) [1236 bp, 411 aa] {ON} Anc_8...    57   4e-08
KLLA0F19624g Chr6 complement(1817206..1818435) [1230 bp, 409 aa]...    57   4e-08
Smik_4.371 Chr4 complement(662692..663999) [1308 bp, 435 aa] {ON...    57   4e-08
NDAI0J01200 Chr10 (280820..282103) [1284 bp, 427 aa] {ON}              57   5e-08
SAKL0H16500g Chr8 (1450828..1452087) [1260 bp, 419 aa] {ON} simi...    56   8e-08
Suva_2.288 Chr2 complement(496577..497884) [1308 bp, 435 aa] {ON...    55   1e-07
ZYRO0D06666g Chr4 (576172..577314) [1143 bp, 380 aa] {ON} simila...    55   2e-07
NCAS0B05120 Chr2 complement(953798..954988) [1191 bp, 396 aa] {O...    54   5e-07
NCAS0B03710 Chr2 (664097..665389) [1293 bp, 430 aa] {ON} Anc_8.284     49   2e-05
CAGL0M11462g Chr13 complement(1129244..1130404) [1161 bp, 386 aa...    48   3e-05
KLTH0G13178g Chr7 (1131579..1132826) [1248 bp, 415 aa] {ON} simi...    48   3e-05
ZYRO0F09064g Chr6 (735162..736211) [1050 bp, 349 aa] {ON} simila...    46   9e-05
TDEL0B03250 Chr2 complement(575015..576061) [1047 bp, 348 aa] {O...    46   1e-04
NDAI0C05430 Chr3 (1259106..1260194) [1089 bp, 362 aa] {ON} Anc_8...    45   2e-04
TBLA0H01400 Chr8 (312727..313992) [1266 bp, 421 aa] {ON} Anc_8.2...    44   4e-04
KNAG0H03120 Chr8 (586146..587450) [1305 bp, 434 aa] {ON} Anc_8.2...    44   6e-04
KAFR0B02830 Chr2 complement(578530..579705) [1176 bp, 391 aa] {O...    42   0.001
KNAG0A03770 Chr1 complement(494021..495091) [1071 bp, 356 aa] {O...    39   0.028
TPHA0L01600 Chr12 (338450..339568) [1119 bp, 372 aa] {ON} Anc_8....    38   0.038
KAFR0G03180 Chr7 complement(660802..661740) [939 bp, 312 aa] {ON...    36   0.11 
NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {O...    36   0.18 
Kwal_27.11975 s27 (1028242..1029252) [1011 bp, 336 aa] {ON} YBR2...    33   1.7  
ZYRO0A01276g Chr1 complement(91512..99242) [7731 bp, 2576 aa] {O...    33   2.5  
KAFR0I02300 Chr9 (467218..468672) [1455 bp, 484 aa] {ON} Anc_1.4...    32   2.6  
TBLA0B06200 Chr2 (1461434..1464088) [2655 bp, 884 aa] {ON} Anc_4...    32   3.1  
KLLA0E00705g Chr5 complement(59404..68778) [9375 bp, 3124 aa] {O...    32   5.4  
KAFR0K02100 Chr11 complement(429397..431916) [2520 bp, 839 aa] {...    31   6.3  
TBLA0A09040 Chr1 (2225598..2228930) [3333 bp, 1110 aa] {ON} Anc_...    31   7.9  

>KNAG0B00950 Chr2 (173167..174423) [1257 bp, 418 aa] {ON} Anc_3.454
           YGR110W
          Length = 418

 Score =  868 bits (2242), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/418 (100%), Positives = 418/418 (100%)

Query: 1   MASKALRGSLQAVLNRLKVFDLKNVRFRKQSDSRVYVKTPTAPTAIPLTEIIVKLPYLFP 60
           MASKALRGSLQAVLNRLKVFDLKNVRFRKQSDSRVYVKTPTAPTAIPLTEIIVKLPYLFP
Sbjct: 1   MASKALRGSLQAVLNRLKVFDLKNVRFRKQSDSRVYVKTPTAPTAIPLTEIIVKLPYLFP 60

Query: 61  RGVAQSLEDYKVFSNNADKIQYDLLSTLPFFPEAKDGKRAEIVRTKIDEDDNFINEFFIQ 120
           RGVAQSLEDYKVFSNNADKIQYDLLSTLPFFPEAKDGKRAEIVRTKIDEDDNFINEFFIQ
Sbjct: 61  RGVAQSLEDYKVFSNNADKIQYDLLSTLPFFPEAKDGKRAEIVRTKIDEDDNFINEFFIQ 120

Query: 121 PANVTEPSKLKHLIFIHGYGAGLGFFLKNFENIQLKDNSWCIHAIDLPGFGFSSRTKFPF 180
           PANVTEPSKLKHLIFIHGYGAGLGFFLKNFENIQLKDNSWCIHAIDLPGFGFSSRTKFPF
Sbjct: 121 PANVTEPSKLKHLIFIHGYGAGLGFFLKNFENIQLKDNSWCIHAIDLPGFGFSSRTKFPF 180

Query: 181 KYPEDDVSKVQTWFHERLKIWFEKRDLLKNPGNNMVVAHSLGAYLMALYKRNNPLHFKKL 240
           KYPEDDVSKVQTWFHERLKIWFEKRDLLKNPGNNMVVAHSLGAYLMALYKRNNPLHFKKL
Sbjct: 181 KYPEDDVSKVQTWFHERLKIWFEKRDLLKNPGNNMVVAHSLGAYLMALYKRNNPLHFKKL 240

Query: 241 IMCSPAGMCNSTVVKKQPPWWYAALWDMNLSPFSLVRNSGWLGSKLTSGWSYRRFRSLHS 300
           IMCSPAGMCNSTVVKKQPPWWYAALWDMNLSPFSLVRNSGWLGSKLTSGWSYRRFRSLHS
Sbjct: 241 IMCSPAGMCNSTVVKKQPPWWYAALWDMNLSPFSLVRNSGWLGSKLTSGWSYRRFRSLHS 300

Query: 301 KIQFENLHLYSYAIFNRPGCGEYLLAFALRCGGDPRVSLEATLFNDVVNKWDSDSEWVWL 360
           KIQFENLHLYSYAIFNRPGCGEYLLAFALRCGGDPRVSLEATLFNDVVNKWDSDSEWVWL
Sbjct: 301 KIQFENLHLYSYAIFNRPGCGEYLLAFALRCGGDPRVSLEATLFNDVVNKWDSDSEWVWL 360

Query: 361 YGDRDWMDVKGGRRISQKINEIFPGKSSVEVIPNAGHHLYFDNISCFNAILEKEMTKL 418
           YGDRDWMDVKGGRRISQKINEIFPGKSSVEVIPNAGHHLYFDNISCFNAILEKEMTKL
Sbjct: 361 YGDRDWMDVKGGRRISQKINEIFPGKSSVEVIPNAGHHLYFDNISCFNAILEKEMTKL 418

>TDEL0F03390 Chr6 (624579..625853) [1275 bp, 424 aa] {ON} Anc_3.454
           YGR110W
          Length = 424

 Score =  501 bits (1289), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 247/432 (57%), Positives = 315/432 (72%), Gaps = 22/432 (5%)

Query: 1   MASKALRGSLQAVLNRLKVFDLKN-VRFRKQSDSRVYVKTPTAPTAIPLTEIIVKLPYLF 59
           M+++ +  SL+ ++  L    L+N V  + QS   V +  P APTAIPL EIIVKLP LF
Sbjct: 1   MSTRFVTQSLKGIVGSL----LRNRVSLKAQS---VSLDVPAAPTAIPLREIIVKLPSLF 53

Query: 60  PRGVAQSLEDYKVFSNNAD-KIQYDLLSTLPFFPEAKDGKRAEIVRTKIDEDDNFINEFF 118
           PR    S+ DY+    + D K Q DLL+TLPF+ E    +R+E++RTK+D++ N+INEF+
Sbjct: 54  PRSFGDSVRDYRDLCRHTDEKFQRDLLATLPFYGEGDLHRRSEVIRTKVDDEGNYINEFY 113

Query: 119 IQPANVTEP-SKLKHLIFIHGYGAGLGFFLKNFENIQLKDNSWCIHAIDLPGFGFSSRTK 177
           I P N + P  +LKHL+FIHGYGAGLGFFLKNFENI L +N WCIHAIDLPG+GFSSR K
Sbjct: 114 IMPKNASVPRDRLKHLVFIHGYGAGLGFFLKNFENIPLLNNEWCIHAIDLPGYGFSSRCK 173

Query: 178 FPFKYPEDDVSKVQTWFHERLKIWFEKRDLLKNPGNNMVVAHSLGAYLMALYKRNNPLHF 237
           FPF+YP+D V+ V  WFH+RL  WF +R+LL+NP NN+V+AHSLGAYLMALY   N  HF
Sbjct: 174 FPFQYPKDTVTDVHEWFHKRLNRWFAERNLLRNPENNIVMAHSLGAYLMALYASKNSSHF 233

Query: 238 KKLIMCSPAGMCNSTVVK----KQPPWWYAALWDMNLSPFSLVRNSGWLGSKLTSGWSYR 293
           KKL+MCSPAG+C ST  K    ++PPWWY+ LWD N+SPFSLVR S  LGSKLTSGWSY+
Sbjct: 234 KKLVMCSPAGICESTTTKAIGNRKPPWWYSKLWDRNISPFSLVRVSSRLGSKLTSGWSYK 293

Query: 294 RF------RSLHSKIQFENLHLYSYAIFNRPGCGEYLLAFALRCGGDPRVSLEATLF-ND 346
           RF      +S  S+ QFE LH Y Y+IFN+PGCGEYLL+FALRCGGDPR+ LE  LF  +
Sbjct: 294 RFGKLLRSKSRKSEQQFEALHKYCYSIFNKPGCGEYLLSFALRCGGDPRIPLEDMLFKTN 353

Query: 347 VVNKWDSDSEWVWLYGDRDWMDVKGGRRISQKINEIFPGKSSVEVIPNAGHHLYFDNISC 406
                + + EW+WLYG+RDWMD  GG+R+S+ + +    KS V ++PNAGHHLYFDN   
Sbjct: 354 DSGIMNGNLEWLWLYGERDWMDFNGGKRVSEHLKKS-GQKSEVCIVPNAGHHLYFDNYDY 412

Query: 407 FNAILEKEMTKL 418
           FN+++ +EM  +
Sbjct: 413 FNSLIIREMKSM 424

>KAFR0I01970 Chr9 (401907..403142) [1236 bp, 411 aa] {ON} 
          Length = 411

 Score =  492 bits (1267), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 238/421 (56%), Positives = 295/421 (70%), Gaps = 13/421 (3%)

Query: 1   MASKALRGSLQAVLNRLKVFDLKNVRFRKQSDSRVYVKTPTAPTAIPLTEIIVKLPYLFP 60
           M+ + +   L+ VL   K+         K+S   V+    +AP AIPL +II +LP LFP
Sbjct: 1   MSPRLVASFLKLVLGHSKI---------KKSQVPVHSNISSAPVAIPLVKIIAQLPRLFP 51

Query: 61  RGVAQSLEDYKVFSNNADKIQYDLLSTLPFFPEAKDGKRAEIVRTKIDEDDNFINEFFIQ 120
           R + +S +DY+V+    +++Q DLLSTLPF+P     K A I++T +DE+ N+INEF I 
Sbjct: 52  RSIDESFKDYRVYKEGPERMQEDLLSTLPFYPNVSKDKVARIIKTVVDEEGNYINEFCIT 111

Query: 121 PANVTEPSKLKHLIFIHGYGAGLGFFLKNFENIQLKDNSWCIHAIDLPGFGFSSRTKFPF 180
           P N     KLKHLIFIHGYGAG GFFLKN E+I L DN+WCIHAIDLPGFGFSSR  FPF
Sbjct: 112 PKNTVNSQKLKHLIFIHGYGAGFGFFLKNLESIPLLDNNWCIHAIDLPGFGFSSRKNFPF 171

Query: 181 KYPEDDVSKVQTWFHERLKIWFEKRDLLKNPGNNMVVAHSLGAYLMALYKRNNPLHFKKL 240
           KYP  + S+V  WFHER++ W E+R LL NP NN++VAHSLGAYLMALY +  P H +KL
Sbjct: 172 KYPTSNTSEVTAWFHERIRRWLEERTLLDNPKNNVIVAHSLGAYLMALYTQVYPAHLRKL 231

Query: 241 IMCSPAGMCNSTVVKK---QPPWWYAALWDMNLSPFSLVRNSGWLGSKLTSGWSYRRFRS 297
           IMCSPAG+  S    K   QPPWWYA LWDMNLSPF+LVR S  LGSKLTSGWSYRRF+ 
Sbjct: 232 IMCSPAGVSKSQNNSKAVLQPPWWYAKLWDMNLSPFTLVRLSKHLGSKLTSGWSYRRFKL 291

Query: 298 LHSKIQFENLHLYSYAIFNRPGCGEYLLAFALRCGGDPRVSLEATLFNDVVNKWDSDSEW 357
           + +++QFE LH YSYAIFN+PG GEYLL F L CGG+PR SLE TLF++  N   S  EW
Sbjct: 292 IENRMQFEMLHRYSYAIFNQPGSGEYLLGFILECGGNPRCSLEDTLFSNNFNV-SSKVEW 350

Query: 358 VWLYGDRDWMDVKGGRRISQKINEIFPGKSSVEVIPNAGHHLYFDNISCFNAILEKEMTK 417
            W+YG+ DWMD++GGRR+   + E F   S   ++PNAGHHLY DNI  FN I+ + M  
Sbjct: 351 AWIYGENDWMDIEGGRRVHNLLLEKFNRDSKFYMVPNAGHHLYLDNIRYFNNIIVQHMEN 410

Query: 418 L 418
           +
Sbjct: 411 V 411

>ZYRO0C06270g Chr3 (475283..476575) [1293 bp, 430 aa] {ON} similar
           to uniprot|P53264 Saccharomyces cerevisiae YGR110W
           Hypothetical ORF
          Length = 430

 Score =  489 bits (1260), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 239/432 (55%), Positives = 301/432 (69%), Gaps = 16/432 (3%)

Query: 1   MASKALRGSLQAVLNRLKVFDLKNVRFRKQSDSRVYVKTPTAPTAIPLTEIIVKLPYLFP 60
           M++K   G L+++     +   KNV  +K+    +  + P APTAIPL +II++LP LFP
Sbjct: 1   MSTKFTTGYLKSIA--ASILSRKNVGIKKKLHGTLGTRVPAAPTAIPLHKIIMRLPKLFP 58

Query: 61  RGVAQSLEDYKVFSNNADKIQYDLLSTLPFFPEAKDGKRAEIVRTKIDEDDNFINEFFIQ 120
           R V  S  DYK F  +  ++Q +LL TLPF+P   + K+AE+V+T +D+  N+INEF I 
Sbjct: 59  RSVDASTRDYKDFCYHTGQLQEELLRTLPFYPYCAESKKAEVVKTTVDDQGNYINEFCIT 118

Query: 121 PANVTEPS-KLKHLIFIHGYGAGLGFFLKNFENIQLKDNSWCIHAIDLPGFGFSSRTKFP 179
           P   + PS K+KHLI IHGYGAGLGFFLKN E I L DNSW IHAIDLPG+GFSSR KFP
Sbjct: 119 PVKPSVPSHKMKHLICIHGYGAGLGFFLKNLEGIPLLDNSWVIHAIDLPGYGFSSRPKFP 178

Query: 180 FKYPEDDVSKVQTWFHERLKIWFEKRDLLKNPGNNMVVAHSLGAYLMALYKRNNPLHFKK 239
           FKYP+D +S+V +WFH+R+  WF+KR LL N  NN+V+AHSLGAYLMALY      HFKK
Sbjct: 179 FKYPKDSLSQVHSWFHDRIHTWFKKRGLLVNSQNNLVMAHSLGAYLMALYTTKYTTHFKK 238

Query: 240 LIMCSPAGMCNSTVVKK----QPPWWYAALWDMNLSPFSLVRNSGWLGSKLTSGWSYRRF 295
           L+MCSPAG+C ST  K      PPWWY  LWD+N+SPF LVRN+  LGS +TSGWSYRRF
Sbjct: 239 LVMCSPAGVCKSTTAKNIGNTTPPWWYTKLWDLNISPFCLVRNAAALGSMVTSGWSYRRF 298

Query: 296 RSLHS--------KIQFENLHLYSYAIFNRPGCGEYLLAFALRCGGDPRVSLEATLFNDV 347
             L          ++QFE LH Y+YAIFNR G GEYLL+FAL CGGDPR+ LE T+F D 
Sbjct: 299 NKLLQSNSNTNLDRLQFEALHRYAYAIFNRRGSGEYLLSFALSCGGDPRLPLEDTIFKDK 358

Query: 348 VNK-WDSDSEWVWLYGDRDWMDVKGGRRISQKINEIFPGKSSVEVIPNAGHHLYFDNISC 406
            +  + S+ EW+W+YG+RDWMDV GG R+S+ I      KS V V PN+GHHLYFDN   
Sbjct: 359 TSGIFRSNCEWIWIYGERDWMDVNGGERVSRFIENQGGRKSQVHVAPNSGHHLYFDNHKF 418

Query: 407 FNAILEKEMTKL 418
           FN+ + K+M  +
Sbjct: 419 FNSFIVKQMKDM 430

>KLTH0E13948g Chr5 complement(1231122..1232438) [1317 bp, 438 aa]
           {ON} similar to uniprot|P53264 Saccharomyces cerevisiae
           YGR110W Hypothetical ORF
          Length = 438

 Score =  488 bits (1257), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 230/383 (60%), Positives = 286/383 (74%), Gaps = 7/383 (1%)

Query: 40  PTAPTAIPLTEIIVKLPYLFPRGVAQSLEDYKVFSNNADKIQYDLLSTLPFFPEAKDGKR 99
           P++P+AIPL E+++ LP LFPR + +S+ DY  F  +A  +Q+ LLSTLPFFP A D K 
Sbjct: 51  PSSPSAIPLRELVINLPRLFPRSMKESVRDYFAFRKDAGTLQHQLLSTLPFFPVAGDDKV 110

Query: 100 AEIVRTKIDEDDNFINEFFIQPANVTEPSKLKHLIFIHGYGAGLGFFLKNFENIQLKDNS 159
           AE+V+T +DE  N+INEF ++PA       L+HLI +HGYGAGLGFFLKN E + L DN 
Sbjct: 111 AEVVQTPVDEQANYINEFCVRPAMPHPSGTLRHLIIVHGYGAGLGFFLKNLEKLNLIDNR 170

Query: 160 WCIHAIDLPGFGFSSRTKFPFKYPEDDVSKVQTWFHERLKIWFEKRDLLKNPGNNMVVAH 219
           W IHAIDLPG+GFSSR KFP+KY  D  ++V+ WFH R K W EKR LL++P  NM+VAH
Sbjct: 171 WVIHAIDLPGYGFSSRPKFPYKYKSDPAAQVEHWFHARFKTWLEKRGLLQHPEQNMLVAH 230

Query: 220 SLGAYLMALYKRNNPLHFKKLIMCSPAGMCNSTVVKKQ--PPWWYAALWDMNLSPFSLVR 277
           S+GAYL ALY    P HFKKL+MCSPAG+CN+   K++  PPWW+A LWD N+SPFSLVR
Sbjct: 231 SMGAYLAALYANKYPNHFKKLVMCSPAGICNTPSNKQRRLPPWWFAKLWDRNISPFSLVR 290

Query: 278 NSGWLGSKLTSGWSYRRFRSLHSK-----IQFENLHLYSYAIFNRPGCGEYLLAFALRCG 332
           NS  LGSKLTSGWSYRRF  L S+      QFE +H Y+YAIFN PG GEYLL+FAL+CG
Sbjct: 291 NSRLLGSKLTSGWSYRRFGQLLSEGYRGAQQFEAIHKYAYAIFNSPGSGEYLLSFALKCG 350

Query: 333 GDPRVSLEATLFNDVVNKWDSDSEWVWLYGDRDWMDVKGGRRISQKINEIFPGKSSVEVI 392
           GDPR +LE  LF++ +N++ +  EW+WLYGD+DWMDV GGRR+S  +N     KS VEV+
Sbjct: 351 GDPRDALERRLFHNKMNQFKAKCEWLWLYGDQDWMDVGGGRRVSHFLNTAMGKKSKVEVV 410

Query: 393 PNAGHHLYFDNISCFNAILEKEM 415
            ++GHHLYFDN   FN ILEKEM
Sbjct: 411 HDSGHHLYFDNYEQFNRILEKEM 433

>Kpol_1035.9 s1035 complement(19721..21004) [1284 bp, 427 aa] {ON}
           complement(19721..21004) [1284 nt, 428 aa]
          Length = 427

 Score =  484 bits (1246), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 232/425 (54%), Positives = 302/425 (71%), Gaps = 16/425 (3%)

Query: 10  LQAVLNRLKVFDLKNVRFRKQSDSRVYVK------TPTAPTAIPLTEIIVKLPYLFPRGV 63
           ++ ++   K F   N  FR+ + S V  +       P AP AIPL EII+KLP LFPR +
Sbjct: 3   IRNLIRTSKSFISNNFNFRRVATSGVPSRDEKLPTVPAAPAAIPLYEIILKLPNLFPRTL 62

