Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0B008603.485ON1088108853300.0
NCAS0E009503.485ON1052108929940.0
NDAI0G009903.485ON1054110429920.0
Skud_7.4363.485ON1036107829810.0
Suva_7.4133.485ON1037107929620.0
Smik_6.2213.485ON1036108029610.0
YGR125W3.485ON1036107629140.0
KAFR0C019103.485ON1020109328880.0
CAGL0I10626g3.485ON1070104828460.0
TDEL0D055303.485ON1031109027370.0
SAKL0F02926g3.485ON1050109926770.0
Kpol_480.183.485ON1057110626120.0
TBLA0C044403.485ON115091925840.0
ZYRO0C07986g3.485ON102485225820.0
TPHA0D042103.485ON1049110425660.0
Kwal_55.212013.485ON1011109024420.0
KLTH0F14674g3.485ON1010110224420.0
KLLA0E04731g3.485ON1060110123710.0
AFR304W3.485ON101582021780.0
SAKL0B03124g8.99ON7443541362e-07
Smik_16.2418.99ON7442891335e-07
Suva_16.3228.99ON7422891292e-06
Skud_16.2868.99ON7452861255e-06
AGR213Cna 1ON6892911211e-05
ZYRO0F04796g8.99ON7351241183e-05
SAKL0H08800gna 1ON6202621121e-04
TDEL0C012808.99ON7272851122e-04
Ecym_7084na 1ON6892711112e-04
YPR003C8.99ON7542881103e-04
NCAS0B048008.99ON7242861067e-04
NDAI0B022108.99ON7062521040.001
TBLA0C052708.99ON7763601000.004
KLTH0G16764g8.99ON710287990.006
CAGL0L09207g8.99ON725132980.006
KLLA0E14059g8.99ON706482980.006
Kwal_27.110398.99ON726136980.008
Kpol_467.118.99ON744281930.027
KNAG0D023908.99ON716340910.048
KAFR0D011707.73ON30551860.13
TPHA0H007208.99ON787138820.49
Kpol_1050.181.429ON59685820.54
KNAG0L004607.73ON30851771.4
Kpol_2001.331.174ON962128762.6
SAKL0F06809g2singletonON175551762.9
SAKL0C11913g1singletonON175551762.9
SAKL0B11583g2singletonON175551763.0
YFR031C (SMC2)7.186ON1170135753.6
NCAS0I004007.73ON30451734.6
NDAI0A086207.73ON30751735.0
TBLA0D043701.429ON61357736.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0B00860
         (1088 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0B00860 Chr2 complement(156225..159491) [3267 bp, 1088 aa] {...  2057   0.0  
NCAS0E00950 Chr5 complement(171346..174504) [3159 bp, 1052 aa] {...  1157   0.0  
NDAI0G00990 Chr7 complement(205221..208385) [3165 bp, 1054 aa] {...  1157   0.0  
Skud_7.436 Chr7 (721556..724666) [3111 bp, 1036 aa] {ON} YGR125W...  1152   0.0  
Suva_7.413 Chr7 (712372..715485) [3114 bp, 1037 aa] {ON} YGR125W...  1145   0.0  
Smik_6.221 Chr6 (360160..363270) [3111 bp, 1036 aa] {ON} YGR125W...  1145   0.0  
YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative p...  1127   0.0  
KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3....  1117   0.0  
CAGL0I10626g Chr9 complement(1048818..1052030) [3213 bp, 1070 aa...  1100   0.0  
TDEL0D05530 Chr4 (999021..1002116) [3096 bp, 1031 aa] {ON} Anc_3...  1058   0.0  
SAKL0F02926g Chr6 complement(245957..249109) [3153 bp, 1050 aa] ...  1035   0.0  
Kpol_480.18 s480 complement(36794..39967) [3174 bp, 1057 aa] {ON...  1010   0.0  
TBLA0C04440 Chr3 (1075482..1078934) [3453 bp, 1150 aa] {ON} Anc_...   999   0.0  
ZYRO0C07986g Chr3 complement(609503..612577) [3075 bp, 1024 aa] ...   999   0.0  
TPHA0D04210 Chr4 (908861..912010) [3150 bp, 1049 aa] {ON} Anc_3....   993   0.0  
Kwal_55.21201 s55 (727206..730241) [3036 bp, 1011 aa] {ON} YGR12...   945   0.0  
KLTH0F14674g Chr6 (1201874..1204906) [3033 bp, 1010 aa] {ON} sim...   945   0.0  
KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa] ...   917   0.0  
AFR304W Chr6 (991645..994692) [3048 bp, 1015 aa] {ON} Syntenic h...   843   0.0  
SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {...    57   2e-07
Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {...    56   5e-07
Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {...    54   2e-06
Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {...    53   5e-06
AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}...    51   1e-05
ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} simila...    50   3e-05
SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} simila...    48   1e-04
TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {O...    48   2e-04
Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}...    47   2e-04
YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON} ...    47   3e-04
NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {O...    45   7e-04
NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {O...    45   0.001
TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa] ...    43   0.004
KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]...    43   0.006
CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]...    42   0.006
KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} simi...    42   0.006
Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {...    42   0.008
Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON} (26194..2...    40   0.027
KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.9...    40   0.048
KAFR0D01170 Chr4 complement(234381..235298) [918 bp, 305 aa] {ON...    38   0.13 
TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {O...    36   0.49 
Kpol_1050.18 s1050 complement(45297..47087) [1791 bp, 596 aa] {O...    36   0.54 
KNAG0L00460 Chr12 complement(68845..69771) [927 bp, 308 aa] {ON}...    34   1.4  
Kpol_2001.33 s2001 complement(95868..98756) [2889 bp, 962 aa] {O...    34   2.6  
SAKL0F06809g2 Chr6 (518357..519658,519660..523625) [5268 bp, 175...    34   2.9  
SAKL0C11913g1 Chr3 complement(1069940..1073905,1073907..1075208)...    34   2.9  
SAKL0B11583g2 Chr2 (998260..999561,999563..1003528) [5268 bp, 17...    34   3.0  
YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON} ...    33   3.6  
NCAS0I00400 Chr9 complement(60179..61093) [915 bp, 304 aa] {ON} ...    33   4.6  
NDAI0A08620 Chr1 (1987519..1988442) [924 bp, 307 aa] {ON} Anc_7....    33   5.0  
TBLA0D04370 Chr4 complement(1082614..1084455) [1842 bp, 613 aa] ...    33   6.0  