Query: 64  AQSLEDYKVFSNNADKIQYDLLSTLPFFPEAKDGKRAEIVRTKIDEDDNFINEFFIQPAN 123
            +SL DY  F  + DK Q +LLSTLP++P A DGK+AE++ TK+D++ N+INEF I P  
Sbjct: 63  KESLNDYHDFHKDIDKFQTELLSTLPYYPMANDGKKAELITTKVDDEGNYINEFCISPIG 122

Query: 124 VTEPSK-LKHLIFIHGYGAGLGFFLKNFENIQLKDNSWCIHAIDLPGFGFSSRTKFPFKY 182
                + LKHLIFIHGYGAGLGFFLKNFE++ L DN WCIHAIDLPG+G+S R +FPFKY
Sbjct: 123 AEADQRDLKHLIFIHGYGAGLGFFLKNFEHLPLLDNKWCIHAIDLPGYGYSKRCEFPFKY 182

Query: 183 PEDDVSKVQTWFHERLKIWFEKRDLLKNPGNNMVVAHSLGAYLMALYKRNNPLHFKKLIM 242
           PE D+S VQ WFH+R++ WF+ R LL  P NNM++AHSLGAYLMALY    P  FKK++M
Sbjct: 183 PEHDISDVQDWFHKRIRTWFKARSLLTTPENNMIMAHSLGAYLMALYIDKFPNDFKKIVM 242

Query: 243 CSPAGMCNSTVVKK----QPPWWYAALWDMNLSPFSLVRNSGWLGSKLTSGWSYRRFRSL 298
           CSPAG+C S+  ++    + PWW+  LWD N+SPF+LVRN+ +LGSKLTSGWSYRRF+ L
Sbjct: 243 CSPAGICQSSTSEEIGNIKTPWWFNKLWDQNVSPFTLVRNTYYLGSKLTSGWSYRRFKQL 302

Query: 299 HSK---IQFENLHLYSYAIFNRPGCGEYLLAFALRCGGDPRVSLEATLFNDVVNKW--DS 353
                 +QFE LH Y+Y+IFN+ G GEY+L FAL+CGGDPR+ LE  LF     +    S
Sbjct: 303 KQSGHLMQFEKLHRYAYSIFNQKGSGEYILGFALKCGGDPRIPLEDNLFKSPKTEGIPKS 362

Query: 354 DSEWVWLYGDRDWMDVKGGRRISQKINEIFPGKSSVEVIPNAGHHLYFDNISCFNAILEK 413
           D EW+W+YG++DWMD+ GG+R++ ++   F  KSS  V+P++GHHLYFDN   FN +L K
Sbjct: 363 DCEWLWVYGEKDWMDIGGGKRVTDELVTRFGKKSSTTVVPDSGHHLYFDNYKFFNELLVK 422

Query: 414 EMTKL 418
           EM  +
Sbjct: 423 EMKNM 427

>Ecym_2465 Chr2 complement(908173..909489) [1317 bp, 438 aa] {ON}
           similar to Ashbya gossypii ABL019W
          Length = 438

 Score =  476 bits (1224), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 226/388 (58%), Positives = 286/388 (73%), Gaps = 9/388 (2%)

Query: 40  PTAPTAIPLTEIIVKLPYLFPRGVAQSLEDYKVFSNNADKIQYDLLSTLPFFPEAKDGKR 99
           PT PTAIPL EI++ +P LFP  + +S +DYK+F ++ DK Q  LLSTLPFFP A DGK 
Sbjct: 43  PTPPTAIPLMEILLNIPSLFPMPLKESWKDYKIFHDDVDKFQTGLLSTLPFFPSAADGKI 102

Query: 100 AEIVRTKIDEDDNFINEFFIQPANVT---EPSKLKHLIFIHGYGAGLGFFLKNFENIQLK 156
            EI+RT +DE+ N+INEF I+P +     + SK+ HLIF+HGYGAGLGFFLKNFENI+L 
Sbjct: 103 GEIIRTPVDEEGNYINEFCIRPNSPPVNPKDSKMHHLIFVHGYGAGLGFFLKNFENIKLL 162

Query: 157 DNSWCIHAIDLPGFGFSSRTKFPFKYPEDDVSKVQTWFHERLKIWFEKRDLLKNPGNNMV 216
           +NSW IHAID PG+GFSSR KFPF   ++  S+V+ WFH+R +IW +KR LL++   N+V
Sbjct: 163 NNSWTIHAIDFPGYGFSSRPKFPFSINKNTASEVENWFHDRFEIWLQKRGLLEDQERNLV 222

Query: 217 VAHSLGAYLMALYKRNNPLHFKKLIMCSPAGMCNSTVVKKQPPWWYAALWDMNLSPFSLV 276
           +AHSLGAYL+ALY ++ P H KKLIMCSPAG+C S  V KQPPWW+  LWD NLSPFSLV
Sbjct: 223 LAHSLGAYLIALYAQSRPKHLKKLIMCSPAGICPSNKVIKQPPWWFVKLWDRNLSPFSLV 282

Query: 277 RNSGWLGSKLTSGWSYRRFRSL-----HSKIQFENLHLYSYAIFNRPGCGEYLLAFALRC 331
           RNSG  GSKLTSGWS+RRF+         + QF+ LH Y+YAIFN+PG GEYLL+F L+C
Sbjct: 283 RNSGIFGSKLTSGWSFRRFKQFLNEGTMGESQFQALHRYAYAIFNKPGSGEYLLSFVLKC 342

Query: 332 GGDPRVSLEATLFN-DVVNKWDSDSEWVWLYGDRDWMDVKGGRRISQKINEIFPGKSSVE 390
           GGDPR  L + LFN    + + +  +W+W+YGD+DWMD KGG + S  I      +S+V 
Sbjct: 343 GGDPRSPLLSRLFNSQAADSFKAQCDWLWMYGDQDWMDCKGGEQASDFIVRHIGKESNVH 402

Query: 391 VIPNAGHHLYFDNISCFNAILEKEMTKL 418
           VIP +GHHLY DN S FN +L+ EM K+
Sbjct: 403 VIPQSGHHLYLDNYSVFNELLQAEMAKM 430

>SAKL0B06116g Chr2 complement(519929..521224) [1296 bp, 431 aa] {ON}
           similar to uniprot|P53264 Saccharomyces cerevisiae
           YGR110W Hypothetical ORF
          Length = 431

 Score =  469 bits (1208), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 226/420 (53%), Positives = 299/420 (71%), Gaps = 9/420 (2%)

Query: 6   LRGSLQAVLNRLKVFDL-KNVRFRKQSDSRVYV-KTPTAPTAIPLTEIIVKLPYLFPRGV 63
           L  +L+A +N + + +L    + R  +++   + +  T PTA+PL +I  +LP LFP   
Sbjct: 12  LLTALKAAVNSISITNLISRAKVRTSAETTAIINQKSTPPTAMPLIQIATQLPNLFPLSF 71

Query: 64  AQSLEDYKVFSNNADKIQYDLLSTLPFFPEAKDGKRAEIVRTKIDEDDNFINEFFIQPAN 123
             S+ DY +F  NA+  Q  LLSTLPF+P   +G+ +EI++T +D++ N+INEF I+P N
Sbjct: 72  EASIRDYSMFQENAESFQSQLLSTLPFYPSPANGRSSEILKTPVDDEGNYINEFTIKPMN 131

Query: 124 VTEPSKLKHLIFIHGYGAGLGFFLKNFENIQLKDNSWCIHAIDLPGFGFSSRTKFPFKYP 183
            +  S +KHLIF+HGYGAGLGFFLKNFENI L +N+WCIHAIDLPG+GFSSR KFPF YP
Sbjct: 132 PSSSSSMKHLIFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRPKFPFNYP 191

Query: 184 EDDVSKVQTWFHERLKIWFEKRDLLKNPGNNMVVAHSLGAYLMALYKRNNPLHFKKLIMC 243
           E +   V+ WFH+R+K W  KR LL NP NN++VAHSLGAY+ ALY    P HF KLIMC
Sbjct: 192 EHNPIMVEDWFHQRIKGWLHKRGLLANPKNNLLVAHSLGAYISALYANKFPNHFSKLIMC 251

Query: 244 SPAGMCNSTVVKKQPPWWYAALWDMNLSPFSLVRNSGWLGSKLTSGWSYRRFRSL----- 298
           SPAG+C S  + + PP W+  LWD N+SPFSLVRNS  LGSKLTSGW+YRRFR       
Sbjct: 252 SPAGICPSPKLGQAPPQWFVKLWDRNISPFSLVRNSFHLGSKLTSGWTYRRFRQFLREGQ 311

Query: 299 HSKIQFENLHLYSYAIFNRPGCGEYLLAFALRCGGDPRVSLEATLFNDVVNKWDSDSEWV 358
               Q + +H Y+YAIFN+PG GEYLL+FAL+CGGDPR+ LE  LF D  + + ++ +W+
Sbjct: 312 RGYEQHKAMHKYTYAIFNKPGSGEYLLSFALKCGGDPRLPLEKRLF-DNTSSFKANCDWL 370

Query: 359 WLYGDRDWMDVKGGRRISQKINEIFPGKSSVEVIPNAGHHLYFDNISCFNAILEKEMTKL 418
           WLYGD DWMD++GG+R S+ + +I   KS V+V+P+AGHHLY DN   FN ++ KEM K+
Sbjct: 371 WLYGDEDWMDLRGGQRASEFLKKI-GMKSDVKVVPSAGHHLYLDNYKHFNNVVIKEMEKM 429

>ABL019W Chr2 (361560..362855) [1296 bp, 431 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGR110W
          Length = 431

 Score =  469 bits (1206), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 231/419 (55%), Positives = 298/419 (71%), Gaps = 13/419 (3%)

Query: 13  VLNRLKVFDLKN----VRFRKQSDSRVY-VKTPTAPTAIPLTEIIVKLPYLFPRGVAQSL 67
           +LN LK    +N    V+  ++    ++ V+ PT PTA+PL EII  LP LFP   +QS 
Sbjct: 10  LLNTLKALHRRNFGDQVQAPRKDGRHIHTVRKPTPPTAVPLYEIIRNLPNLFPLPTSQSW 69

Query: 68  EDYKVFSNNADKIQYDLLSTLPFFPEAKDGKRAEIVRTKIDEDDNFINEFFIQPANVTE- 126
           EDYK F ++ +  Q  LLSTLPFF  A++GK  +I+RT +D++ N+INEF I+PA++ E 
Sbjct: 70  EDYKAFKSDREAFQVGLLSTLPFFERAREGKIGKIIRTPVDDEGNYINEFCIRPASMEEN 129

Query: 127 -PSKLKHLIFIHGYGAGLGFFLKNFENIQLKDNSWCIHAIDLPGFGFSSRTKFPFKYPED 185
             +   HLIFIHGYGAGLGFF+KNFE++ L D+ W IHAIDLPG+G+S+R +FPF     
Sbjct: 130 HGAATNHLIFIHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYGYSTRCQFPFDVNTH 189

Query: 186 DVSKVQTWFHERLKIWFEKRDLLKNPGNNMVVAHSLGAYLMALYKRNNPLHFKKLIMCSP 245
            V +V+ WFHERL+ W  KR LL+ P  NMV+AHS+GAYL A Y ++   HFKKLIMCSP
Sbjct: 190 SVREVEAWFHERLETWLSKRGLLQAPHRNMVMAHSMGAYLTAHYAQSRQNHFKKLIMCSP 249

Query: 246 AGMCNSTVVKKQPPWWYAALWDMNLSPFSLVRNSGWLGSKLTSGWSYRRFRSLHSK---- 301
           AG+  S  +KKQPPWW+  LWD N+SPFSLVRNSG LGSKLTSGWS+RRFR L ++    
Sbjct: 250 AGISPSKSMKKQPPWWFIKLWDRNVSPFSLVRNSGPLGSKLTSGWSFRRFRHLLNEGEIG 309

Query: 302 -IQFENLHLYSYAIFNRPGCGEYLLAFALRCGGDPRVSLEATLFN-DVVNKWDSDSEWVW 359
             QFE LH YSYAIFN PG GEYLL+F L+CGGDPR+ L  ++F+ +  + + +  EW+W
Sbjct: 310 MRQFEALHKYSYAIFNMPGSGEYLLSFVLKCGGDPRIPLLGSMFSPEKEHGFKAQCEWLW 369

Query: 360 LYGDRDWMDVKGGRRISQKINEIFPGKSSVEVIPNAGHHLYFDNISCFNAILEKEMTKL 418
           LYGD  WMD +GG+R S  I +   GKS VE++PN+GHHLYFDN S FN IL +EM  +
Sbjct: 370 LYGDHVWMDKEGGQRASSYITDRIGGKSRVEIVPNSGHHLYFDNYSYFNKILLREMQSI 428

>NDAI0G01090 Chr7 (230932..232302) [1371 bp, 456 aa] {ON} Anc_3.454
          Length = 456

 Score =  468 bits (1204), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 229/392 (58%), Positives = 281/392 (71%), Gaps = 8/392 (2%)

Query: 31  SDSRVYVKTPTAPTAIPLTEIIVKLPYLFPRGVAQSLEDYKVFSNNADKIQYDLLSTLPF 90
           + +++    PT PTAIPL  II  LP LFPR + QS++DYK+F  + +++Q DLL TLPF
Sbjct: 60  TTTKINTIAPTPPTAIPLLRIITSLPKLFPRSIKQSIQDYKIFQKDPERLQIDLLKTLPF 119

Query: 91  FPEAKDGKRAEIVRTKI-DEDDNFINEFFIQP-ANVT-EPSKLKHLIFIHGYGAGLGFFL 147
           F      K  +I++T+I D DD +INEF I P  N+    + +KHLIFIHGYGAGLGFF+
Sbjct: 120 FSNGAKFKTGKILKTQIEDNDDYYINEFCITPDTNININSADVKHLIFIHGYGAGLGFFI 179

Query: 148 KNFENIQLKDNSWCIHAIDLPGFGFSSRTK-FPFKYPEDDVSKVQTWFHERLKIWFEKRD 206
           KN ENI L +N WCIHAIDLPG+G+S+R K FPFKYP D   KVQ WFH+++ IW +KR+
Sbjct: 180 KNLENIPLLNNRWCIHAIDLPGYGYSTRNKKFPFKYPRDSQLKVQNWFHDKIHIWLQKRN 239

Query: 207 LLKNPGNNMVVAHSLGAYLMALYKRNNPLHFKKLIMCSPAGMCNSTVVK--KQPPWWYAA 264
           LL  P NN++VAHSLGAYLMA Y    P HF+KLIMCSPAG+  S++ K    PPWWY  
Sbjct: 240 LLNYPKNNLIVAHSLGAYLMAQYAFKFPSHFQKLIMCSPAGVTKSSIKKLNNSPPWWYEK 299

Query: 265 LWDMNLSPFSLVRNSGWLGSKLTSGWSYRRFRSLH-SKIQFENLHLYSYAIFNRPGCGEY 323
           LWD+N SPFS+VRNSG  GSK+TS WSYRRF+ L     QFE LH Y+Y+IFNRPGCGEY
Sbjct: 300 LWDLNFSPFSIVRNSGIYGSKITSAWSYRRFKPLDLDHKQFEALHRYAYSIFNRPGCGEY 359

Query: 324 LLAFALRCGGDPRVSLEATLFNDVVNKWDSDSEWVWLYGDRDWMDVKGGRRISQKINEIF 383
           LL+F L CGG+PR SLE TLF    N      +W W+YGD DWMD+ G +R+S+ INE  
Sbjct: 360 LLSFILSCGGNPRFSLEDTLFQR-ENLSTELCDWGWIYGDNDWMDINGAKRVSRLINEQQ 418

Query: 384 PGKSSVEVIPNAGHHLYFDNISCFNAILEKEM 415
            GKS V VIP+AGHHLY DN   FN +L KEM
Sbjct: 419 KGKSDVHVIPSAGHHLYLDNYKDFNKLLIKEM 450

>Kwal_27.12317 s27 complement(1173365..1174672) [1308 bp, 435 aa]
           {ON} YGR110W - Hypothetical ORF [contig 20] FULL
          Length = 435

 Score =  466 bits (1200), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 226/427 (52%), Positives = 295/427 (69%), Gaps = 12/427 (2%)

Query: 1   MASKALRGSLQAVLNRLKVFDLKNVRFR-----KQSDSRVYVKTPTAPTAIPLTEIIVKL 55
           + S  +   +++  ++L    L+ +R R      Q  +  Y   P++P+AIPL EII+KL
Sbjct: 7   LQSSRVIAVIRSAADQLSNLQLRRLRIRPLEIKNQVPNTSYHPKPSSPSAIPLNEIILKL 66

Query: 56  PYLFPRGVAQSLEDYKVFSNNADKIQYDLLSTLPFFPEAKDGKRAEIVRTKIDEDDNFIN 115
           P LFPR + QS  D+K F  NA  +Q +LL+TLPFFP     + AEI+RT +D   N+IN
Sbjct: 67  PNLFPRSLEQSARDFKDFKLNAGALQSELLATLPFFPAGDSRRTAEIIRTTVDAQGNYIN 126

Query: 116 EFFIQPANVTEPSKLKHLIFIHGYGAGLGFFLKNFENIQLKDNSWCIHAIDLPGFGFSSR 175
           EF I+P  V     +KHLI +HGYGAGLGFFLK FEN+ L + +W IHAIDLPG+GFSSR
Sbjct: 127 EFNIRPTAVDTSKTMKHLILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFSSR 186

Query: 176 TKFPFKYPEDDVSKVQTWFHERLKIWFEKRDLLKNPGNNMVVAHSLGAYLMALYKRNNPL 235
             FPFK  +   ++V+ WFH R   W E+R LL+ P NNMVVAHS+GAYL ALY   +P 
Sbjct: 187 PPFPFKVGDSTPAQVEQWFHSRFHRWMERRGLLETPENNMVVAHSMGAYLTALYANKHPG 246

Query: 236 HFKKLIMCSPAGMCNST--VVKKQPPWWYAALWDMNLSPFSLVRNSGWLGSKLTSGWSYR 293
           HFKKL+MCSPAG+C+S   + K+ PPWW+A LWD N+SPFSLVRN+  LGSKLTSGWSYR
Sbjct: 247 HFKKLVMCSPAGVCHSAPEMRKRPPPWWFAKLWDKNISPFSLVRNANVLGSKLTSGWSYR 306

Query: 294 RF-RSLHSKI----QFENLHLYSYAIFNRPGCGEYLLAFALRCGGDPRVSLEATLFNDVV 348
           R  + L  K+    Q E LH Y+YAIFNR G GEYLL+FAL+CGG+PRV LE  LF++  
Sbjct: 307 RLGQLLKDKVLNARQHEALHRYAYAIFNRKGSGEYLLSFALQCGGEPRVPLERRLFHNRG 366

Query: 349 NKWDSDSEWVWLYGDRDWMDVKGGRRISQKINEIFPGKSSVEVIPNAGHHLYFDNISCFN 408
            ++ ++ EW+WLYGD+DW+D +GG R+SQ +      +S V+++ N+GHHLY DN   FN
Sbjct: 367 QQFKANCEWLWLYGDQDWIDRRGGERVSQFLTAEMGHESCVKIVKNSGHHLYLDNHRMFN 426

Query: 409 AILEKEM 415
            ILE EM
Sbjct: 427 KILEDEM 433

>Suva_7.395 Chr7 (684763..686118) [1356 bp, 451 aa] {ON} YGR110W
           (REAL)
          Length = 451

 Score =  463 bits (1192), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 230/410 (56%), Positives = 293/410 (71%), Gaps = 22/410 (5%)

Query: 29  KQSDSRVYVKTPTAPTAIPLTEIIVKLPYLFPRGVAQSLEDYKVFSNNADKIQYDLLSTL 88
           K +  +  ++TP+APTAIPL EII K+P LFPR +  S++D++ F  N D  Q +LL+TL
Sbjct: 44  KDAAEKRILRTPSAPTAIPLREIIYKVPGLFPRPLEDSVKDFRDFIKNEDSFQTELLATL 103

Query: 89  PFFPEAKDGKRAEIVRTKIDEDDNFINEFFIQPANVTEP-SKLKHLIFIHGYGAGLGFFL 147
           PF+P     K++++++T +D+D N+INEF I P   + P + LKHL+FIHGYGAGLGFF+
Sbjct: 104 PFYPNPSTTKKSKLIKTIVDDDGNYINEFCIYPQVPSVPEADLKHLVFIHGYGAGLGFFI 163

Query: 148 KNFENIQLKDNSWCIHAIDLPGFGFSSRTKFPFKYPEDDVSKVQTWFHERLKIWFEKRDL 207
           KNFE+I L +N WC+HAIDLPG+GFSSR KFPFKYP DD+  VQ WFHER+  WFEKR+L
Sbjct: 164 KNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFKYPRDDIHSVQDWFHERIHTWFEKRNL 223

Query: 208 LKNPGNNMVVAHSLGAYLMALY--KRNNPLHFKKLIMCSPAGMC-------NSTVVK-KQ 257
           L  P  N+V+AHSLG+YLMALY  K      FKKLI+CSPAG+        NS V K K 
Sbjct: 224 LNKPEKNIVMAHSLGSYLMALYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNSDVEKWKP 283

Query: 258 PPWWYAALWDMNLSPFSLVRNSGWLGSKLTSGWSYRRFRSL-----HSKIQFENLHLYSY 312
           PPWWY  LWD N+SPF+LVRNS   GSK+TSGWSYRRF+ +         +FE LH Y+Y
Sbjct: 284 PPWWYVKLWDKNISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDPDQSKRFEALHRYAY 343

Query: 313 AIFNRPGCGEYLLAFALRCGGDPRVSLEATLFN----DVVNKWDSDSEWVWLYGDRDWMD 368
           +IFN+ G GEYLL+FAL+CGG+PR+ LE  LFN    +V+   ++  EWVWLYGD DWMD
Sbjct: 344 SIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNGKNANVLK--NAKYEWVWLYGDDDWMD 401

Query: 369 VKGGRRISQKINEIFPGKSSVEVIPNAGHHLYFDNISCFNAILEKEMTKL 418
           V GG R+S+ +N+    KSSV  +PNAGHHLY DN   FN I+  EM K+
Sbjct: 402 VNGGLRVSKLLNDKLKQKSSVITVPNAGHHLYLDNHKFFNTIIMNEMQKV 451

>Skud_7.415 Chr7 (692655..694013) [1359 bp, 452 aa] {ON} YGR110W
           (REAL)
          Length = 452

 Score =  463 bits (1191), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 228/409 (55%), Positives = 298/409 (72%), Gaps = 19/409 (4%)

Query: 28  RKQSDSRVYVKTPTAPTAIPLTEIIVKLPYLFPRGVAQSLEDYKVFSNNADKIQYDLLST 87
           R  ++ R+ ++TP+APTAIPL EII K+P LFPR +  S++D++ F+ N D  Q +LL T
Sbjct: 44  RDGTEERI-LRTPSAPTAIPLREIIYKVPGLFPRPLEDSVKDFRDFTKNEDVFQTELLET 102

Query: 88  LPFFPEAKDGKRAEIVRTKIDEDDNFINEFFIQPANVTEP-SKLKHLIFIHGYGAGLGFF 146
           LPF+P     K++++++T +D+D N+INEF I P   + P ++LKHL+FIHGYGAGLGFF
Sbjct: 103 LPFYPNPSKYKKSKLIKTVVDDDGNYINEFCIYPQKPSVPETELKHLVFIHGYGAGLGFF 162

Query: 147 LKNFENIQLKDNSWCIHAIDLPGFGFSSRTKFPFKYPEDDVSKVQTWFHERLKIWFEKRD 206
           +KN E+I L DN WCIHAIDLPG+GFSSR KFPF+YP+D++  VQ WFHER+  WF KR+
Sbjct: 163 IKNLEDIPLLDNEWCIHAIDLPGYGFSSRPKFPFEYPKDNLHTVQDWFHERIHTWFNKRN 222

Query: 207 LLKNPGNNMVVAHSLGAYLMALY--KRNNPLHFKKLIMCSPAGMCN----STVVK----K 256
           LL  P  N+VVAHSLG+YLMALY  K      FKKL++CSPAG+ N    +T  +    K
Sbjct: 223 LLHKPDKNIVVAHSLGSYLMALYLQKYKESPSFKKLVLCSPAGVSNRDFDNTTAEVGKWK 282

Query: 257 QPPWWYAALWDMNLSPFSLVRNSGWLGSKLTSGWSYRRFRSL-----HSKIQFENLHLYS 311
            PPWWY  LWD N+SPF+LVRN+  LGSK+TSGWSYRRF+ +         +FE LH Y+
Sbjct: 283 PPPWWYVKLWDRNISPFTLVRNARQLGSKITSGWSYRRFKHILNGDPGQSRRFEALHRYA 342

Query: 312 YAIFNRPGCGEYLLAFALRCGGDPRVSLEATLFNDVVNKW--DSDSEWVWLYGDRDWMDV 369
           Y+IFN+ G GEYLL+FALRCGG+PR+ LE  LFN   +K   +S+ EWVWLYG+ DWMDV
Sbjct: 343 YSIFNKRGSGEYLLSFALRCGGEPRLPLEEQLFNGENSKVLKNSNYEWVWLYGNDDWMDV 402

Query: 370 KGGRRISQKINEIFPGKSSVEVIPNAGHHLYFDNISCFNAILEKEMTKL 418
            GG R+S+ +NE    KS+V ++P+AGHHLY DN + FN IL KEM  +
Sbjct: 403 DGGLRVSKYLNEKLGQKSNVFIVPHAGHHLYLDNYTFFNKILVKEMQNV 451

>YGR110W Chr7 (713709..715046) [1338 bp, 445 aa] {ON}
           CLD1Mitochondrial cardiolipin-specific phospholipase;
           functions upstream of Taz1p to generate
           monolyso-cardiolipin; transcription increases upon
           genotoxic stress; involved in restricting Ty1
           transposition; has homology to mammalian CGI-58
          Length = 445

 Score =  461 bits (1187), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 225/402 (55%), Positives = 291/402 (72%), Gaps = 22/402 (5%)

Query: 37  VKTPTAPTAIPLTEIIVKLPYLFPRGVAQSLEDYKVFSNNADKIQYDLLSTLPFFPEAKD 96
           ++TP+APTAIPL EII ++P LFPR +  S++D++ F  N D  Q +LL TLPF+P   +
Sbjct: 46  LRTPSAPTAIPLREIIYRVPSLFPRPLEDSVKDFRDFIKNEDAFQTELLKTLPFYPTPSE 105

Query: 97  GKRAEIVRTKIDEDDNFINEFFIQPANVTEP-SKLKHLIFIHGYGAGLGFFLKNFENIQL 155
            K A ++RT +D++ N+INEF I+P   + P + LKHL+FIHGYGAGLGFF+KNFE+I L
Sbjct: 106 SKTARLIRTVVDDEGNYINEFCIRPRKTSVPEADLKHLVFIHGYGAGLGFFIKNFEDIPL 165

Query: 156 KDNSWCIHAIDLPGFGFSSRTKFPFKYPEDDVSKVQTWFHERLKIWFEKRDLLKNPGNNM 215
            DN WCIHAIDLPG+GFSSR KFPF+YP D++  VQ WFHER+  WF KR+LL  P  N+
Sbjct: 166 LDNEWCIHAIDLPGYGFSSRPKFPFEYPRDNIHSVQDWFHERIHTWFSKRNLLNRPEKNI 225

Query: 216 VVAHSLGAYLMALY--KRNNPLHFKKLIMCSPAGMC----NSTVVK----KQPPWWYAAL 265
           V+AHSLG+YLMALY  K      FKKLI+CSPAG+     N+T  +    K PPWWY  L
Sbjct: 226 VMAHSLGSYLMALYLQKYKESPSFKKLILCSPAGVSYRDFNNTASEVEKWKPPPWWYVKL 285

Query: 266 WDMNLSPFSLVRNSGWLGSKLTSGWSYRRFRSL-----HSKIQFENLHLYSYAIFNRPGC 320
           WD N+SPF+LVRN   LGSK+TSGWSYRRF+ +         +FE LH Y+YAIFN+ G 
Sbjct: 286 WDRNISPFTLVRNFRQLGSKITSGWSYRRFKHILNGDPEQSKRFEALHRYAYAIFNKRGS 345

Query: 321 GEYLLAFALRCGGDPRVSLEATLFN----DVVNKWDSDSEWVWLYGDRDWMDVKGGRRIS 376
           GEYLL+FAL+CGG+PR+SLE  LF+    D++   +S+ +W+WLYGD DWMDV GG R+S
Sbjct: 346 GEYLLSFALKCGGEPRLSLEQQLFDGKKSDILK--NSNCDWLWLYGDDDWMDVNGGLRVS 403

Query: 377 QKINEIFPGKSSVEVIPNAGHHLYFDNISCFNAILEKEMTKL 418
           + + E    KS+V ++P++GHHLY DN   FN IL KEM K+
Sbjct: 404 RFLKEKLKQKSNVIIVPHSGHHLYLDNYKFFNNILTKEMQKI 445

>Smik_6.200 Chr6 (329969..331306) [1338 bp, 445 aa] {ON} YGR110W
           (REAL)
          Length = 445

 Score =  460 bits (1184), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 229/399 (57%), Positives = 290/399 (72%), Gaps = 18/399 (4%)

Query: 38  KTPTAPTAIPLTEIIVKLPYLFPRGVAQSLEDYKVFSNNADKIQYDLLSTLPFFPEAKDG 97
           +TP+APTAIPL EII K+P LFPR V  S++D++ F  + D  Q +LL TLPF+P     
Sbjct: 47  RTPSAPTAIPLREIIYKVPGLFPRPVGDSVKDFRDFIKSEDVFQTELLKTLPFYPNPSKL 106

Query: 98  KRAEIVRTKIDEDDNFINEFFIQPANVTEP-SKLKHLIFIHGYGAGLGFFLKNFENIQLK 156
           K++ ++RT +D+D N+INEF I+P N + P ++LKHLIFIHGYGAGLGFF+KNFE+I L 
Sbjct: 107 KKSRVIRTVVDDDGNYINEFCIRPINPSVPETELKHLIFIHGYGAGLGFFIKNFEDIPLL 166

Query: 157 DNSWCIHAIDLPGFGFSSRTKFPFKYPEDDVSKVQTWFHERLKIWFEKRDLLKNPGNNMV 216
           +N WC+HAIDLPG+GFSSR KFPF+YP D++  VQ WFH+RL  WF KR+LL  P  N+V
Sbjct: 167 NNEWCVHAIDLPGYGFSSRPKFPFEYPRDNLHDVQDWFHKRLHTWFNKRNLLNKPDKNVV 226

Query: 217 VAHSLGAYLMALY--KRNNPLHFKKLIMCSPAGM----CNSTVVK----KQPPWWYAALW 266
           +AHSLG+YLMALY  K      FKKLI+CSPAG+     N+T  +    K PPWWY  LW
Sbjct: 227 MAHSLGSYLMALYVQKYKERPSFKKLILCSPAGVSHRDSNNTTSEAEKWKPPPWWYVKLW 286

Query: 267 DMNLSPFSLVRNSGWLGSKLTSGWSYRRFR-----SLHSKIQFENLHLYSYAIFNRPGCG 321
           D N+SPF+LVRNS   GSK+TSGWSYRRF+      L    +FE LH Y+Y+IFN+ G G
Sbjct: 287 DRNISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDLKQSSRFEALHRYAYSIFNKRGSG 346

Query: 322 EYLLAFALRCGGDPRVSLEATLFND--VVNKWDSDSEWVWLYGDRDWMDVKGGRRISQKI 379
           EYLL+FAL+CGG+PR+ LE  LFND  +     S+ EW+WLYGD DWMDV GG R+S+ +
Sbjct: 347 EYLLSFALKCGGEPRLPLEEQLFNDRNLNILRSSNYEWLWLYGDDDWMDVNGGIRVSKFL 406

Query: 380 NEIFPGKSSVEVIPNAGHHLYFDNISCFNAILEKEMTKL 418
           NE    KS+V ++P+AGHHLY DN   FN IL KEM K+
Sbjct: 407 NEKLRQKSNVIIVPHAGHHLYLDNSKFFNDILVKEMRKV 445

>NCAS0E00860 Chr5 (157521..158843) [1323 bp, 440 aa] {ON} Anc_3.454
          Length = 440

 Score =  459 bits (1181), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 236/433 (54%), Positives = 293/433 (67%), Gaps = 22/433 (5%)

Query: 5   ALRGSLQAVLNR-------LKVFDLKNVRFRKQSDSRVYVKTPTAPTAIPLTEIIVKLPY 57
            L+ +LQ +  R        K    +NV     S++ +  +  T P AIP+T+II  LP 
Sbjct: 10  TLKTTLQTIFKRRQRIGTIAKQESQRNVTEYATSNT-ILPQPSTPPVAIPITDIITSLPS 68

Query: 58  LFPRGVAQSLEDYKVFSNNADKIQYDLLSTLPFFPEAKDGKRAEIVRTKIDEDDNFINEF 117
           LFPR +  S  DY  F+ + D +Q +LL TLPFFP     K A+++RT ID++ N+INEF
Sbjct: 69  LFPRSLHDSRRDYNTFTTDIDSLQLNLLKTLPFFPMGSSQKVAKLIRTPIDDEGNYINEF 128

Query: 118 FIQPA----NVTEPSKLKHLIFIHGYGAGLGFFLKNFENIQLKDNSWCIHAIDLPGFGFS 173
            I PA    + + P  LKHLIFIHGYGAGLGFFLKN ENI L DN WCIHAIDLPG+GFS
Sbjct: 129 CIMPAVKDGDYSSPD-LKHLIFIHGYGAGLGFFLKNLENIPLLDNKWCIHAIDLPGYGFS 187

Query: 174 SRTKFPFKYPEDDVSKVQTWFHERLKIWFEKRDLLKNPGNNMVVAHSLGAYLMALYKRNN 233
           SR KFPF YP D  +KVQ WFH+R+  WF +R+LL+NP NN+V+AHSLGAYLMA Y  + 
Sbjct: 188 SRFKFPFHYPNDSQTKVQKWFHDRIYRWFRERNLLQNPQNNLVMAHSLGAYLMAHYAFHF 247

Query: 234 PLHFKKLIMCSPAGMCNSTVVK--KQPPWWYAALWDMNLSPFSLVRNSGWLGSKLTSGWS 291
             HFKK+IMCSPAG+    V K  KQPPWWY  LWD+N SPFSLVRNSG  GSK+TSGWS
Sbjct: 248 SNHFKKIIMCSPAGVSQFAVGKQNKQPPWWYNKLWDLNYSPFSLVRNSGIYGSKITSGWS 307

Query: 292 YRRFRSLH----SKIQFENLHLYSYAIFNRPGCGEYLLAFALRCGGDPRVSLEATLFNDV 347
           YRRF+       ++ QFE LH Y+Y IFN+ G GEYLL+F L CGGDPR +LE  LF + 
Sbjct: 308 YRRFKPTSFNGLNESQFEALHKYTYGIFNKNGSGEYLLSFILSCGGDPRFALEDNLFKE- 366

Query: 348 VNKWDSDSEWVWLYGDRDWMDVKGGRRISQKINEIF--PGKSSVEVIPNAGHHLYFDNIS 405
            N  +   +WVW+YGDRDWMD+ G  RIS+++ +      KS V VIP+AGHHLY DN  
Sbjct: 367 ENPPEDLCDWVWVYGDRDWMDINGAHRISRRLVKKAGDTSKSKVHVIPSAGHHLYLDNYK 426

Query: 406 CFNAILEKEMTKL 418
            FN ++ KEM  +
Sbjct: 427 AFNNLIIKEMETM 439

>TPHA0O01310 Chr15 complement(258745..260061) [1317 bp, 438 aa] {ON}
           
          Length = 438

 Score =  417 bits (1072), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 198/376 (52%), Positives = 270/376 (71%), Gaps = 6/376 (1%)

Query: 46  IPLTEIIVKLPYLFPRGVAQSLEDYKVFSNNADKIQYDLLSTLPFFPEAKDGKRAEIVRT 105
           + L E+I + P LFPR   +S +DYK F ++ +  Q  LL TLP+FP+  +G  ++I  T
Sbjct: 59  LSLFELIKQFPRLFPRSFMKSFQDYKQFHSDVENFQVRLLETLPYFPDPSNGIYSKITNT 118

Query: 106 KIDEDDNFINEFFIQPANVTEPS-KLKHLIFIHGYGAGLGFFLKNFENIQLKDNSWCIHA 164
            +D++ + INEF + P+N++ PS KLKHLIF+HGYGAGLGFFLKN ENI+L ++ WC+HA
Sbjct: 119 IVDDEGSSINEFVVYPSNISVPSEKLKHLIFVHGYGAGLGFFLKNLENIKLLNDEWCVHA 178

Query: 165 IDLPGFGFSSRTKFPFKYPEDDVSKVQTWFHERLKIWFEKRDLLKNPGNNMVVAHSLGAY 224
           IDLPG+GFS+R KFPF+  +    +V  WFH R++ W  +R+LL++  NN ++AHSLGAY
Sbjct: 179 IDLPGYGFSTRAKFPFQVGKHRHDQVNEWFHSRIRNWMHQRNLLQHSQNNFLIAHSLGAY 238

Query: 225 LMALYKRNNPLHFKKLIMCSPAGMCNSTVVKKQ-PPWWYAALWDMNLSPFSLVRNSGWLG 283
           LMALY   +P   +K++MCSPAG+ +S  +KK+ P WW+  LW+ N+SPF+LVR+S ++G
Sbjct: 239 LMALYVDKHPNDLQKILMCSPAGIGDSMNLKKKTPAWWFEKLWERNISPFTLVRSSSYIG 298

Query: 284 SKLTSGWSYRRFRSLHSK---IQFENLHLYSYAIFNRPGCGEYLLAFALRCGGDPRVSLE 340
           SKLTSGW+YRRF SL S+    QFE LH Y+Y+IFN+ G GEYLL FAL+CGG PR  LE
Sbjct: 299 SKLTSGWTYRRFSSLLSQNNLKQFEALHKYTYSIFNQRGSGEYLLNFALKCGGGPRYPLE 358

Query: 341 ATLF-NDVVNKWDSDSEWVWLYGDRDWMDVKGGRRISQKINEIFPGKSSVEVIPNAGHHL 399
            TLF N+      S +EW+W YGD DWMD  GG R+S+ + +    +S V ++P AGHHL
Sbjct: 359 KTLFMNNDKGISKSSTEWIWAYGDNDWMDKNGGIRVSEILTKQLKKRSEVYIVPRAGHHL 418

Query: 400 YFDNISCFNAILEKEM 415
           YFDN   FN ++ KEM
Sbjct: 419 YFDNHQFFNDLILKEM 434

>CAGL0L04686g Chr12 (539203..540558) [1356 bp, 451 aa] {ON} similar
           to uniprot|P53264 Saccharomyces cerevisiae YGR110w
          Length = 451

 Score =  410 bits (1054), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 211/410 (51%), Positives = 264/410 (64%), Gaps = 34/410 (8%)

Query: 41  TAPTAIPLTEIIVKLPYLFPRGVAQSLEDYKVFSNNADKIQYDLLSTLPFFPEAKDGKRA 100
           TAPTA PL EI+  LP LFPR +A+S  DY  F +N D +Q +LL TLPFF      KRA
Sbjct: 43  TAPTAKPLYEIVRDLPRLFPRSLAESKRDYATFHSNVDLMQLELLRTLPFFERTGYNKRA 102

Query: 101 EIVRTKIDEDDNFINEFFIQPANVTEPSKLKHLIFIHGYGAGLGFFLKNFENIQLKDNSW 160
            + +T+ID D N+INE  I+PANV    K K LIF+HGYGAGLGF+LKN+E++ L D+SW
Sbjct: 103 YLRKTEIDSDGNYINELVIEPANVDPNKKRKRLIFVHGYGAGLGFYLKNYEHLPLLDDSW 162

Query: 161 CIHAIDLPGFGFSSRTKFPFKYPEDDVSKVQTWFHERLKIWFEKRDLLKNPGNNMVVAHS 220
            IHAIDLPG+GFSSR  FPF++P DD S V  WF  RL+  FEKR   K+  +N+V+AHS
Sbjct: 163 SIHAIDLPGYGFSSRMDFPFQFPRDDTSVVCDWFISRLRTLFEKRGFDKS--DNIVMAHS 220

Query: 221 LGAYLMALYKRNNPLHFKKLIMCSPAGMCNST-------------------VVKKQPPWW 261
           +GAYLMA Y    P   KK++MCSPAG+  S                    +  K+ PWW
Sbjct: 221 MGAYLMAFYLNKYPDSVKKMVMCSPAGISRSQYSINNNITEDISSGKEEIKLKIKKVPWW 280

Query: 262 YAALWDMNLSPFSLVRNSGWLGSKLTSGWSYRRFRSL-----HSKIQFENLHLYSYAIFN 316
           Y  LWD N+SPF LVR +G LGSK+TSGW+YRRF+ +     ++  QFE LH YS+AIFN
Sbjct: 281 YTKLWDRNISPFVLVRKTGILGSKITSGWTYRRFKPILLNKENNYEQFEKLHRYSFAIFN 340

Query: 317 RPGCGEYLLAFALRCGGDPRVSLEATLFNDVVNKW--------DSDSEWVWLYGDRDWMD 368
             G GEYLL+F L CGGDPR  LE +LF+   NK+        +S  EWVW+YG  DWMD
Sbjct: 341 MKGSGEYLLSFVLECGGDPRSPLENSLFSSDANKFGIDNAGIKNSSCEWVWVYGANDWMD 400

Query: 369 VKGGRRISQKINEIFPGKSSVEVIPNAGHHLYFDNISCFNAILEKEMTKL 418
           + G  R+++        KS V  IP +GHHLYFDN   FN++L  EM  L
Sbjct: 401 IHGAERVTKDFLMNNRKKSRVVTIPESGHHLYFDNYPMFNSLLIDEMKSL 450

>KLLA0B12914g Chr2 (1126975..1128255) [1281 bp, 426 aa] {ON} similar
           to uniprot|P53264 Saccharomyces cerevisiae YGR110W
          Length = 426

 Score =  377 bits (968), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 195/381 (51%), Positives = 255/381 (66%), Gaps = 9/381 (2%)

Query: 37  VKTPTAPTAIPLTEIIVKLPYLFPRGVAQSLEDYKVFSNNADKIQYDLLSTLPFFPEAKD 96
           V+  TAP  +PL +I+  L  LFP   A+SL+DYK ++ N ++ Q DLLS LP++PE   
Sbjct: 54  VRKSTAPIGLPLLQIVTNLHKLFPLSFAESLKDYKQYNINKEQFQEDLLSVLPYYPEPSA 113