>KNAG0B00860 Chr2 complement(156225..159491) [3267 bp, 1088 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1088

 Score = 2057 bits (5330), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1009/1088 (92%), Positives = 1009/1088 (92%)

Query: 1    MGMSKAHRIKRPARQSISESISVSLGLQNNDARQSDNENPLQVLPGESSYLGRSYVSGLW 60
            MGMSKAHRIKRPARQSISESISVSLGLQNNDARQSDNENPLQVLPGESSYLGRSYVSGLW
Sbjct: 1    MGMSKAHRIKRPARQSISESISVSLGLQNNDARQSDNENPLQVLPGESSYLGRSYVSGLW 60

Query: 61   SPTQRNNKSGYDLLPTSNEQAYSKPIHKSQMLHRQTQAIGENFSDSNGDEGSENKDLNEY 120
            SPTQRNNKSGYDLLPTSNEQAYSKPIHKSQMLHRQTQAIGENFSDSNGDEGSENKDLNEY
Sbjct: 61   SPTQRNNKSGYDLLPTSNEQAYSKPIHKSQMLHRQTQAIGENFSDSNGDEGSENKDLNEY 120

Query: 121  IDLVEHNERKTANIDNVDQIGGLATGPQTTVPGNKTHPVTSPLSDEYGIPDENSRLLLTP 180
            IDLVEHNERKTANIDNVDQIGGLATGPQTTVPGNKTHPVTSPLSDEYGIPDENSRLLLTP
Sbjct: 121  IDLVEHNERKTANIDNVDQIGGLATGPQTTVPGNKTHPVTSPLSDEYGIPDENSRLLLTP 180

Query: 181  XXXXXXXXXXXXXXTPEDYNGRARSPLNGINSTYGSQIPTLSSYSSAGMKIGPPITSKWD 240
                          TPEDYNGRARSPLNGINSTYGSQIPTLSSYSSAGMKIGPPITSKWD
Sbjct: 181  VSSLSVAISDASSLTPEDYNGRARSPLNGINSTYGSQIPTLSSYSSAGMKIGPPITSKWD 240

Query: 241  YISALSHDIVHYXXXXXXXXXXXXXXXXXYGMIIFPITEPIFSQLGPSGLSMFYISTVIS 300
            YISALSHDIVHY                 YGMIIFPITEPIFSQLGPSGLSMFYISTVIS
Sbjct: 241  YISALSHDIVHYLPASILGLLLNILDALSYGMIIFPITEPIFSQLGPSGLSMFYISTVIS 300