Query: 97  GKRAEIVRTKIDEDDNFINEFFIQPANVTEPSK-LKHLIFIHGYGAGLGFFLKNFENIQL 155
              ++I++T ID   N+INEF I P       K LKH+I +HGYGAGLGF+LKNF N  L
Sbjct: 114 RFSSKIIKTPIDAAGNYINEFQITPIRPESDGKPLKHIILVHGYGAGLGFYLKNF-NALL 172

Query: 156 KDNSWCIHAIDLPGFGFSSRTKFPFKYPEDDVSKVQTWFHERLKIWFEKRDLLKNPGNNM 215
            +N   +HAIDLPG+GFSSR  FPF YP+D    V+ +FH+ L  WF+K+ L+    NN 
Sbjct: 173 SENV-VVHAIDLPGYGFSSRPMFPFHYPKDSYLAVEDYFHDALHKWFDKKGLISCWENNY 231

Query: 216 VVAHSLGAYLMALYKRNNPLHFKKLIMCSPAGMCNSTVVKKQPPWWYAALWDMNLSPFSL 275
           V+AHS+GAY+ +LY  N   HFKKL MCSP G+  +  +   PPWW+  LWD N+SPFSL
Sbjct: 232 VIAHSMGAYIFSLYA-NKYKHFKKLFMCSPGGISRNKDMPP-PPWWFLKLWDQNISPFSL 289

Query: 276 VRNSGWLGSKLTSGWSYRRFRSLHSKIQFENLHLYSYAIFNRPGCGEYLLAFALRCGGDP 335
           VRN+G +GSKL SGW+ RRF   H    F+ LH Y+Y IFN+PG GEY+L+F L CGG P
Sbjct: 290 VRNAGHVGSKLVSGWTARRFGLHHP--NFDKLHHYTYGIFNQPGSGEYMLSFMLGCGGWP 347

Query: 336 RVSLEATLFNDVVNKWDSDSEWVWLYGDRDWMDVKGGRRISQKINEIFPGKSSVEVIPNA 395
           RV LE  LF +  N   S  +WVWLYGD DWMD+ G RRI+  + +     + +E++PNA
Sbjct: 348 RVPLETRLFTE-ENFNSSHLDWVWLYGDSDWMDINGARRINDFLRKKCI-NTKLEIVPNA 405

Query: 396 GHHLYFDNISCFNAILEKEMT 416
           GHHLY+DN S FN +L KE+ 
Sbjct: 406 GHHLYWDNDSFFNNVLRKELV 426

>TBLA0F03460 Chr6 (853280..854605) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score =  353 bits (906), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 192/408 (47%), Positives = 251/408 (61%), Gaps = 39/408 (9%)

Query: 37  VKTPTAPTAIPLTEIIVKLPYLFPRGVAQSLEDYKVFSNNADKIQYDLLSTLPFFPEA-- 94
           +K  TAP A  L +I+  LP LFPR +  S+ DY  F  N +  Q  LLS L F+P    
Sbjct: 42  LKPSTAPKAASLPQILRNLPRLFPRSMTDSIRDYSQFKTNPEFFQDRLLSQLSFYPSLYN 101

Query: 95  ---------KDGKRAEIVRTKIDEDDNFINEFFIQPANVTEPSKLKHLIFIHGYGAGLGF 145
                     D ++ +I++T ++E++ +INEF I P   T   +LKHLI IHGYGAGLGF
Sbjct: 102 NNSNDTSGNDDPRQGQIIKTYVNENE-YINEFQILPNTSTPYDRLKHLILIHGYGAGLGF 160

Query: 146 FLKNFENIQLKDNSWCIHAIDLPGFGFSSRTKFPFK------YPEDDVSKVQTWFHERLK 199
           ++   +++ + +  WCIHA+DLPG+GFSSR KFP+       Y + DV     WF +RLK
Sbjct: 161 YINTLQHLSMDN--WCIHAVDLPGYGFSSRLKFPYGTINPRIYSKKDVLD---WFQKRLK 215

Query: 200 IWFEKRDLLKNPGNNMVVAHSLGAYLMALYKRNNPLHFKKLIMCSPAGMCNSTVVKKQPP 259
            WF K+ LL +P NN+V AHS+GAY+M  Y  N+P  F+K+IMCSPAG   ++      P
Sbjct: 216 TWFHKKGLLAHPENNLVTAHSMGAYIMCHYLNNHPSDFRKIIMCSPAGFYPASNPLTNIP 275

Query: 260 WWYAALWDMNLSPFSLVRNSGWLGSKLTSGWSYRRFRSLHSKIQFEN-----LHLYSYAI 314
            WY  LWD N SPFSLVR SG LGSKLTSGWSY RF   HS     N     LH Y+Y+I
Sbjct: 276 LWYTYLWDRNYSPFSLVRISGPLGSKLTSGWSYSRF--FHSNQTISNELSLALHTYAYSI 333

Query: 315 FNRPGCGEYLLAFALRCGGDPRVSLEATLF------NDVVNKWDSDSEWVWLYGDRDWMD 368
           FN PG GEY L+  L+ GGDPR  L+   F      N+ + +  S+ E+ WLYG  DW++
Sbjct: 334 FNLPGSGEYSLSHILKAGGDPRTPLQEEFFTCQSTTNNGIRR--SNVEYSWLYGQSDWIN 391

Query: 369 VKGGRRISQKINEIFPGKSSVEVIPNAGHHLYFDNISCFNAILEKEMT 416
             GG +ISQ +N +   KS+V + PN+GHHLYFDN   FN+ L KEMT
Sbjct: 392 KTGGFKISQFLNSL-NKKSNVFIAPNSGHHLYFDNYMWFNSYLAKEMT 438

>KLTH0C01254g Chr3 complement(113435..114739) [1305 bp, 434 aa] {ON}
           conserved hypothetical protein
          Length = 434

 Score =  171 bits (434), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 123/403 (30%), Positives = 186/403 (46%), Gaps = 77/403 (19%)

Query: 76  NADKIQYDLLSTLPFFPEAKDGKRAEIVRTKIDEDDNFINEFFIQPANVTEPSKLKHLIF 135
           +A + +  LLSTL FFP     +  E++   I  +   I+EF IQ          K L+ 
Sbjct: 38  DAKENEKKLLSTLEFFPGGDSIRNCELLDVDIG-NKQHIHEFSIQNIESCSRDYCKDLVM 96

Query: 136 IHGYGAGLGFFLKNFENIQLKDNSWCIHAIDLPGFGFSSRTKFPF-----------KYPE 184
           +HGYGA LG F++NF+ +  +     +HA+D+ G G SSR +FP            +  +
Sbjct: 97  VHGYGAALGLFVRNFDGLS-RIPGINLHALDMLGCGLSSRPRFPGTGLISSVIKRGRVTK 155

Query: 185 DDVSKVQTWFHERLKIWFEKRDLLKNPGNNMVVAHSLGAYLMALYKRNNPLHFKKLIMCS 244
           ++V + + +F + L+ W ++R L K     ++V HSLG YL   Y    P   +KL++ S
Sbjct: 156 EEVYEAENFFIDSLEKWRQQRKLDKF----VLVGHSLGGYLSCCYALKFPERVEKLVLVS 211

Query: 245 PAGMCNSTV--------------------------------------------------- 253
           P G+  S                                                     
Sbjct: 212 PVGVEKSVFDLTKEHTPSHNNASELGPDLSKEVTNSSGRPTTDDPVKTSSSFHVPDEAGN 271

Query: 254 VKKQP--PWWYAALWDMNLSPFSLVRNSGWLGSKLTSGWSYRRFRSLHSKIQFENLHLYS 311
           V++ P  PW ++++W  N+SPF L+R++G  G  L+S WS+RRF    +  Q    H Y 
Sbjct: 272 VERVPNMPWIFSSMWTYNISPFGLLRSAGPAGPLLSSRWSFRRFSFAENTEQLLTFHEYC 331

Query: 312 YAIFNRPGCGEYLLAFALRCGGDPRVSLEATLFNDVVNKWDSDSEWVWLYGDRDWMDVKG 371
           Y+IF+  G GEY L   L  G   RV L + +  ++  K DS     W+YG  DWM  + 
Sbjct: 332 YSIFSGSGSGEYALTRILAPGVLARVPLLSRVPENL--KCDS----FWMYGSHDWMSKEA 385

Query: 372 GRRISQKINEIFPG-KSSVEVIPNAGHHLYFDNISCFNAILEK 413
           G  I ++IN+     K+   V+ +AGHHLY DN   FN  L K
Sbjct: 386 GSVIVRQINKTKGSVKADYSVVSDAGHHLYLDNPEEFNQKLAK 428

>SAKL0G19074g Chr7 (1646858..1648156) [1299 bp, 432 aa] {ON}
           conserved hypothetical protein
          Length = 432

 Score =  162 bits (411), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 119/395 (30%), Positives = 177/395 (44%), Gaps = 77/395 (19%)

Query: 81  QYDLLSTLPFFPEAKDGKRAEIVRTKIDEDDNFINEFFIQPANVTEPSKLKHLIFIHGYG 140
           + ++LS L F+PE  + +R E +   I    N I+EF I+    ++    + ++ +HGYG
Sbjct: 45  EENILSMLDFYPEGDESRRCETMDVDIGTG-NSIHEFCIENTKESDRDYCRDMVLVHGYG 103

Query: 141 AGLGFFLKNFENIQLKDNSWCIHAIDLPGFGFSSRTKFP-----------FKYPEDDVSK 189
           A LG F++NF+ +  +     +HAID+ G+G SSR KFP            +  ++DV  
Sbjct: 104 AALGLFIRNFDGLS-QIPGIRLHAIDMLGYGLSSRPKFPDTGFLTSFWKKREVTKEDVLL 162

Query: 190 VQTWFHERLKIWFEKRDLLKNPGNNMVVAHSLGAYLMALYKRNNPLHFKKLIMCSPAGM- 248
            + +F + ++ W  KR L K     ++V HSLG YL   Y    P   +KLI+ SP G+ 
Sbjct: 163 AEDFFIDSIETWRHKRHLDK----FVLVGHSLGGYLSCRYALKYPERVEKLILVSPVGVE 218

Query: 249 --------------------------------CNSTVVKK-QP----------------- 258
                                            NST  K  QP                 
Sbjct: 219 TSIFDLTKEHTATHEHAAELGPDIAQELKVVPENSTTDKPVQPSSSFHVPNESGHVERIP 278

Query: 259 --PWWYAALWDMNLSPFSLVRNSGWLGSKLTSGWSYRRFRSLHSKIQFENLHLYSYAIFN 316
             P     +W+ N+SPF ++R+ G  G  L S WS+RRF     K Q    H Y+Y  FN
Sbjct: 279 NLPKIVRIIWENNISPFGILRSLGPWGPLLCSRWSFRRFSHCGDKEQVMKFHDYAYNTFN 338

Query: 317 RPGCGEYLLAFALRCGGDPRVSLEATLFNDVVNKWDSDSEWVWLYGDRDWMDVKGGRRIS 376
             G GEY L   L  G   R+ L +    ++        E +W+YG  DWM  + G  I 
Sbjct: 339 ARGSGEYALTRILAPGVLARIPLLSCAPKNL------KCESLWMYGSHDWMSKEAGSVIV 392

Query: 377 QKINEIFPGKSSVEVIPNAGHHLYFDNISCFNAIL 411
           +++N+     +   V+ +AGHHLY DN   FN  L
Sbjct: 393 KELNKA-GNTADYSVVSDAGHHLYLDNPHEFNQKL 426

>Ecym_5577 Chr5 (1185997..1187298) [1302 bp, 433 aa] {ON} similar to
           Saccharomyces cerevisiae YGR110W
          Length = 433

 Score =  137 bits (345), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 110/411 (26%), Positives = 185/411 (45%), Gaps = 74/411 (18%)

Query: 68  EDYKVFSNNA--DKIQYDLLSTLPFFPEAKDGKRAEIVRTKIDEDDNFINEFFIQPANVT 125
           E +K + ++A   + + ++L  L F+P+    +  E++   I   D +++EF I+     
Sbjct: 26  ESFKTWKSSARLHEAEDNVLRMLSFYPDGDSERTCEVLHVDIGGGD-YMHEFCIENKLPM 84

Query: 126 EPSKLKHLIFIHGYGAGLGFFLKNFENIQLKDNSWCIHAIDLPGFGFSSRTKFPFK---- 181
                K ++ +HGYG  LG F++NF+ +  +     +HAID+ G+G SSR +FP      
Sbjct: 85  TRDTCKDIVLVHGYGTALGVFIRNFDELS-QIPGVRLHAIDMLGYGLSSRPRFPRSGFWD 143

Query: 182 -------YPEDDVSKVQTWFHERLKIWFEKRDL-------------------LKNPGN-- 213
                    ++ V +   +F + L+ W EKR++                   L++P    
Sbjct: 144 YYVKGKVVTKEQVEEALAFFVDSLEAWREKRNVDSFVLVGHSLGGYLSSFYALRHPERID 203

Query: 214 ---------------NMVVAHS--------LGAYLMALYKRNNPLHFKKLIMCSPAGMCN 250
                          ++   H+        LG  + + +K +   H   L + S +   +
Sbjct: 204 KLVLVSPVGVETSIYDLTAEHTPEHQHAGQLGPEVASEFKEDATEHTTDLSIDSNSPQSS 263

Query: 251 STVVKKQP---------PWWYAALWDMNLSPFSLVRNSGWLGSKLTSGWSYRRFRSLHSK 301
           S  +  +          PW    LW+ N+SPFSL+R  G LG K+ + WS+RRF +    
Sbjct: 264 SLHIPNEKGFVEHVPNIPWLVKMLWNTNVSPFSLLRLLGPLGPKICANWSFRRFGACKDT 323

Query: 302 IQFENLHLYSYAIFNRPGCGEYLLAFALRCGGDPRVSLEATLFNDVVNKWDSDSEWVWLY 361
            +  N H Y+Y  F   G GEY +   L  G   RV L + L   +  K DS    +W+Y
Sbjct: 324 NELMNFHQYAYNNFKAKGSGEYAMMKILAPGALARVPLLSQLPGAL--KCDS----LWMY 377

Query: 362 GDRDWMDVKGGRRISQKINEIFPGKSSVEVIPNAGHHLYFDNISCFNAILE 412
           G  DWM  + G  I +++ E    ++  +++ NAGHHLY DN   FN  L+
Sbjct: 378 GSNDWMSKEAGCIIVEELQEKSDYRAEYKIVNNAGHHLYLDNPEEFNRELK 428

>Kwal_14.985 s14 complement(142781..144088) [1308 bp, 435 aa] {ON}
           YDR125C (ECM18) - (putative) involved in cell wall
           biogenesis [contig 244] FULL
          Length = 435

 Score = 98.2 bits (243), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 98/188 (52%), Gaps = 17/188 (9%)

Query: 75  NNADKIQYDLLSTLPFFPEAKDGKRAEIVRTKIDEDDNFINEFFIQPANVTEPSKLKHLI 134
           +NA + +  LLSTL FFP+    ++ +I+   I  D   I+E  I+    +  S    L+
Sbjct: 38  SNARENEKQLLSTLEFFPQGDSTRKCKILDVDIG-DKQTIHELEIENLKTSSRSYANDLV 96

Query: 135 FIHGYGAGLGFFLKNFENIQLKDNSWCIHAIDLPGFGFSSRTKFP-----------FKYP 183
            +HGYGA LG F++NF+ +        +HAID+ G G SSR KFP               
Sbjct: 97  LVHGYGAALGLFVRNFDGLS-SVPGIKLHAIDMLGCGLSSRPKFPGTGLISSLIKRGNVT 155

Query: 184 EDDVSKVQTWFHERLKIWFEKRDLLKNPGNNMVVAHSLGAYLMALYKRNNPLHFKKLIMC 243
           +++V + + +F + ++ W +KR + K     ++V HSLG YL + Y    P   +KL++ 
Sbjct: 156 KEEVYEAEDFFVDSMEKWRKKRQVEK----FVLVGHSLGGYLSSCYALKYPERVEKLVLV 211

Query: 244 SPAGMCNS 251
           SP G+  S
Sbjct: 212 SPVGVEKS 219

 Score = 96.7 bits (239), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 55/153 (35%), Positives = 82/153 (53%), Gaps = 7/153 (4%)

Query: 262 YAALWDMNLSPFSLVRNSGWLGSKLTSGWSYRRFRSLHSKIQFENLHLYSYAIFNRPGCG 321
           ++ +W  N+SPF ++R  G +G  ++S WS+RRF       Q    H Y Y +F+  G G
Sbjct: 283 FSYMWTYNISPFGILRTLGPVGPLISSNWSFRRFSFTDDPKQLLTFHEYCYGVFSGAGSG 342

Query: 322 EYLLAFALRCGGDPRVSLEATLFNDVVNKWDSDSEWVWLYGDRDWMDVKGGRRISQKINE 381
           EY L   L  G   R+ L + +  ++  K DS     W+YG +DWM  + G  + +K+NE
Sbjct: 343 EYALTRILAPGVLARLPLLSRMPGNL--KCDS----FWMYGSQDWMSKEAGSVMVKKLNE 396

Query: 382 IFP-GKSSVEVIPNAGHHLYFDNISCFNAILEK 413
               GK+   ++ +AGHHLY DN   FN  L K
Sbjct: 397 SPGLGKADFSIVSDAGHHLYLDNPEEFNRKLLK 429

>YLR099C Chr12 complement(339744..340928) [1185 bp, 394 aa] {ON}
           ICT1Lysophosphatidic acid acyltransferase, responsible
           for enhanced phospholipid synthesis during organic
           solvent stress; null displays increased sensitivity to
           Calcofluor white; highly expressed during organic
           solvent stress
          Length = 394

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 87/337 (25%), Positives = 145/337 (43%), Gaps = 69/337 (20%)

Query: 134 IFIHGYGAGLGFFLKNFENIQLKDNSWCIHAIDLPGFGFS-------SRTK----FPFKY 182
           + IHGY A    F + FEN  L DN   ++AIDLP  G S       ++TK      FK+
Sbjct: 74  VLIHGYAASSMAFYRTFEN--LSDNIKDLYAIDLPANGASEAPALQVNKTKKIKSLRFKH 131

Query: 183 PEDDV------------------SKVQTWFHERLKIWFEKRDLLKNPGNNMVVAHSLGAY 224
            EDDV                   + +++F +R++ W +   L K      VV HS G Y
Sbjct: 132 IEDDVVIPVIEKRPPAEDIKSHLEQYESYFVDRIEQWRKDNKLRKI----NVVGHSFGGY 187

Query: 225 LMALYKRNNPLHFKKLIMCSPAGMCNS---TVVKKQPPWWYAALWD----------MNLS 271
           +   Y    P   +KL + SP G+ NS      K +P   Y   +           +N+ 
Sbjct: 188 ISFKYALKYPDSIEKLCLISPLGVENSIHAITHKWEPNTTYPLTFTDPSSRYYTRKLNVP 247

Query: 272 PF------SLVRNSGWLGSKLTSGWSYRRFRSLHSKIQFENLHLYSYAIFNRPGCGEYLL 325
            F      ++++  G +GSKL S +    +  +  +I +++  L+S+   N+    + + 
Sbjct: 248 RFIFENQLNVLKWMGPIGSKLCSNYISTAYVKVPDQI-YKDYLLHSFVGKNQTVQPQTIK 306

Query: 326 AFAL-----RCGGDPRVSLEATLFNDVVNKWDSDSEWVWLYGDRDWMDVKGGRRISQKIN 380
            F           DP +        + V   +  +  +++YG+ DWMD   G   ++ + 
Sbjct: 307 VFTHLFERNLIARDPII--------NNVRFLNPATPVMFMYGEHDWMDKYAGYLTTESML 358

Query: 381 EIFPGKSSVEVIPNAGHHLYFDNISCFNAILEKEMTK 417
           +     S VEV P+AGH+L+ DN   F + L   ++K
Sbjct: 359 KNKAKASYVEV-PDAGHNLFLDNPQHFASSLVSFLSK 394

>AGR062C Chr7 complement(833212..834366) [1155 bp, 384 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR099C
           (ICT1) and YDR125C (ECM18)
          Length = 384

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 79/330 (23%), Positives = 133/330 (40%), Gaps = 66/330 (20%)

Query: 122 ANVTEPSKLKHLIFIHGYGAGLGFFLKNFENIQLKDNSWCIHAIDLPGFGFSSRTKF--- 178
           AN   P +    + +HGY +    F +N   +  +     ++A+DLPG G S        
Sbjct: 75  ANAGAPIRTP-TVLLHGYASSAVSFHRNLAALGAQVEQ--LYALDLPGNGMSQELPLGPA 131

Query: 179 ------PFKYPEDDVSKVQTWFHERLKIWFEKRDLLKNPGNNMVVAHSLGAYLMALYKRN 232
                        D+  +  ++ + L+ W     L           HS G YL   Y   
Sbjct: 132 AARALARRCGARADIRALADYYLDALERWRAANGL----ETLNAAGHSFGGYLAFKYALR 187

Query: 233 NPLHFKKLIMCSPAGMCNSTVVKKQP---------------PWWYAA------LWDMNLS 271
           +P   ++L + SP G+   T  ++ P               P +  A      L++  L 
Sbjct: 188 HPARVQRLCLVSPLGVEAQTAGRRMPGRATRRRTRPPTPASPHYTRAAALPPLLFEQQL- 246

Query: 272 PFSLVRNSGWLGSKLTSGWSYRRFRSLHSKIQFENLHLYSYAIFNRPGCGEYLLAFALRC 331
              ++R  G LG+ L   W Y    +  S++     H Y++A+ +R          ALR 
Sbjct: 247 --RVLRWLGPLGAHLL--WQY--VNASFSRVPGREFHRYTFALLHR---------LALRP 291

Query: 332 GGDPRVSLEATLFNDVVNK---WDSDSEW-----VWLYGDRDWMDVKGGRRISQKINEIF 383
              PR        N ++ +    DS +E        LYGD DWMD + GR +  ++N + 
Sbjct: 292 --LPRKLFTGLFTNALLARDPLLDSLAELKVPNVQLLYGDHDWMDARAGRALVAELNALR 349

Query: 384 PGK--SSVEVIPNAGHHLYFDNISCFNAIL 411
            G+  +S+ ++P AGH+L+ DN   F++ L
Sbjct: 350 -GRPDASLAIVPAAGHNLFLDNPEDFHSWL 378

>Kpol_543.49 s543 complement(108945..110234) [1290 bp, 429 aa] {ON}
           complement(108945..110234) [1290 nt, 430 aa]
          Length = 429

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 83/342 (24%), Positives = 134/342 (39%), Gaps = 90/342 (26%)

Query: 134 IFIHGYGAGLGFFLKNFENIQLKDNSWCIHAIDLPGFGFSSRTKFPFKYPEDD------- 186
           + IHGY A    + + F    L D    ++AIDLP FG S+     FK    D       
Sbjct: 103 LLIHGYAASSLAYFRTFSG--LSDKIKNLYAIDLPSFGLSNAPPLDFKEKVSDIKIKLSD 160

Query: 187 ---------------------VSKVQTWFHERLKIWFEKRDLLKNPGNNMVVAHSLGAYL 225
                                + K + ++ E+++ W +   L K      +V HS G Y+
Sbjct: 161 DNTKFKISDSNRVDSLDLKKLIGKYEDYYVEKIEDWRKANKLEKIN----LVGHSFGGYI 216

Query: 226 MALYKRNNPLHFKKLIMCSPAGM-------CNSTVVKKQPPW--------WYAALWDM-N 269
              Y    P    +L + SP GM        N+   KK+ P         +YA    + N
Sbjct: 217 SFKYAIKYPDAINRLCLVSPLGMESNIHSVNNNFETKKEYPLDLEDPSSRFYAKERRIPN 276

Query: 270 L---SPFSLVRNSGWLGSKLTSGWSYRRFRSLHSKIQFENLHLYSYAIFNRPGCGEYLLA 326
               +  +++R  G +GSKL   W+Y                  SY     P   EYL  
Sbjct: 277 FLFKNQLNVLRWMGPIGSKLC--WNYIN---------------ASYRRVPNPLFKEYLFE 319

Query: 327 FALRCGGDPRVSLE--ATLFN----------DVVNKWDSDSEWVWLYGDRDWMDVKGGRR 374
                GG P V+++    LF           D ++K  ++ + + LYG+ DWM+   G  
Sbjct: 320 LLYGKGGMPSVTIDIFTNLFTRSLLARDPIMDSISKLKAE-KVLLLYGEHDWMNNLAGYN 378

Query: 375 ISQKINEIFPGKSSVEV-------IPNAGHHLYFDNISCFNA 409
           + + +N++ P  +   +       +P+AGH+L+ DN   FN+
Sbjct: 379 MVESLNQLKPNNNISTIDYANYVEVPDAGHNLFLDNPQFFNS 420

>Skud_12.167 Chr12 complement(322870..324054) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 68.6 bits (166), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 84/337 (24%), Positives = 142/337 (42%), Gaps = 69/337 (20%)

Query: 134 IFIHGYGAGLGFFLKNFENIQLKDNSWCIHAIDLPGFGFSS-------RTK----FPFKY 182
           + IHGY A    F + FE+  L DN   ++AIDLP  G S        +TK      FK+
Sbjct: 74  VLIHGYAASSMAFYRTFES--LSDNIKDLYAIDLPANGASQAPALQVDKTKKIKPLRFKH 131

Query: 183 PEDDV------------------SKVQTWFHERLKIWFEKRDLLKNPGNNMVVAHSLGAY 224
            EDDV                   + + +F +R++ W +   L +      VV HS G Y
Sbjct: 132 IEDDVVVPVLDKHPPAEDIKSHLEQYENYFVDRIEQWRKDNKLRRI----NVVGHSFGGY 187

Query: 225 LMALYKRNNPLHFKKLIMCSPAGMCNS---TVVKKQPPWWYAALWD----------MNLS 271
           +   Y    P    KL + SP G+ NS      K +P   Y   +           +N+ 
Sbjct: 188 ISFKYALKYPNSIDKLCLISPLGVENSIHAIAHKWEPNTTYPLTFTDPSSRYYTRKLNVP 247

Query: 272 PF------SLVRNSGWLGSKLTSGWSYRRFRSLHSKIQFENLHLYSYAIFNRPGCGEYLL 325
            F      ++++  G +GSKL S +    +  +  ++ +++  L+S+   N+    + + 
Sbjct: 248 QFIFENQLNVLKWMGPIGSKLCSNYISTAYVKVPDQL-YKDYLLHSFVGKNQTVQPQTIK 306

Query: 326 AFAL-----RCGGDPRVSLEATLFNDVVNKWDSDSEWVWLYGDRDWMDVKGGRRISQKIN 380
            F           DP +        + V   +  +  +++YG+ DWMD   G   ++ + 
Sbjct: 307 VFTHLFERNLIARDPII--------NNVGLLNPATHVMFMYGEHDWMDKYAGYLTTESML 358

Query: 381 EIFPGKSSVEVIPNAGHHLYFDNISCFNAILEKEMTK 417
           +     S VEV P+AGH+L+ DN   F + L   ++K
Sbjct: 359 KNKAKASYVEV-PDAGHNLFLDNPHHFTSSLVSFLSK 394

>Suva_10.183 Chr10 complement(344549..345733) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 81/338 (23%), Positives = 140/338 (41%), Gaps = 71/338 (21%)

Query: 134 IFIHGYGAGLGFFLKNFENIQLKDNSWCIHAIDLPGFGFSSRTKFP-----------FKY 182
           + IHGY A    F + F+N  L DN   ++AIDLP  G S                 FK+
Sbjct: 74  VLIHGYAASSMAFYRTFKN--LSDNIKDLYAIDLPANGASEAPALQVEGVKKIKSLRFKH 131

Query: 183 PEDDV------------------SKVQTWFHERLKIWFEKRDLLKNPGNNMVVAHSLGAY 224
            EDD+                   + +++F +R++ W +  +L K      VV HS G Y
Sbjct: 132 VEDDMVTPVLDKRPPAEEIKSHLEQYESYFVDRIEQWRKDNNLRKI----NVVGHSFGGY 187

Query: 225 LMALYKRNNPLHFKKLIMCSPAGMCNST--------------VVKKQPPWWYAALWDMNL 270
           +   Y    P    KL + SP G+ NS               V    P   Y     +N+
Sbjct: 188 ISFKYALKYPNSIDKLCLISPLGVENSIHAINHKWEANTTYPVTFTDPSSRYYTR-KLNV 246

Query: 271 SPF------SLVRNSGWLGSKLTSGWSYRRFRSLHSKIQFENLHLYSYAIFNRPGCGEYL 324
             F      ++++  G +GSKL S +    +  +  ++ +++  L+S+   N+    + +
Sbjct: 247 PQFIFENQLNVLKWMGPIGSKLCSSYISTAYVKVPDQL-YKDYLLHSFVGKNQSVQPQTI 305

Query: 325 LAFAL-----RCGGDPRVSLEATLFNDVVNKWDSDSEWVWLYGDRDWMDVKGGRRISQKI 379
             F           DP ++    L N         +  +++YG+ DWMD   G   ++ +
Sbjct: 306 KVFTQLFERNLIARDPIIN-NVGLLNPA-------THVMFMYGEHDWMDKYAGYLTTESM 357

Query: 380 NEIFPGKSSVEVIPNAGHHLYFDNISCFNAILEKEMTK 417
            +    K+S   +P+AGH+L+ DN + F + L   ++K
Sbjct: 358 LK-NKAKASYMEVPDAGHNLFLDNPNHFTSSLVSFLSK 394

>Smik_12.158 Chr12 complement(319660..320844) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 82/323 (25%), Positives = 137/323 (42%), Gaps = 69/323 (21%)

Query: 134 IFIHGYGAGLGFFLKNFENIQLKDNSWCIHAIDLPGFGFSS-------RTK----FPFKY 182
           + IHGY A    F + FE+  L +N   ++AIDLP  G S        +TK      FK+
Sbjct: 74  VLIHGYAASSMAFYRTFES--LSNNIKDLYAIDLPANGASEAPVLQVDKTKKVKSLRFKH 131

Query: 183 PEDDV------------------SKVQTWFHERLKIWFEKRDLLKNPGNNMVVAHSLGAY 224
            EDDV                   + + +F +R++ W +   L K      VV HS G Y
Sbjct: 132 IEDDVVIPVLDRRPPAEDIKSHLEQYENYFVDRIEQWRKDNKLRKI----NVVGHSFGGY 187

Query: 225 LMALYKRNNPLHFKKLIMCSPAGMCNS---TVVKKQPPWWYAALWD----------MNLS 271
           +   Y    P    KL + SP G+ NS      K +P   Y   +           +N+ 
Sbjct: 188 ISFKYALKYPNSIDKLCLISPLGVENSIHAITHKWEPNTTYPLTFTDPSSRYYTRKLNVP 247

Query: 272 PF------SLVRNSGWLGSKLTSGWSYRRFRSLHSKIQFENLHLYSYAIFNRPGCGEYLL 325
            F      ++++  G +GSKL S +    +  +  +I +++  L+S+   N+    + + 
Sbjct: 248 RFIFENQLNVLKWMGPIGSKLCSNYISTAYVKVPDQI-YKDYLLHSFVGKNQTVQPQTIK 306

Query: 326 AFAL-----RCGGDPRVSLEATLFNDVVNKWDSDSEWVWLYGDRDWMDVKGGRRISQKIN 380
            F           DP ++    L N  ++        +++YG+ DWMD   G   ++ + 
Sbjct: 307 VFTHLFERNLIARDPIIN-NVGLLNPTMHV-------MFMYGEHDWMDKYAGYLTTESML 358

Query: 381 EIFPGKSSVEVIPNAGHHLYFDN 403
           +     S +EV P+AGH+L+ DN
Sbjct: 359 KNKAKASYIEV-PDAGHNLFLDN 380

>TDEL0F04100 Chr6 complement(756762..758066) [1305 bp, 434 aa] {ON}
           Anc_8.284 YDR125C
          Length = 434

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 80/334 (23%), Positives = 136/334 (40%), Gaps = 63/334 (18%)

Query: 124 VTEPSKLKHLIFIHGYGAGLGFFLKNFENIQLKDNSWCIHAIDLPGFGFSSRTKFPF--- 180
           +T P+     + IHGY A    + +NF    L      ++AIDLP  G S+   F     
Sbjct: 111 ITTPT-----LLIHGYAASSMAYYRNFTG--LSQTVTDLYAIDLPANGLSAEQPFKLNGD 163

Query: 181 -------KYPEDD----------------VSKVQTWFHERLKIWFEKRDLLKNPGNNMVV 217
                  KY ++D                + + ++++ ++++ W +   L K      +V
Sbjct: 164 KPRSLKVKYLDNDKFSVQHVIDESGTKQMIQQCESYYLDKIEEWRKVNKLEKIN----LV 219

Query: 218 AHSLGAYLMALYKRNNPLHFKKLIMCSPAGMCNSTVV---KKQPPWWYAALWDMNLSPF- 273
            HS G YL   Y    P   +KL + SP G+  S      K +    YA   +   S F 
Sbjct: 220 GHSFGGYLSFKYALKYPNSIEKLCLVSPLGVETSIYSVNNKLEKNTKYALDLEDPTSNFY 279

Query: 274 ---------------SLVRNSGWLGSKLTSGWSYRRFRSLHSKIQFENLHLYSYAIFNRP 318
                           ++R  G LG+K+   W+Y    S +S+I       Y + +    
Sbjct: 280 TRRREIPKFIFKNQSEILRWMGPLGAKMC--WNY--ILSAYSRIPEMEYKSYIFELLYGK 335

Query: 319 GCGEYLLAFALRCGGDPRVSLEATLFNDVVNKWDSDSEWVWLYGDRDWMDVKGGRRISQK 378
           G G    A  +      R  L      D + +  +  + + +YGD DWM+   G ++ ++
Sbjct: 336 G-GIAPTARQIFTNLFTRNLLAKDPIMDSLGQLQA-KKVLLVYGDHDWMNKYAGYKLVER 393

Query: 379 INEIFPGKSSVEV-IPNAGHHLYFDNISCFNAIL 411
           +N I    S+  + +P +GH+L+ DN + FNA L
Sbjct: 394 LNTIRNNTSAQYIEVPESGHNLFLDNPTFFNASL 427

>KNAG0G02140 Chr7 complement(484440..485666) [1227 bp, 408 aa] {ON} 
          Length = 408

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 76/332 (22%), Positives = 116/332 (34%), Gaps = 67/332 (20%)

Query: 134 IFIHGYGAGLGFFLKNFENIQLKDNSWCIHAIDLPGFGFSSRTKF--------PFKYPE- 184
           + IHGY A    F  N   +    +  C+  +DLP  G S             P  + E 
Sbjct: 84  VLIHGYAASSMAFHLNVAGLSNAFSDLCV--VDLPANGLSREPPMLGPKVKGQPVHWKEL 141

Query: 185 -----------------------DDVSKVQTWFHERLKIWFEKRDLLKNPGNNMVVAHSL 221
                                  DD    + +F +R++ W     L     N  VV HS 
Sbjct: 142 DKKTGSLTVVCEPPSKMSSSGVLDDPGVYEDYFVDRIEKW----RLAHGFDNINVVGHSF 197

Query: 222 GAYLMALYKRNNPLHFKKLIMCSPAGMCNSTVVKKQPPWWYAALWDMN---------LSP 272
           G Y+   Y      H  KL++ SP G+    +      W     +D+            P
Sbjct: 198 GGYMSFKYAIKYSKHVDKLVLLSPLGV-ERNIDSVSNKWDVGKTYDLTDIDATSPLYYRP 256

Query: 273 FSL-----------VRNSGWLGSKLTSGWSYRRFRSLHSKIQFENLHLYSYAIFNRPGCG 321
           F++           +R  G LG+ +       R+ ++        LH   Y     P   
Sbjct: 257 FTVPGYLFNNQLNVLRKMGPLGNHMAKRAIASRYSNVPGTAYHAYLHHVFYGAHTFPSAN 316

Query: 322 EYLLAFALRCGGDPRVSLEATLFNDVVNKWDSDSEWVWLYGDRDWMDVKGGRRISQKINE 381
                         R  L   +    VNK       + +YGD DWM+ + G  + Q+IN+
Sbjct: 317 ITAFTHLFTRQLLARDPLLDNIQRLKVNKL------MMVYGDHDWMNKEAGYGMVQEINK 370

Query: 382 --IFPGKSSVEVIPNAGHHLYFDNISCFNAIL 411
               P K+    +P+AGH+L+ DN S FN +L
Sbjct: 371 ERYVPAKAVYAELPSAGHNLFLDNPSGFNKLL 402

>CAGL0B01969g Chr2 complement(181406..182677) [1272 bp, 423 aa] {ON}
           similar to uniprot|Q04623 Saccharomyces cerevisiae
           YDR125c ECM18 or uniprot|Q12385 Saccharomyces cerevisiae
           YLR099c ICT1
          Length = 423

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 87/338 (25%), Positives = 134/338 (39%), Gaps = 90/338 (26%)

Query: 134 IFIHGYGAGLGFFLKN--FENIQLKDNSWCIHAIDLPGFGFS------------------ 173
           + IHGY A    F ++  + N  +KD    ++ IDLPG G S                  
Sbjct: 110 VLIHGYAATSTAFFRSIPYLNRDIKD----LYTIDLPGNGLSFTPSLDLEVSKPLPLKIE 165

Query: 174 ---SRTKFPFKYPEDD------VSKVQTWFHERLKIWFEKRDLLKNPGNNMVVAHSLGAY 224
                 +F   Y  D       + K+  ++ +R++ W     L    G   VVAHS G Y
Sbjct: 166 NIDDGNEFQLPYVIDSAHHRYVLQKLLDYYVDRIEQWRLDNKL----GKINVVAHSYGGY 221

Query: 225 LMALYKRNNPLHFKKLIMCSPAGM-----------------------CNSTVVKKQPPWW 261
           L   Y    P +   L + SP G+                       CNS    ++    
Sbjct: 222 LSFNYALKYPANINTLGLISPLGVERNIYSINNEFHSRTIYKREWNDCNSMFYDRKFKL- 280

Query: 262 YAALWDMNLSPFSLVRNSGWLGSKLTSGWSYRRFRSLHSKIQFENLHLYSYAIF-NRPGC 320
              L+   L P   +R  G +G+KL   W+Y   RS ++++   +   Y++  F  R G 
Sbjct: 281 NDYLFQKQLKP---LRWLGPIGAKLC--WNY--IRSAYARVPSIDYKDYTFETFYGRGGL 333

Query: 321 GEY-------LLAFALRCGGDPRVSLEATLFNDVVNKWDSDSEWVWLYGDRDWMDVKGGR 373
            E        LL  +L    DP +   + L            + + +YG  DWM+  GG+
Sbjct: 334 PEQTSQIFTSLLTSSL-LARDPLLDHVSQL---------QVPKLIMMYGQYDWMNKNGGK 383

Query: 374 RISQKINEIFPGKSSVEVIPNAGHHLYFDNISCFNAIL 411
            ++Q    IF G++    IPNAGH+L+ DN S F + L
Sbjct: 384 LMTQ----IFNGETKYIDIPNAGHNLFLDNPSDFASQL 417

>TPHA0A01690 Chr1 (344521..345738) [1218 bp, 405 aa] {ON} Anc_8.284
           YDR125C
          Length = 405

 Score = 62.0 bits (149), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 77/356 (21%), Positives = 141/356 (39%), Gaps = 99/356 (27%)

Query: 134 IFIHGYGAGLGFFLKNFENIQ--LKDNSWCIHAIDLPGFGFSSRTKFP------------ 179
           + +HGY      + +NF  +   +KD    +++IDLP FG S   + P            
Sbjct: 65  LLVHGYATSSLAYYRNFAGLSSYIKD----LYSIDLPTFGLSKTPELPTRKVTKNLKVTL 120

Query: 180 ---------------FKYPEDDVSKVQTWFHE--------------RLKIWFEKRDLLKN 210
                          F+  +DD+   + +++E              R++ W  +  L K 
Sbjct: 121 SNSNDKSDDPKKITSFQLSKDDIKHNEKYYNETKKELEINENYYIDRIEKWRIENKLDKI 180

Query: 211 PGNNMVVAHSLGAYLMALYKRNNPLHFKKLIMCSPAGMCNSTV-------------VKKQ 257
                +V HS G YL   Y    P   +KL + SP GM ++               ++++
Sbjct: 181 N----LVGHSFGGYLSYKYATKYPDSIEKLCLVSPLGMESNIYSINNKFENDKIYEIEEE 236

Query: 258 PPWWYAALWDMNL---------SPFSLVRNSGWLGSKLTSGWSYRRFRSLHSKIQFENLH 308
            P   ++++  N          +  +++R  G +GS LT  +    +R +   +  + +H
Sbjct: 237 DP---SSIFFTNTRTIPKFLFNNQLNVLRWLGPVGSTLTWKYIKASYRRVDDALYKDYIH 293

Query: 309 --LYSYAIFNRPGCGEYLLAFALRC-GGDPRVSLEATLFNDVVNKWDSDSEWVWLYGDRD 365
             +Y            +   F  +    DP          D V+K  + +  + LYG  D
Sbjct: 294 ELIYGKGGMEETTIKTFTNLFTTKLLAKDP--------ITDTVDKLKAKN-VLLLYGQED 344

Query: 366 WMDVKGGRRISQKINEIFPGKSSVEV----------IPNAGHHLYFDNISCFNAIL 411
           WM+   G ++++K+NE+  G ++ +V          +P AGH+L+ DN S FN  L
Sbjct: 345 WMNNYAGYQMTKKLNEL-KGYNTSKVGELNYATYMEVPEAGHNLFLDNPSFFNKAL 399

>YDR125C Chr4 complement(701397..702758) [1362 bp, 453 aa] {ON}
           ECM18Protein of unknown function, similar to Rlp24p
          Length = 453

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 92/367 (25%), Positives = 144/367 (39%), Gaps = 95/367 (25%)

Query: 106 KIDEDDNFINEFFIQPAN---VTEPSKLKHLIFIHGYGAGLGFFLKNFENIQLKDNSWCI 162
           K D+  N IN++  Q  N   V  P+     + IHGY A    F +N+    L  +   +
Sbjct: 104 KNDKLFNEINQWHFQNENTSTVRTPT-----LLIHGYAASSMSFFRNYPG--LSKHIRNL 156

Query: 163 HAIDLPGFGFSS--------RTKFP----------FKYPEDD--------VSKVQTWFHE 196
           ++ID+P  G SS         T  P          FK P           +   + ++ +
Sbjct: 157 YSIDMPASGLSSVPSLEINTTTPLPLDIKFIGENKFKVPYTINANHNKFVIQMYEDFYLD 216

Query: 197 RLKIWFEKRDLLKNPGNNMVVAHSLGAYLMALYKRNNPLHFKKLIMCSPAGMCNS----- 251
           R++ W     L    G   VV HS G YL   Y    P    KL + SP G+  +     
Sbjct: 217 RIEQWRIDNKL----GKMNVVGHSFGGYLSFKYAVKYPNSVNKLCLVSPLGVERNIWSVN 272

Query: 252 ---------TVVKKQPPWWYAALWDMNLSP-------FSLVRNSGWLGSKLTSGWSYRRF 295
                    T+  K P   + +    N+ P       F ++R  G LG+KL   W+Y   
Sbjct: 273 NNFHSNTLYTIDFKNPNSKFYS--KRNMIPKYLFEQQFHILRMMGPLGAKLC--WNYI-- 326

Query: 296 RSLHSKIQFENLHLYSYAIFNRPGCGEYLLAFALRCGGDPRVSLE--ATLFNDVVNKWDS 353
                        + +Y+        EY+       GG P V+ +    LF+  +   D 
Sbjct: 327 -------------MAAYSRVPSLAYKEYIFELFYGKGGIPEVTTDIFKALFSRCILAKDP 373

Query: 354 --DS-------EWVWLYGDRDWMDVKGGRRISQKINEI---FPGKSSVEVIPNAGHHLYF 401
             DS       + + +YG  DWM+ K G  + +++N +     G S +E IP++GH+L+ 
Sbjct: 374 LMDSLQYLNVKKLLIVYGQYDWMNKKAGMFMVKELNNLKNCLEGASYLE-IPSSGHNLFL 432

Query: 402 DNISCFN 408
           DN   FN
Sbjct: 433 DNPESFN 439

>Kwal_56.23702 s56 complement(668862..670112) [1251 bp, 416 aa] {ON}
           YDR125C (ECM18) - (putative) involved in cell wall
           biogenesis [contig 174] FULL
          Length = 416

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 79/328 (24%), Positives = 131/328 (39%), Gaps = 73/328 (22%)

Query: 134 IFIHGYGAGLGFFLKNFENIQ--LKDNSWCIHAIDLPGFGFS------------------ 173
           + +HGY A    F +NF  +   +KD    ++AIDLP  G S                  
Sbjct: 100 LLVHGYAASSMGFHRNFPGLSQSIKD----LYAIDLPASGLSPALPLEMRCTQPLDLKIN 155

Query: 174 -SRTKFPFKYP------EDDVSKVQTWFHERLKIWFEKRDLLKNPGNNMVVAHSLGAYLM 226
            S+  F   Y       +  +   + ++ + ++ W     L    G   +VAHS G YL 
Sbjct: 156 MSKDTFSLPYTINYLHHKSLIQNYEDYYLDAIEQWRHDNKL----GPINIVAHSFGGYLS 211

Query: 227 ALYKRNNPLHFKKLIMCSPAGMCNSTVVKKQPPWWYAALWDMNL-SPFS----------- 274
             Y    P   +KL + SP G+    +      W     ++++  +P S           
Sbjct: 212 FKYAVKFPHAVEKLCLVSPLGV-ERNIFSVNNQWRSNTSYNLDFENPASKFYIKKGPAIP 270

Query: 275 ---------LVRNSGWLGSKLTSGW---SYRRFRSL-HSKIQFENLHLYSYAIFNRPGCG 321
                    L+RN G LG+KL+  +   +Y R  SL + K  FE   LY     N+    
Sbjct: 271 RLVFEQQTQLLRNLGPLGAKLSWNYINAAYSRVPSLDYKKYVFE--LLYGKNGLNQTSKD 328

Query: 322 EYLLAFALRC-GGDPRVSLEATLFNDVVNKWDSDSEWVWLYGDRDWMDVKGGRRISQKIN 380
            ++  F  R    DP +        D +  +   ++ + +YGD DWM+ + G  +  + N
Sbjct: 329 LFIGLFNNRVLARDPLL--------DSIQFFGKSAKLMCIYGDHDWMNRRAGMEMVNEAN 380

Query: 381 EIFPGKSSVEVIPNAGHHLYFDNISCFN 408
           ++       EV  ++GH+L+ DN   FN
Sbjct: 381 QLGIEAKYNEV-SSSGHNLFLDNPEEFN 407

>Ecym_4285 Chr4 (612053..613270) [1218 bp, 405 aa] {ON} similar to
           Ashbya gossypii AGR062C
          Length = 405

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 81/351 (23%), Positives = 140/351 (39%), Gaps = 82/351 (23%)

Query: 117 FFIQPANVTEPSKLKHLIFIHGYGAGLGFFLKNFENIQLKDNSWCIHAIDLPGFGFSS-- 174
           F+   A +  P+     + +HGY      + +N    QL +    ++ IDLP  G S   
Sbjct: 75  FYNPDAKIQTPT-----LLLHGYATSSMCYHRNMP--QLSEGIKHLYTIDLPANGLSKEL 127

Query: 175 -------------------RTKFPFKYPEDD------VSKVQTWFHERLKIWFEKRDLLK 209
                              +++F   Y  D       + K++ ++ + +++W  K  L  
Sbjct: 128 PLELDIAKPIVFKPEFNSVKSEFHIPYTIDGLHHRCAIQKLEDYYIDSIELWRRKNSL-- 185

Query: 210 NPGNNMVVAHSLGAYLMALYKRNNPLHFKKLIMCSPAGM--------------CNSTVVK 255
             G   +V HS G Y+   Y    P + KKL + SP G+              C  ++  
Sbjct: 186 --GAINLVGHSFGGYISFKYSIKYPQNVKKLCLISPIGVERNIYSVHNNWRSNCPYSIDY 243

Query: 256 KQPPWWYAALWDMNLSPF------SLVRNSGWLGSKLTSGWSYRRFRSLHSKI-QFENLH 308
           + P   + A   M +  F       L+R  G LG+KL  GW Y    +++SK+  F  L 
Sbjct: 244 EDPSSKHFANKTM-IPEFVFNEQTKLLRLMGPLGAKL--GWKY--INAVYSKVPNFLYLE 298

Query: 309 LYSYAIFNRPGCGE-------YLLAFALRCGGDPRVSLEATLFNDVVNKWDSDSEWVWLY 361
                I+ +    +       YL   +L    DP +     L  D         + + LY
Sbjct: 299 FIFTLIYGKNVMTDTSRNIFTYLFTNSL-LARDPMLDSLEHLHVD---------KLLMLY 348

Query: 362 GDRDWMDVKGGRRISQKINEIFPGKS-SVEVIPNAGHHLYFDNISCFNAIL 411
           G+ DW+  + G+ + ++ N+     S ++ V+P+A H+L+ DN   FN  L
Sbjct: 349 GEHDWVRSQPGKMMVEEFNKQRSHPSGTLTVVPDASHNLFLDNPVFFNVAL 399

>Skud_4.386 Chr4 complement(673125..674465) [1341 bp, 446 aa] {ON}
           YDR125C (REAL)
          Length = 446

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 88/365 (24%), Positives = 145/365 (39%), Gaps = 91/365 (24%)

Query: 106 KIDEDDNFINEFFIQPANVTEPSKLKHLIFIHGYGAGLGFFLKNFENI--QLKDNSWCIH 163
           K D+  N +N++  Q  N    + L   + IHGY A    + +N+  +   ++D    ++
Sbjct: 97  KNDKLFNELNQWHFQ--NEKASTVLTPTLLIHGYAASSMSYFRNYPGLSKHIRD----LY 150

Query: 164 AIDLPGFGFSS--------------------RTKFPFKYPEDD------VSKVQTWFHER 197
           +IDLP  G SS                    + KF   Y  +       +   + ++ +R
Sbjct: 151 SIDLPASGLSSIPSLEINATTPLPLDIKFIGKNKFKIPYTINANHHKFVIQMFEDFYLDR 210

Query: 198 LKIWFEKRDLLKNPGNNMVVAHSLGAYLMALYKRNNPLHFKKLIMCSPAGM--------- 248
           ++ W     L    G   +V HS GAYL   Y    P   +KL + SP G+         
Sbjct: 211 IEQWRIDNKL----GKMNIVGHSFGAYLSFKYAVKYPNSVEKLCLVSPLGVERNIWSVNN 266

Query: 249 ---CNS--TVVKKQPPWWYAALWDMNLSP-------FSLVRNSGWLGSKLTSGWSYRRFR 296
               NS  T+  + P   + +    N+ P       F ++R  G LG+KL   W+Y    
Sbjct: 267 NFRSNSPYTIDFENPSSKFYS--KRNIIPRYLFQQQFQILRMMGPLGAKLC--WNYI--- 319

Query: 297 SLHSKIQFENLHLYSYAIFNRPGCGEYLLAFALRCGGDPRVSLE--ATLFNDVVNKWDS- 353
                       L +Y+        EY+       GG P V+ E    LF+  +   D  
Sbjct: 320 ------------LAAYSRVPSLAYKEYIFELFYGKGGIPAVTTEIFEGLFSRSILARDPL 367

Query: 354 -DS-------EWVWLYGDRDWMDVKGGRRISQKINEIFPG--KSSVEVIPNAGHHLYFDN 403
            DS       + + +YG  DWM+   G  + +++N +     K++   IP +GH+L+ DN
Sbjct: 368 MDSLNSLNVRKLLVVYGQYDWMNKNAGMLMVKELNNLGDHFEKATYTEIPFSGHNLFLDN 427

Query: 404 ISCFN 408
              FN
Sbjct: 428 PESFN 432

>NDAI0J01210 Chr10 (282384..283634) [1251 bp, 416 aa] {ON} Anc_8.284
          Length = 416

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 78/342 (22%), Positives = 128/342 (37%), Gaps = 93/342 (27%)

Query: 134 IFIHGYGAGLGFFLKNFENIQLKDNSWCIHAIDLPGFGFS-------------------- 173
           + +HGY A    F + F    L +N   ++AIDLP  G S                    
Sbjct: 98  LLLHGYAASSMSFYRTFA--PLSNNFKNLYAIDLPANGLSVAIPLKITKQRKRLYEVKYK 155

Query: 174 SRTKFPFKYP---EDD---VSKVQTWFHERLKIWFEKRDLLKNPGNNMVVAHSLGAYLMA 227
              KF   YP   E+    + + + ++ + ++ W     +  N     +V HS G Y   
Sbjct: 156 ENNKFSISYPVPIEEQKPLIEQYENYYLDAMRSW----QVANNIEKFNLVGHSFGGYFSF 211

Query: 228 LYKRNNPLHFKKLIMCSPAGMCNSTVVKKQPPWWYAALWDMNL----SPF---------- 273
            Y    P    KL + SP GM  S +      +    ++++NL    SPF          
Sbjct: 212 KYALRFPDSINKLCLVSPLGM-ESNIFSIHNKFEENKIYNVNLTDPTSPFYGKKFQIPNY 270

Query: 274 ------SLVRNSGWLGSKLTSGW---SYRRFRSLHSKIQFENLHLYSYAIFNRPGCGEYL 324
                  ++R  G  G++L   +   +Y+R  S+  K                    EYL
Sbjct: 271 LFENQLDVIRKLGPFGARLCWNYILSAYKRVPSMEYK--------------------EYL 310

Query: 325 LAFALRCGGDPRVSLEATLFNDVVNK--------WDSD-----SEWVWLYGDRDWMDVKG 371
             F L  G      +   LF +++ +         DS      S  + +YG+ DWM+   
Sbjct: 311 --FELFYGNRQVSPILCELFTNLLTRNLLARDPILDSIDQLQLSNVLVMYGEHDWMNRYA 368

Query: 372 GRRISQKINEI--FPGKSSVEVIPNAGHHLYFDNISCFNAIL 411
           G  +  ++N I   P  +    +P AGH+L+ DN   F++ L
Sbjct: 369 GYCMVSRLNNIRRTPNTAQYLQVPAAGHNLFLDNPEYFSSAL 410

>KAFR0B05380 Chr2 (1107049..1108284) [1236 bp, 411 aa] {ON}
           Anc_8.284 YDR125C
          Length = 411

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 83/340 (24%), Positives = 130/340 (38%), Gaps = 76/340 (22%)

Query: 123 NVTEPSKLKHLIFIHGYGAGLGFFLKNFENIQLKDNSWCIHAIDLPGFGFSSR--TKFPF 180
           NVT P+     + +HG+ +    F +NF    L  +   ++AIDLP  G S    TKF  
Sbjct: 85  NVTVPT-----LLLHGFASSSMSFFRNFTG--LSQDIMDLYAIDLPANGLSRSLSTKFYR 137

Query: 181 KYPE--------DDV-----------------SKVQTWFHERLKIWFEKRDLLKNPGNNM 215
             P+        DD+                  K + ++ + ++ W    +L K      
Sbjct: 138 VSPKETRKFDMLDDIHFQLLSHGNYHAEKELIQKCEDYYIDTIERWRRSNELHKIN---- 193

Query: 216 VVAHSLGAYLMALYKRNNPLHFKKLIMCSPAGMCNSTVVKKQPPWWYAALWDMN-LSP-- 272
           +VAHS G YL   Y    P    KL + SP G+  + +      +     + +N L P  
Sbjct: 194 IVAHSFGGYLSFKYALKYPESINKLCLVSPLGV-EANIYSINNNFNVGETYTVNRLDPSS 252

Query: 273 -----------------FSLVRNSGWLGSKLTSGW---SYRRFRSLHSKIQFENLHLYSY 312
                            F ++R SG +G+KL   +   SY R  SL  K     L LY  
Sbjct: 253 CCYINENEIPKYVFDNLFKILRLSGPIGAKLCWNYVLSSYSRISSLDFKRYVFEL-LYGK 311

Query: 313 AIFNRPGCGEYLLAFALR-CGGDPRVSLEATLFNDVVNKWDSDSEWVWLYGDRDWMDVKG 371
                     +   F  R    DP +    +L         S +  + LYG+ DWM    
Sbjct: 312 GGMTATAINLFTQLFTTRLLARDPLMDSAHSL---------SCNGILLLYGEYDWMAKNA 362

Query: 372 GRRI---SQKINEIFPGKSSVEVIPNAGHHLYFDNISCFN 408
           G+ +    +  N+    K+    +P +GH+L+ DN + FN
Sbjct: 363 GKSLLTNCKADNKGSASKTKYLEVPKSGHNLFLDNPAFFN 402

>KLLA0F19624g Chr6 complement(1817206..1818435) [1230 bp, 409 aa]
           {ON} similar to uniprot|Q04623 Saccharomyces cerevisiae
           YDR125C ECM18 Protein of unknown function, similar to
           Rlp24p
          Length = 409

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 83/340 (24%), Positives = 132/340 (38%), Gaps = 88/340 (25%)

Query: 134 IFIHGYGAGLGFFLKNFE--NIQLKDNSWCIHAIDLPGFGFSSR---------------- 175
           + IHGY A    F +NFE  ++ LKD    ++A+DLPG G S                  
Sbjct: 90  LMIHGYAASSMTFFRNFEQLSLSLKD----VYAVDLPGNGLSKELPLSVDSMQKPDRVEF 145

Query: 176 ------TKFPFKYPEDD------VSKVQTWFHERLKIWFEKRDLLKNPGNNMVVAHSLGA 223
                   F  + P D+      ++  + ++ + L+ W ++  L K      +V HS G 
Sbjct: 146 NETVKGQYFRLQNPVDEEKYKKHLAHYEDYYVDALEKWRKENKLSKIN----LVGHSYGG 201

Query: 224 YLMALYKRNNPLHFKKLIMCSPAGMCNS--TVVKKQPPW--WYAALWDMNLSPFSLVRN- 278
           YL   Y    P +  KL + SP G+  S  ++     P   +     D + S +S  RN 
Sbjct: 202 YLTFKYSLKYPDNVHKLCLVSPLGVERSIFSIHNHLEPERDYEIQSEDPSKSNYSNKRNI 261

Query: 279 --------------SGWLGSKLTSGW---SYRRFRSLHSKIQFENLHLYSYAIFNRPGCG 321
                          G LG+K   G+   SY R  S+           Y   +F      
Sbjct: 262 PKLILQYQNKALRWMGPLGAKACWGYVNSSYGRVPSVP----------YREYVFQ----- 306

Query: 322 EYLLAFALRCGGDPRVSLEATLFNDVVNKWD---------SDSEWVWLYGDRDWMDVKGG 372
              L F      D  + +   LF+  +  +D           S+ + +YG+ DWM+   G
Sbjct: 307 ---LVFGKGIMTDTSIRIFNQLFSRSLLAYDPIMDSLDKVKVSKLMLVYGEHDWMNKVAG 363

Query: 373 RRISQKINEIFPG-KSSVEVIPNAGHHLYFDNISCFNAIL 411
           R   ++ N I      + +++  AGH+L  DN S FN+ L
Sbjct: 364 RLAIEEFNSIRKSYDGTFDIVSRAGHNLVLDNPSEFNSKL 403

>Smik_4.371 Chr4 complement(662692..663999) [1308 bp, 435 aa] {ON}
           YDR125C (REAL)
          Length = 435

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 79/335 (23%), Positives = 130/335 (38%), Gaps = 85/335 (25%)

Query: 134 IFIHGYGAGLGFFLKNFENIQLKDNSWCIHAIDLPGFGFSS------------------- 174
           + IHGY A    F +N+    L  +   +++IDLP  G SS                   
Sbjct: 112 LLIHGYAASSMSFFRNYPG--LSKHIQNLYSIDLPASGLSSIPPLEINATTPLPLDIEFT 169

Query: 175 -RTKFPFKYPED------DVSKVQTWFHERLKIWFEKRDLLKNPGNNMVVAHSLGAYLMA 227
            + KF   Y  +       +   + ++ ++++ W     L    G   +V HS G YL  
Sbjct: 170 GKNKFKIPYTINLNHHKFVIQMYEDFYLDKIEQWRIDNKL----GKVNIVGHSFGGYLSF 225

Query: 228 LYKRNNPLHFKKLIMCSPAGMCNS--------------TVVKKQPPWWYAALWDMNLSP- 272
            Y    P   +KL + SP G+  +              T+  + P   + +    N+ P 
Sbjct: 226 KYAAKYPNSVEKLCLVSPLGVERNIWSINNNFRSNTLYTIGFEDPSSKFYS--KRNMIPK 283

Query: 273 ------FSLVRNSGWLGSKLTSGWSYRRFRSLHSKIQFENLHLYSYAIFNRPGCGEYLLA 326
                 F L+R  G +G+KL   W+Y                + +Y+        EY+  
Sbjct: 284 YLFERQFQLLRMMGPVGAKLC--WNYI---------------MAAYSRVPSLAYKEYIFE 326

Query: 327 FALRCGGDPRVSLE--ATLFNDVVNKWDS--DS-------EWVWLYGDRDWMDVKGGRRI 375
                GG P V+ E    LF+  +   D   DS       + + +YG  DWM+ K G  +
Sbjct: 327 LFYGKGGIPEVTTEIFKGLFSRCILAKDPLMDSLHYLNVRKLMVVYGQYDWMNKKAGMLM 386

Query: 376 SQKINEI--FPGKSSVEVIPNAGHHLYFDNISCFN 408
            + +N +     K+S   IP++GH+L+ DN   FN
Sbjct: 387 VENLNSLGNCLEKASYLEIPSSGHNLFLDNPLSFN 421

>NDAI0J01200 Chr10 (280820..282103) [1284 bp, 427 aa] {ON} 
          Length = 427

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 82/355 (23%), Positives = 137/355 (38%), Gaps = 94/355 (26%)

Query: 122 ANVTEPSKLKHLIFIHGYGAGLGFFLKNFENI--QLKDNSWCIHAIDLPGFGFSS----- 174
           + +T P+     + +HGY      F + F  +  Q++D    ++AID P  G S      
Sbjct: 100 SQITTPT-----LLLHGYATSSIAFFRTFGPLSKQIRD----LYAIDFPANGLSKAPPLN 150

Query: 175 ----RTKFPFKYP-EDDVSKVQTWFHERLKIWFEKRDLLKNPGNNMV------------- 216
               +   P+K   +DD +K Q      +++  E  +  +N   + V             
Sbjct: 151 VNHLKKHTPYKVKFKDDNTKFQISHTVDVQLQKETIEHYENYYLDAVRKWQLTNKIEKFN 210

Query: 217 -VAHSLGAYLMALYKRNNPLHFKKLIMCSPAGM------CNSTVVKKQ---------PPW 260
            V HS G Y    Y    P    KL + SP G+       N+    K+            
Sbjct: 211 LVGHSFGGYFAYKYALRYPDSVDKLCLVSPLGVERNIYSVNNNFEDKKVYNLELEDPTSK 270

Query: 261 WYAALWDMNL----SPFSLVRNSGWLGSKLTSGW---SYRRFRSLHSKIQFENLHLYSYA 313
           +Y   + +        F ++R  G LG + T  +   SYRR  S+  K            
Sbjct: 271 YYGRTFQIPKCLFEGQFDILRKFGPLGPRFTWNYINSSYRRVPSMEFK------------ 318

Query: 314 IFNRPGCGEYLLAFALRCGGDPRVSLEATLFNDVVNK--------WDSDSEW-----VWL 360
                   EY+  F L  G      +   +F+++V++         DS  E      + +
Sbjct: 319 --------EYI--FELLYGNRKTSPILTEVFSNIVSRNLLARDPILDSIDELKASNVMLM 368

Query: 361 YGDRDWMDVKGGRRISQKINEIF--PGKSSVEVIPNAGHHLYFDNISCFNAILEK 413
           YG  DWM+ + G  + +++NEI   P  +S   +PNAGH+L+ DN   F + L +
Sbjct: 369 YGQEDWMNSQAGYLMVKELNEIRENPNAASYVEVPNAGHNLFLDNPDFFCSSLTR 423

>SAKL0H16500g Chr8 (1450828..1452087) [1260 bp, 419 aa] {ON} similar
           to uniprot|Q04623 Saccharomyces cerevisiae YDR125C
          Length = 419

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 77/341 (22%), Positives = 137/341 (40%), Gaps = 64/341 (18%)

Query: 116 EFFIQPANVTEPSKLKHLIFIHGYGAGLGFFLKNFENIQLKDNSWCIHAIDLPGFGFSSR 175
            F+   A++  P+     + +HGY A    F +NF  +  +  +  ++AIDLP  G S  
Sbjct: 87  HFYNASASIKTPT-----LLLHGYAAASMGFHRNFAGLSSRIQN--LYAIDLPANGLSPG 139

Query: 176 TKFPFKYPEDDVSKVQTWF-HERLKI-----WFEKRDLLK----------------NPGN 213
           +  P      +   ++  F ++R KI     +  ++  ++                N  N
Sbjct: 140 SSQPLVVSCGEPLPMKAEFSNDRFKIPYTLEYLHQKSFIQQLEDYYLNSIEQWRIDNKLN 199

Query: 214 NM-VVAHSLGAYLMALYKRNNPLHFKKLIMCSPAGMCNSTVVKKQPPWWYAALWDMNL-- 270
            + +VAHS G YL   Y    P   ++L + SP G+    +      W     +D+N   
Sbjct: 200 KINIVAHSFGGYLSTKYAIKYPHAVERLCLVSPLGV-ERNIHSVNNHWCSNTWYDLNYED 258

Query: 271 -------------------SPFSLVRNSGWLGSKLTSGWSYRRFRSLHSKIQFENLHLYS 311
                              S   L+R  G LG+KL   W+Y    + +S+++ E    Y 
Sbjct: 259 PGSKYYMRRMRGIPSTVFQSQVKLLRLLGPLGAKLC--WNY--INAAYSRVKNEKYKEYV 314

Query: 312 YAIF-NRPGCGEYLLAFALRCGGDPRVSLEATLFNDVVNKWDSDSEWVWLYGDRDWMDVK 370
           + +F  + G  +   A  +      R  L      D +         +  YG+ DWM+  
Sbjct: 315 FELFYGKEGVTQ--TAMDIFTNLFTRQLLAKDPLMDSLQHLHV-GRLMLAYGEHDWMNKY 371

Query: 371 GGRRISQKINEIFPGKS---SVEVIPNAGHHLYFDNISCFN 408
            G  ++++ N +  GKS   +  VI ++GH+++ DN   FN
Sbjct: 372 AGVLMTKEFNHL-RGKSDAATYTVISSSGHNMFLDNPDEFN 411

>Suva_2.288 Chr2 complement(496577..497884) [1308 bp, 435 aa] {ON}
           YDR125C (REAL)
          Length = 435

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 82/359 (22%), Positives = 142/359 (39%), Gaps = 96/359 (26%)

Query: 114 INEFFIQ--PANVTEPSKLKHLIFIHGYGAGLGFFLKNFENIQLKDNSWCIHAIDLPGFG 171
           IN++  Q   A++  P+     + IHGY A    + +N+    L  +   +++IDLP  G
Sbjct: 95  INQWHFQNTKASIRTPT-----LLIHGYAASSMSYFRNYSG--LSKHFQNLYSIDLPASG 147

Query: 172 FSS--------------------RTKFPFKYPEDD------VSKVQTWFHERLKIWFEKR 205
            SS                    + KF   Y  +       +   + ++ +R++ W    
Sbjct: 148 LSSIPPLEVNTTTPLPLDIKFIGKNKFKIPYTINASHHKFVIQMFEDFYIDRIEQW---- 203

Query: 206 DLLKNPGNNM-VVAHSLGAYLMALYKRNNPLHFKKLIMCSPAGM---------------C 249
             + N  + M +V HS G YL   Y    P   +KL + SP G+                
Sbjct: 204 -RIDNKLDKMNIVGHSFGGYLSFKYAVKYPNSVEKLCLVSPLGVERNIWSVNNNLSSNTL 262

Query: 250 NSTVVKKQPPWWYAALWDMNLSP-------FSLVRNSGWLGSKLTSGWSYRRFRSLHSKI 302
            +T  K     +Y+     +L P       F L+R  G LG+K+   W+Y          
Sbjct: 263 YTTDFKDPSSKFYSK---GHLIPKYLFEEQFKLLRLMGPLGAKVC--WNYI--------- 308

Query: 303 QFENLHLYSYAIFNRPGCGEYLLAFALRCGGDPRVSLE--ATLFNDVVNKWDS--DS--- 355
                 + +Y+        EY+       GG P V+ +    LF+  +   D   DS   
Sbjct: 309 ------MAAYSRVTSLAFKEYIFELFYGKGGIPEVTTDIFKGLFSRSILARDPILDSLNY 362

Query: 356 ----EWVWLYGDRDWMDVKGGRRISQKINEIFPG--KSSVEVIPNAGHHLYFDNISCFN 408
               + + +YG  DWM+   G  + + +N++  G  ++S   +P++GH+L+ DN   FN
Sbjct: 363 LNVKKLLVVYGQYDWMNKNAGMLLVENVNKLGNGLERASYLEVPSSGHNLFLDNPESFN 421

>ZYRO0D06666g Chr4 (576172..577314) [1143 bp, 380 aa] {ON} similar
           to uniprot|Q04623 Saccharomyces cerevisiae YDR125C
          Length = 380

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 74/339 (21%), Positives = 136/339 (40%), Gaps = 55/339 (16%)

Query: 114 INEFFIQPANVTEPSKLKHLIFIHGYGAGLGFFLKNFENIQLKDNSWCIHAIDLPGFGFS 173
           +N++    +N +E +     + IHGY A    + + F+   L D    ++ IDLP  G S
Sbjct: 44  VNQWHFHNSNASEVTT--PTLLIHGYAASSMAYYRTFQG--LTDKISDLYTIDLPSNGLS 99

Query: 174 --------SRTKFPFK-------------------YPEDDVSKVQTWFHERLKIWFEKRD 206
                    +T  P K                   +    V + + ++ + +++W +   
Sbjct: 100 KELPLILDGQTPPPLKVEIHKDGSKFKIIERVDAEHCRSVVKQYEDYYLDSIELWRKHNG 159

Query: 207 LLKNPGNNMVVAHSLGAYLMALYKRNNPLHFKKLIMCSPAGMCNSTVVKKQPPWWYAALW 266
           +    G   +V HS G Y+   Y    P   ++L + SP G+  S +      W    ++
Sbjct: 160 I----GRFNLVGHSFGGYIAFKYAVKYPKAVEQLGLISPLGV-ESNIYSVNNDWKLDTVY 214

Query: 267 DM-NLSPFSLVRNSGWLGSKLTSGWSYRRFRSLHSKIQFENLHLYSYAIFNRPGCGEY-- 323
           +M +  P S +    W   K+         R +   I  +    Y  A +N+    EY  
Sbjct: 215 EMESTDPASRMYGKNWEIPKVLFERQTELLRWM-GPIGAKLCWNYITAAYNKLPTMEYKD 273

Query: 324 -LLAFALRCGGDPRVSLE--ATLFN----------DVVNKWDSDSEWVWLYGDRDWMDVK 370
            +       GG P+ + +    LF           D ++K  +  + + LYGD DWM+  
Sbjct: 274 YVFELLYGNGGIPKTARKVFGGLFTRSLLARDPIMDSMDKLGA-RKVLLLYGDSDWMNNY 332

Query: 371 GGRRISQKINEI-FPGKSSVEVIPNAGHHLYFDNISCFN 408
            G R+ + +N+    G ++ + +P+A H+L+ DN   FN
Sbjct: 333 AGYRMVELLNQKRGKGYATYDEVPDARHNLFLDNPDSFN 371

>NCAS0B05120 Chr2 complement(953798..954988) [1191 bp, 396 aa] {ON} 
          Length = 396

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 79/339 (23%), Positives = 131/339 (38%), Gaps = 74/339 (21%)

Query: 134 IFIHGYGAGLGFFLKNFENIQLKDNSWCIHAIDLPGFGFSS------------------- 174
           + IHGY A    + +      L  N   ++ IDLP    SS                   
Sbjct: 70  VLIHGYAASSMAYYRTLA--TLSKNVKDVYVIDLPANSLSSVPPHSDISHLKINKIKVVQ 127

Query: 175 ------RTKFPFKYP----------EDDVSKVQTWFHERLKIWFEKRDLLKNPGNNMVVA 218
                   K+ FK            +  + K++ ++ + ++ W      L       +V 
Sbjct: 128 VSKDKENEKYVFKVAPPHAYDAQREKQVIDKLENYYLDVIEKWRRANYGLDKFN---LVG 184

Query: 219 HSLGAYLMALYKRNNPLHFKKLIMCSPAGMCNST-------------VVKKQPPWWYAAL 265
           HS G YL   Y    P    KL + SP G+ ++              V+  Q P   + L
Sbjct: 185 HSFGGYLSFKYAIKYPEVVDKLCLVSPLGVASNIRSVNNVFDTKKEYVMDLQNPG--SML 242

Query: 266 WD-MNLSPFSLVRNS-------GWLGSKLTSGWSYRRFRSLHSKIQFENLHLYSYAIFNR 317
           ++   + P  L  N        G +GSKLT  +      S + K+   +   Y Y  F +
Sbjct: 243 YNRQRMIPNFLFNNQLNVLKWMGPVGSKLTRKY----INSAYVKVPTMDYKDYLYEYF-Q 297

Query: 318 PGCGEYLLAFALRCGGDPRVSLEATLFNDVVNKWDSDSEWVWLYGDRDWMDVKGGRRISQ 377
            G  +  +    +      ++ +  +  D +N+  S + ++ +YGD DWMD   G  + Q
Sbjct: 298 MGVPQVNVDIFTKLFSRNLMARDPIM--DNMNRLKS-TRFMMMYGDNDWMDKFSGYTLVQ 354

Query: 378 KINEI---FPGKSSVEVIPNAGHHLYFDNISCFNAILEK 413
            IN+I   F  K++   IP+AGH+L+ DN   F+  L K
Sbjct: 355 NINKIKNNFDRKATYVEIPDAGHNLFLDNPEDFSNNLIK 393

>NCAS0B03710 Chr2 (664097..665389) [1293 bp, 430 aa] {ON} Anc_8.284
          Length = 430

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 79/345 (22%), Positives = 124/345 (35%), Gaps = 100/345 (28%)

Query: 124 VTEPSKLKHLIFIHGYGAGLGFFLKNFENIQLKDNSWCIHAIDLPGFGFSSRTKF----- 178
           VT P+     + +HGY A    F + F  + L  +   ++A DLPG G S    F     
Sbjct: 107 VTTPT-----LLLHGYAASSLCFFRTF--VPLSRSIKNLYATDLPGNGLSKNKSFFSVMY 159

Query: 179 -----PFKYPEDD----------------VSKVQTWFHERLKIWFEKRDLLKNPGNNMVV 217
                  KY E++                +   + ++ + ++ W    +L   P  N+V 
Sbjct: 160 GNEYMKVKYEENNKFSIKYLNSLKDQTNSIKHSEDYYIDAIREWQLSNNL---PKINLV- 215

Query: 218 AHSLGAYLMALYKRNNPLHFKKLIMCSPAGMCNSTVVKKQPPWWYAALWDMNLS------ 271
            HS G YL   Y    P +  KL + SP G+  S +           L+D++ S      
Sbjct: 216 GHSFGGYLSFKYALRYPDNVNKLCLVSPLGV-ESNLYSVNNSLKENYLYDVDYSDPKSSY 274

Query: 272 --------------PFSLVRNSGWLGSKLTSGW---SYRRFRSLHSKIQFENLHLYSYAI 314
                          F ++R  G +G+++   +   SY+R  S+  K             
Sbjct: 275 YSRNFAIPKSLFEGQFGILRWMGPIGARVCWNYILSSYKRVPSMKYK------------- 321

Query: 315 FNRPGCGEYLLAFALRCGGDPRVSLEATLFN--------------DVVNKWDSDSEWVWL 360
                  EYL  F L  G   ++   A  F               D + K   +   V +
Sbjct: 322 -------EYL--FHLLFGNAKKLVTSAKTFTNLFTRNLLAKDPIMDSIEKLQCEKLMV-M 371

Query: 361 YGDRDWMDVKGGRRISQKINEIFPGKSS--VEVIPNAGHHLYFDN 403
           YG  DWM+   G  +  K+N     K +     IP AGH+L  DN
Sbjct: 372 YGQHDWMNKYAGYCLIAKLNNYRSTKDAGYFTEIPEAGHNLILDN 416

>CAGL0M11462g Chr13 complement(1129244..1130404) [1161 bp, 386 aa]
           {ON} similar to uniprot|Q12385 Saccharomyces cerevisiae
           YLR099c ICT1
          Length = 386

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 98/417 (23%), Positives = 160/417 (38%), Gaps = 122/417 (29%)

Query: 75  NNADKIQYDLLSTLPFFPEAKDGKRAEIVRTKIDEDDNFINEFFIQPANVTEPSKLKHLI 134
           ++ + +QY ++  +P      +G+RA ++R  +++       +F     V  P+     +
Sbjct: 6   DDLETLQYKVMEEVPV-----EGQRA-VLRCGVNQ------WYFRGGDRVVTPT-----L 48

Query: 135 FIHGYGAGLGFFLKNFENI--QLKDNSWCIHAIDLPGFGFSSRT---------KFPFKYP 183
            +HGYGA    + + F  +   ++D    ++AIDLP  G S            K  FK  
Sbjct: 49  LVHGYGASSMAYHRCFAPLSRHIRD----LYAIDLPANGLSEAPPLVAEGEAPKAKFKIE 104

Query: 184 EDD-------------VSKVQTWFHERLKIWFEKRDLLKN-------------PGNNM-- 215
           E+              V+  Q      L+   EKR  L+                NN+  
Sbjct: 105 ENKFTVVQGARRAAEPVTDAQVDQELMLRTHREKRRYLQQYEDYYVESIEQWRKENNLDK 164

Query: 216 --VVAHSLGAYLMALYKRNNPLHFKKLIMCSPAGM------CNSTV-------VKKQPPW 260
             +V HS G YL   Y    P    KL + SP GM       N+T        +++  P 
Sbjct: 165 FNLVGHSFGGYLSYKYALKYPESVNKLCLLSPLGMERNIHSINNTFEENVVYELQESDPS 224

Query: 261 WYAALWDMNL------SPFSLVRNSGWLGSKLTSGW---SYRR----------FRSLHSK 301
            Y              + FS++R  G +G KL   +   SY +          F S   K
Sbjct: 225 SYLYTRKRKAPKFLFENQFSVLRWMGPIGDKLCLSFINSSYAKVPSQAYKDYLFESFLGK 284

Query: 302 IQF--ENLHLYSYAIFNRPGCGEYLLAFALRCGGDPRVSLEATLFNDVVNKWDSDSEWVW 359
             F  +N+H   + +F R      LLA       DP +        D ++K       V+
Sbjct: 285 KHFAKQNVHALKH-LFTRS-----LLA------RDPIM--------DTIDKLKVPDVSVF 324

Query: 360 LYGDRDWMDVKGGRRISQKINEI-----FPGKSSVEVIPNAGHHLYFDNISCFNAIL 411
            YGD DWM+   G  + +++ +        G +S   +P+AGH+L+ DN   F+  L
Sbjct: 325 -YGDHDWMNSYAGYLMVERLKKFRVASTSGGSASYLEVPDAGHNLFLDNPDYFSKKL 380

>KLTH0G13178g Chr7 (1131579..1132826) [1248 bp, 415 aa] {ON} similar
           to uniprot|Q04623 Saccharomyces cerevisiae YDR125C
          Length = 415

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 82/355 (23%), Positives = 136/355 (38%), Gaps = 85/355 (23%)

Query: 114 INEFFIQP--ANVTEPSKLKHLIFIHGYGAGLGFFLKNFENIQLKDNSWCI---HAIDLP 168
           +N+F  Q   A +  P+     + +HGY A    F +NFE +     S CI   +AIDLP
Sbjct: 83  VNQFHFQNSLAEIKTPT-----LLLHGYAASSMAFHRNFEGL-----SKCIRDLYAIDLP 132

Query: 169 GFGFSS------RTKFP-----------FKYP--------EDDVSKVQTWFHERLKIWFE 203
             G S       R   P           FK P        +  +   + ++ + L+ W  
Sbjct: 133 ANGLSPPQPLEIRCTEPQPLKIEISNDTFKLPYTINSLHHKSAIQNFEDYYLDALEQW-- 190

Query: 204 KRDLLKNPGNNMVVAHSLGAYLMALYKRNNPLHFKKLIMCSPAGMCN------------- 250
           + D    P N  +VAHS G Y+   Y    P   K+L + SP G+               
Sbjct: 191 RLDNKLGPIN--IVAHSFGGYISFRYAVKYPHAVKRLCLLSPLGVERNIFSVNNNWRSNT 248

Query: 251 ----------STVVKKQPPWWYAALWDMNLSPFSLVRNSGWLGSKLTSGW---SYRRFRS 297
                     S    ++ P    A++++      ++R  G LG++L   +   +Y R  S
Sbjct: 249 QYKLDFENPASKFYIRKGPAIPPAIFELQT---KVLRGLGPLGARLCWNYITAAYARVPS 305

Query: 298 LHSKIQFENLHLYSYAIFNRPGCGEYLLAFALR-CGGDPRVSLEATLFNDVVNKWDSDSE 356
           L  K Q+     Y      +     +   F  R    DP       L + + +      +
Sbjct: 306 LKYK-QYIFEMFYGKNALTQTSKDIFTGLFTNRLLARDP-------LLDSLCHV--RSKK 355

Query: 357 WVWLYGDRDWMDVKGGRRISQKINEIFPGKSSVEVIPNAGHHLYFDNISCFNAIL 411
            + +YGD DWM+ K G  +  +  ++       EV  ++GH+L+ DN    N ++
Sbjct: 356 LLLMYGDHDWMNRKAGLEMVTEAKKLGIDAQYGEV-SSSGHNLFLDNPEESNELI 409

>ZYRO0F09064g Chr6 (735162..736211) [1050 bp, 349 aa] {ON} similar
           to uniprot|P38139 Saccharomyces cerevisiae YBR204C
           Hypothetical ORF
          Length = 349

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 65/299 (21%), Positives = 119/299 (39%), Gaps = 59/299 (19%)

Query: 123 NVTEPSKLKHL-IFIHGYGAGLGFFLKNFENIQLKDNSWCIHAIDLPGFGFSSR-TKFPF 180
           N  + S++  L +FIHG G  L  F      +   D  +   A+DLPGFG S    ++P 
Sbjct: 75  NCQDSSQVHELFLFIHGLGGELEQFEPLLRLVDAMDQRFL--ALDLPGFGKSDEWDEYPM 132

Query: 181 KYPEDDVSKVQTWFHERLKIWFEKRDLLKNPGNNMVVAHSLGAYLMA-LYKRNNPLH-FK 238
               + + ++   F               N    ++V HS+G YL +  Y+  + +H   
Sbjct: 133 LKVVETIEEIAAKF---------------NAAKIVLVGHSMGCYLTSHFYEAYHKVHSIN 177

Query: 239 KLIMCSPAGMCNSTVVKKQPPW--WYAA----LWDMNLSPFSLVR---NSGWLG----SK 285
           ++++ SP       +      W  W+      L+D   S F   +   +SG  G      
Sbjct: 178 RIVLLSPPKRVLYELQGNVVQWGIWFGYKLPWLFDFYRSWFDQSKGLASSGIRGFFSNDT 237

Query: 286 LTSGWSYRRFRSLHSKIQFENLHLYSYAIFNRPGCGEYLLAFALRCGGDPRVSLEATLFN 345
           +T+  +YR+    H+ +Q ++  ++ Y    +P                    ++    N
Sbjct: 238 ITTIQTYRKLWQFHNNVQIKSRTIFGYLSGWQP--------------------IQWDKLN 277

Query: 346 DVVNKWDSDSEWVWLYGDRDWMD-VKGGRRISQKINEIFPGKSSVEVIPNAGHHLYFDN 403
            + N   + +  V + GDRD +  +   + I + + E    K  +  IP+ GHH+ FD 
Sbjct: 278 QIWNV--TATTLVVMCGDRDAVTPISAAQEIVESLPEHMEKK--LVTIPDCGHHVCFDT 332

>TDEL0B03250 Chr2 complement(575015..576061) [1047 bp, 348 aa] {ON}
           Anc_8.524 YBR204C
          Length = 348

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 71/300 (23%), Positives = 121/300 (40%), Gaps = 59/300 (19%)

Query: 133 LIFIHGYGAGLGFFLKNFENIQLKDNSWCIHAIDLPGFGFSSRTKFPFKYPEDDVSKVQT 192
            +FIHG G  L  F      +  ++ S+   A DLPGFG S       +YP  DV K   
Sbjct: 81  FLFIHGLGGTLEQFEPVLRELDQRNKSFL--AFDLPGFGKSDEWD---QYPMLDVVKSID 135

Query: 193 WFHERL--KIWFEKRDLLKNPGNNMVVAHSLGAYLMALYKR--NNPLHFKKLIMCSPAGM 248
           W   +L   + FEK +L         + HS+G YL   +    +      +L++ +P   
Sbjct: 136 WLIHQLTNNLKFEKLNL---------IGHSMGCYLAVHFYLLFHESWCISRLVLLAPPKP 186

Query: 249 CNSTVVKK--------QPPWWYAALWDMNLSPFSLVRNSGWLGSK--------LTSGWSY 292
               + K         Q  + +  ++D+  + F   +     G K        +T    Y
Sbjct: 187 NVDQLSKSKYLIQFGLQTGFRFPWMFDIYRTRFDQSKGLSSSGIKQFFYRDGDITD--KY 244

Query: 293 RRFRSLHSKIQFENLHLYSYAIFNRPGCGEYLLAFALRCGGDPRVSLEATLFNDVVNKWD 352
           R+    H+ +Q +     S +IF       Y L +           ++  + N V++  +
Sbjct: 245 RKLWQFHNNVQIK-----SRSIFG------YFLGWE---------EIDWNVLNRVLSHQE 284

Query: 353 SDSEWVWLYGDRDWMD-VKGGRRISQKINEIFPGKSSVEVIPNAGHHLYFDNISCFNAIL 411
           S ++ + L G++D +   K  R I   ++++ P K  +  IPN GH+L FD     N I 
Sbjct: 285 SKTKLLILCGEKDTITPEKYSREIYDLLSDV-PSKEII-TIPNCGHNLCFDLPEVVNQIF 342

>NDAI0C05430 Chr3 (1259106..1260194) [1089 bp, 362 aa] {ON}
           Anc_8.524 YBR204C
          Length = 362

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 63/155 (40%), Gaps = 25/155 (16%)

Query: 93  EAKDGKRAEIVRTKIDEDDNFINEFFIQPANVTEPSKLKHLIFIHGYGAGLGFFLKNFEN 152
           E  DGK   + R       NF         N  EP  L    FIHG G  L  F      
Sbjct: 63  EKVDGKSIRVCR-------NFGTSDSEGDGNHNEPLYL----FIHGLGGVLEQFEPLLRL 111

Query: 153 IQLKDNSWCIHAIDLPGFGFSSRTKFPFKYPEDDVSKVQTWFHERLKIWFEKRDLLKNPG 212
           + L +N +   A+DLPGFG S       +Y + ++  V +  H  +     +R       
Sbjct: 112 LDLNENKFL--ALDLPGFGKSD------EYEDYNMFDVISIIHTIVDRLIPER----TTS 159

Query: 213 NNMVVAHSLGAY--LMALYKRNNPLHFKKLIMCSP 245
           N ++V HS+G Y  L   YK      FKKL+  SP
Sbjct: 160 NIVLVGHSMGCYISLHLFYKSYTRFSFKKLVFLSP 194

>TBLA0H01400 Chr8 (312727..313992) [1266 bp, 421 aa] {ON} Anc_8.284
           YDR125C
          Length = 421

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 67/140 (47%), Gaps = 17/140 (12%)

Query: 273 FSLVRNSGWLGSKLTSGWSYRRFRSLHSKIQFENLHLYSYAIFNRPGCGEYLLAFALRC- 331
           F++++  G LGSKLT  +  RR+  + S+  ++N     +A         +   F     
Sbjct: 284 FNVLKCMGPLGSKLTWSFISRRYEHIASE-AYQNFLFKLFATVPNVTINNFSNMFTRNLL 342

Query: 332 GGDPRVSLEATLFNDVVNKWDSDSEWVWLYGDRDWMDVKGGRRISQKINEIFPGKSS--- 388
             DP +        D +NK  S  + +  YG+ DWM+ + G  +++K+N I  G S    
Sbjct: 343 AKDPIM--------DSINKLQS-KKLLLFYGENDWMNKEAGFLMAEKLN-ILKGDSKYAN 392

Query: 389 -VEVIPNAGHHLYFDNISCF 407
            +EV PN+GH+L  D+   F
Sbjct: 393 WIEV-PNSGHNLILDDPKFF 411

 Score = 38.1 bits (87), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 68/179 (37%), Gaps = 53/179 (29%)

Query: 112 NFINEFFIQPANVTEPSKLKH-LIFIHGYGAGLGFFLKNFENI--QLKDNSWCIHAIDLP 168
           N IN++    AN    S +K   + IHGY A    + K F  +   +KD    ++ IDLP
Sbjct: 34  NEINQWHFHNANA---STIKTPTVLIHGYAASSMAYYKTFRYLTGSIKD----LYTIDLP 86

Query: 169 GFGFSS------------RTKFPFKYPEDD---------------------------VSK 189
           GFG S+            +++F  K  +                             +S 
Sbjct: 87  GFGLSASPKIIINDHNRKKSQFDIKLIDSKDSNNNKFSISKKNLKLLENGNIEDKAFISA 146

Query: 190 VQTWFHERLKIWFEKRDLLKNPGNNMVVAHSLGAYLMALYKRNNPLHFKKLIMCSPAGM 248
              ++ +R++ W +      N G   V+ HS G Y+   Y    P   + L + SP GM
Sbjct: 147 FDDYYIDRIEKWRK----FNNLGKINVIGHSFGGYISFKYAIKYPDSIENLCLVSPFGM 201

>KNAG0H03120 Chr8 (586146..587450) [1305 bp, 434 aa] {ON} Anc_8.284
           YDR125C
          Length = 434

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 73/354 (20%), Positives = 138/354 (38%), Gaps = 86/354 (24%)

Query: 118 FIQPANVTEPSKLKH-LIFIHGYGAGLGFFLKNFENI--QLKDNSWCIHAIDLPGFGFSS 174
           F  P+ V   + +K  ++ IHGY +    + +NF  +  Q KD    ++AIDLP  G S 
Sbjct: 95  FHNPSLVGSEAAVKPPVLLIHGYASSSMSYFRNFRGLSSQCKD----VYAIDLPANGLSR 150

Query: 175 RTKFPFKYPEDDVSK-------------------------------VQTWFHERLKIWFE 203
                      D+ K                               ++ ++ + ++ W  
Sbjct: 151 EISLSEDADLKDLVKYSLQVKGLDSPGQVKVTKPYNNKLCATQLRILEDYYVDEIERW-- 208

Query: 204 KRDLLKNPGNNM-VVAHSLGAYLMALYKRNNPLHFKKLIMCSPAG-----------MCNS 251
               ++N  + + +V HS G Y+   Y    P +  KL + SP G           +   
Sbjct: 209 ---RVENQIDQLHLVGHSFGGYISYKYALKYPQNVMKLALISPLGVERNLYSVNNHLPQD 265

Query: 252 TVVKK--QPPWWYAALWDMNL------SPFSLVRNSGWLGSKLTSGWSYRRFRSLHSKIQ 303
           ++V+   + P   + L  + +      +   ++R  G +G++L   W+Y    S ++K+ 
Sbjct: 266 SIVQGTFEDPSSPSYLRKLEVPRYIFENQLKILRWGGPMGARLC--WNY--ITSAYAKVP 321

Query: 304 FENLHLYSYAIF------NRPGCGEYLLAFALRC-GGDPRVSLEATL-FNDVVNKWDSDS 355
                 Y + +F       +     ++L F       DP +   A L   DV+       
Sbjct: 322 SREFKEYLFELFYGDGGITKTALTTFILLFTRNLLARDPIMDSIAELKVKDVM------- 374

Query: 356 EWVWLYGDRDWMDVKGGRRISQKINEIFPGKSSVEV-IPNAGHHLYFDNISCFN 408
              + YG  DWM+   G R ++ + +     S++ + IP +GH+L+ D+   FN
Sbjct: 375 ---FQYGQYDWMNKNAGARAAELLRKQPYNNSALYLEIPESGHNLFLDSPQSFN 425

>KAFR0B02830 Chr2 complement(578530..579705) [1176 bp, 391 aa] {ON}
           Anc_8.284 YDR125C
          Length = 391

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 77/184 (41%), Gaps = 37/184 (20%)

Query: 93  EAKDGKRAEIVRTKIDED-DNFINEFFIQPANVTEPSKLKH-LIFIHGYGAGLGFFLKNF 150
           E K  ++  +  TK ++  +N INE+     N    SK+K   + IHGY A    F + F
Sbjct: 32  EEKIMEKVTVPGTKTNQMVNNEINEWHFHNPNA---SKIKTPTLLIHGYAASSMAFHRTF 88

Query: 151 ENIQLKDNSWCIHAIDLPGFGFSS--------------------RTKFPFKYPED----- 185
              +L  +   ++AIDLPG G SS                    +  F  K   D     
Sbjct: 89  N--RLSTDIKDLYAIDLPGNGLSSAPELSDVIKMKDLKITLNKSKDGFTLKKAIDLEIEK 146

Query: 186 -DVSKVQTWFHERLKIWFEKRDLLKNPGNNMVVAHSLGAYLMALYKRNNPLHFKKLIMCS 244
            +++K + ++  R+  W +   + K      V+ HS G ++   Y   +P     LI+ S
Sbjct: 147 ANLAKYENYYLSRIDEWRKFHGIEKLN----VIGHSFGGFISFKYAITHPNQVNDLILVS 202

Query: 245 PAGM 248
           P GM
Sbjct: 203 PLGM 206

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 32/53 (60%), Gaps = 3/53 (5%)

Query: 358 VWLYGDRDWMDVKGGRRISQKINEI-FPGKSSVEV--IPNAGHHLYFDNISCF 407
           + +YG+ DWMD   G  + + +++  +  K +V    IP+AGH+L+ DN + F
Sbjct: 329 MLVYGEHDWMDKYAGYNMVELLSKSNYKLKDTVHYVEIPDAGHNLFLDNPTDF 381

>KNAG0A03770 Chr1 complement(494021..495091) [1071 bp, 356 aa] {ON}
           Anc_8.524 YBR204C
          Length = 356

 Score = 38.5 bits (88), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 50/117 (42%), Gaps = 18/117 (15%)

Query: 134 IFIHGYGAGLGFFLKNFENIQLKDNSWCIHAIDLPGFGFSSR-TKFPFKYPEDDVSKVQT 192
           IFIHG G  L  F    + + L +  +   AIDLPGFG S   T +P       +  V +
Sbjct: 86  IFIHGLGGSLDQFFPLLKLLDLSEKYFV--AIDLPGFGKSDEHTDYPMIQVVKHIDAVIS 143

Query: 193 WFHERLKIWFEKRDLLKNPGNNMVVAHSLGAYL----MALYKRNNPLHFKKLIMCSP 245
                 ++ F+   L         + HS+G YL    M L+ +       K+++ +P
Sbjct: 144 ELLNEARLAFDTVRL---------IGHSMGCYLTLHFMTLFSKK--YRIGKVVLLAP 189

>TPHA0L01600 Chr12 (338450..339568) [1119 bp, 372 aa] {ON} Anc_8.524
           YBR204C
          Length = 372

 Score = 38.1 bits (87), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 62/126 (49%), Gaps = 11/126 (8%)

Query: 123 NVTEPSKLKHL-IFIHGYGAGLGFFLKNFENIQLKDNSWCIHAIDLPGFGFSSRTKFPFK 181
           N+ E S +  + IFIHG G  L  FL   +   L + S+   A+DLPGFG   +++F  +
Sbjct: 81  NLKEQSSIDEIYIFIHGLGGSLEQFLPLLKLTDLSNKSFI--AVDLPGFG---QSEFNDE 135

Query: 182 YPEDDVSKVQTWFHERLKIWFEKRDLLKNPGNNMVVAHSLGAYL-MALYKR-NNPLHFKK 239
           Y   + S        + +++   R L  N    ++  HS+G YL +  Y++       +K
Sbjct: 136 YNIANYSMSSIIGFLKSQVF--SRYLTTNT-KIILTGHSMGCYLALHFYQQYKTEYQIQK 192

Query: 240 LIMCSP 245
           +++ +P
Sbjct: 193 IVLLAP 198

>KAFR0G03180 Chr7 complement(660802..661740) [939 bp, 312 aa] {ON}
           Anc_4.233 YDL057W
          Length = 312

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 69/172 (40%), Gaps = 14/172 (8%)

Query: 79  KIQYDLLSTLPFFPEAKDGKRAEIVRTKIDEDDNFINEFFIQPANVTEPSKLKHLIFIHG 138
           +I  D  + LP + + +  ++  +V+      D  ++     P    E SK+  +I +HG
Sbjct: 4   RIHLDEDAVLPSYLQLEANEKYLLVKDSEVHCDKGLSTILSVPTKTKENSKI--VILLHG 61

Query: 139 YGAGLGFFLKNFENIQLKDNSWCIHAIDLPGFGFSSRTKFPFKYPEDDVSKVQTWFHERL 198
           + +      +   + +L    + +   D  G G S   +       ++  +  T   E +
Sbjct: 62  HQSHKNALYQPLLSQELSKMGYFVIRFDFRGQGDSEPNR------NENEGRTITQDLEDM 115

Query: 199 KIWFEKRDLLKNPGN-----NMVVAHSLGAYLMALYKRNN-PLHFKKLIMCS 244
                  D+L    N      MVVAHS G  +M  Y  NN P+   KL+ CS
Sbjct: 116 NAIISSLDVLSTSYNISFQLEMVVAHSRGVLIMFEYLLNNKPICVPKLVNCS 167

>NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {ON}
           Anc_8.524 YBR204C
          Length = 363

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 68/293 (23%), Positives = 106/293 (36%), Gaps = 54/293 (18%)

Query: 134 IFIHGYGAGLGFFLKNFENIQLKDNSWCIHAIDLPGFGFSSRTK-FPFKYPEDDVSKVQT 192
           +FIHG G  LG F        LK   +    +DLPGFG S   + +  K   + +  V  
Sbjct: 85  LFIHGLGGSLGQFEPLLRLTHLKGKKFL--TLDLPGFGQSDELESYSMKSVIETIRSVVD 142

Query: 193 WFHERLKIWFEKRDLLKNPGNNMVVAHSLGAYL----MALYKRNNPLHFKKLIMCSPAGM 248
                 K   E   L       ++  HS+G YL       Y +N  +  +K+ + SP   
Sbjct: 143 LATGNQKSLGENTQL-----KLILTGHSMGCYLCLHFFETYSKNYDI--RKIALLSPPKP 195

Query: 249 CNSTVVKKQPPWWYAALWDMNLSP--FSLVRNSGWLGSKLTSG---------------WS 291
             +++ K+   W   ALW +   P  F L RN       L+S                  
Sbjct: 196 IMTSLSKRN-YWTQWALWGVFKLPFIFDLYRNYFDQTRGLSSSGMKRFFFNNDPNDYDLR 254

Query: 292 YRRFRSLHSKIQFENLHLYSYAIFNRPGCGEYLLAFALRCGGDPRVSLEATLFNDVVNKW 351
           YR+    HS +Q ++  +  Y +                 G D     +     D  +K 
Sbjct: 255 YRKLWQFHSNVQNKSRSVVGYLL-----------------GWDAINWEKVNTLVDKNDKQ 297

Query: 352 DSDSEWVWLYGDRDWMDVKGGRRISQKINEIFPGKSSVEV--IPNAGHHLYFD 402
            SD   +   G  D + +    +   +  E F  K++ ++  IPN  H L FD
Sbjct: 298 GSDLHVLVFLGKNDQVTLPEDVK---QFYESFENKNNTKLIEIPNCSHTLCFD 347

>Kwal_27.11975 s27 (1028242..1029252) [1011 bp, 336 aa] {ON} YBR204C
           - Hypothetical ORF [contig 26] FULL
          Length = 336

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 45/110 (40%), Gaps = 29/110 (26%)

Query: 134 IFIHGYGAGLGFFLKNFENIQLKDNSWCIHAIDLPGFGFSSRTKFPFKYPEDDVSKVQTW 193
           +FIHG G  L  F      + + +  +    IDLPGFG S        Y   D++K+   
Sbjct: 82  VFIHGLGGTLTQFEPLLRVLDVLNEGFL--TIDLPGFGHSDELD---SYSMLDIAKI--- 133

Query: 194 FHERLKIWFEKRDLLKNPGNN---MVVAHSLGAYLMALYKRNNPLHFKKL 240
                      R++L     N   +VV HS+G ++         LHF +L
Sbjct: 134 ----------IREVLVETTKNKKVIVVGHSMGCHI--------ALHFGQL 165

>ZYRO0A01276g Chr1 complement(91512..99242) [7731 bp, 2576 aa] {ON}
            similar to uniprot|P40468 Saccharomyces cerevisiae
            YIL129C TAO3 Identified in a hunt for mutants that
            activate OCH1 transcription Transcriptional Activator of
            OCH1
          Length = 2576

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 26/42 (61%)

Query: 67   LEDYKVFSNNADKIQYDLLSTLPFFPEAKDGKRAEIVRTKID 108
            LED ++ +N+  ++ + L+S LP F +A D K    ++T +D
Sbjct: 2019 LEDSRIIANSESRLLFALISNLPRFLQAMDRKDYSNIQTAVD 2060

>KAFR0I02300 Chr9 (467218..468672) [1455 bp, 484 aa] {ON} Anc_1.415
           YCL004W
          Length = 484

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 52/114 (45%), Gaps = 22/114 (19%)

Query: 287 TSGWSYRRFRSLHSK--IQFENLHL----------YSYAIFNRPGCGEYLLAFALRCGGD 334
           T  +++ +F+ LHSK  I   +L+L           S A+ + P    YLL   LR   +
Sbjct: 43  TDFYNHLKFKILHSKDRIFLSSLYLGKNETELVETISKALNSNPNLKVYLLFDGLRSTRE 102

Query: 335 PRVSLEATLFNDVVNKWDSDSEWVWLY-----GDRDWMDVKGGRRISQKINEIF 383
              S  ATL ++++ K D D  +V LY         W D    + I ++ NEIF
Sbjct: 103 KNFS-SATLLSNLIAKHDHDRVFVSLYFNPSFNSSIWKD----KLIPKRFNEIF 151

>TBLA0B06200 Chr2 (1461434..1464088) [2655 bp, 884 aa] {ON}
           Anc_4.348 YJR126C
          Length = 884

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 1/50 (2%)

Query: 274 SLVRNSGWL-GSKLTSGWSYRRFRSLHSKIQFENLHLYSYAIFNRPGCGE 322
           SL R  GWL GS  T   +YR F +   +      H+++YA  N+ G  E
Sbjct: 182 SLTRTFGWLHGSTFTKAETYRIFLTALQEENKAKYHVHNYATANKNGVHE 231

>KLLA0E00705g Chr5 complement(59404..68778) [9375 bp, 3124 aa] {ON}
            similar to uniprot|Q07878 Saccharomyces cerevisiae
            YLL040C VPS13 homologous to human COH1 component of
            peripheral vacuolar membrane protein complex
          Length = 3124

 Score = 31.6 bits (70), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 31/57 (54%)

Query: 10   LQAVLNRLKVFDLKNVRFRKQSDSRVYVKTPTAPTAIPLTEIIVKLPYLFPRGVAQS 66
            L AV N    FD+   +F  +SD+ V VK   AP  + LT++ ++  YL  + +A S
Sbjct: 1252 LSAVSNLDLRFDVSYNQFHTESDALVTVKGYFAPFYVDLTDLQLQYIYLLSQRIANS 1308

>KAFR0K02100 Chr11 complement(429397..431916) [2520 bp, 839 aa] {ON}
           Anc_7.435 YPR029C
          Length = 839

 Score = 31.2 bits (69), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 32/69 (46%), Gaps = 11/69 (15%)

Query: 67  LEDYKVFSNNADKIQYDLLSTLPFFPEAKDGKRAEIVRTKI---DEDDNFINE------- 116
           L DY   SNN   IQY L S+L    +  D +  E +R  I   D++ N I +       
Sbjct: 574 LNDYHSLSNNNRIIQYILTSSLKMSTKISDSQCIEKLRQLILGHDKNPNLIIQAKSVQCG 633

Query: 117 -FFIQPANV 124
             F QPANV
Sbjct: 634 LLFDQPANV 642

>TBLA0A09040 Chr1 (2225598..2228930) [3333 bp, 1110 aa] {ON}
           Anc_4.113 YGL013C
          Length = 1110

 Score = 30.8 bits (68), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 24/40 (60%)

Query: 188 SKVQTWFHERLKIWFEKRDLLKNPGNNMVVAHSLGAYLMA 227
           +K+Q W      +W++   LL N  N+ +++HSL  +L+A
Sbjct: 728 NKIQVWMDRLGDVWWDMVTLLLNIDNDYILSHSLKFFLVA 767

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.139    0.440 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,460,957
Number of extensions: 2270522
Number of successful extensions: 5169
Number of sequences better than 10.0: 70
Number of HSP's gapped: 5133
Number of HSP's successfully gapped: 101
Length of query: 418
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 306
Effective length of database: 40,638,807
Effective search space: 12435474942
Effective search space used: 12435474942
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)