Query: 301  QFTYSSGWSSFPCGIGSEMIEVTPFFHTMALTIMKTLGEERKNEIITTTIFCYVISSMXX 360
            QFTYSSGWSSFPCGIGSEMIEVTPFFHTMALTIMKTLGEERKNEIITTTIFCYVISSM  
Sbjct: 301  QFTYSSGWSSFPCGIGSEMIEVTPFFHTMALTIMKTLGEERKNEIITTTIFCYVISSMFT 360

Query: 361  XXXXXXXXXXXXXXXVGFFPRHILIGCIGGVGYFLLITGIEVCTRIAKFEYSIPFLLNLF 420
                           VGFFPRHILIGCIGGVGYFLLITGIEVCTRIAKFEYSIPFLLNLF
Sbjct: 361  GLTFFTLGKLKLGKLVGFFPRHILIGCIGGVGYFLLITGIEVCTRIAKFEYSIPFLLNLF 420

Query: 421  TDEKTLFQWLLPTMLTIILIFTQNRFRNSLVLPSFYILTLILFHFIVAIVPNLSLTKLRN 480
            TDEKTLFQWLLPTMLTIILIFTQNRFRNSLVLPSFYILTLILFHFIVAIVPNLSLTKLRN
Sbjct: 421  TDEKTLFQWLLPTMLTIILIFTQNRFRNSLVLPSFYILTLILFHFIVAIVPNLSLTKLRN 480

Query: 481  SGWIFPVAASNVTWYDHYKYFNFSDVHWALVIKQIPTMMALTFFGILHVPINVPALAMSL 540
            SGWIFPVAASNVTWYDHYKYFNFSDVHWALVIKQIPTMMALTFFGILHVPINVPALAMSL
Sbjct: 481  SGWIFPVAASNVTWYDHYKYFNFSDVHWALVIKQIPTMMALTFFGILHVPINVPALAMSL 540

Query: 541  QMDKYDVDRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGYXXXXXXXXX 600
            QMDKYDVDRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGY         
Sbjct: 541  QMDKYDVDRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGYILIVLTIIV 600

Query: 601  XXXGPVIISFIPICIVGSLIFLLGYELLMEALVDTWGKLNTFEYVTVGIIILTMGIFDFV 660
               GPVIISFIPICIVGSLIFLLGYELLMEALVDTWGKLNTFEYVTVGIIILTMGIFDFV
Sbjct: 601  MLIGPVIISFIPICIVGSLIFLLGYELLMEALVDTWGKLNTFEYVTVGIIILTMGIFDFV 660

Query: 661  LGIIVGILIACFKFLIDSTHLQTVNGEFSGEVAKSTVYRDPIQTTFLDGVGEQIYVLKLQ 720
            LGIIVGILIACFKFLIDSTHLQTVNGEFSGEVAKSTVYRDPIQTTFLDGVGEQIYVLKLQ
Sbjct: 661  LGIIVGILIACFKFLIDSTHLQTVNGEFSGEVAKSTVYRDPIQTTFLDGVGEQIYVLKLQ 720

Query: 721  NLLFFGTIISIEEKIDKLLEISNNDSSKRRIKYLILDFKNINTDNIDYSAAEGFNRIRRF 780
            NLLFFGTIISIEEKIDKLLEISNNDSSKRRIKYLILDFKNINTDNIDYSAAEGFNRIRRF
Sbjct: 721  NLLFFGTIISIEEKIDKLLEISNNDSSKRRIKYLILDFKNINTDNIDYSAAEGFNRIRRF 780

Query: 781  TQTKGIQLIISSIREKDGIYRAFNNVGLLEDVELFQDLNSSLEWCENELLHWYNELRTKA 840
            TQTKGIQLIISSIREKDGIYRAFNNVGLLEDVELFQDLNSSLEWCENELLHWYNELRTKA
Sbjct: 781  TQTKGIQLIISSIREKDGIYRAFNNVGLLEDVELFQDLNSSLEWCENELLHWYNELRTKA 840

Query: 841  KARLRKLNNTANSVVSRLPVSASKQMDSRAITSADQSGRAAISNLMSLPTNTPRNHQMLT 900
            KARLRKLNNTANSVVSRLPVSASKQMDSRAITSADQSGRAAISNLMSLPTNTPRNHQMLT
Sbjct: 841  KARLRKLNNTANSVVSRLPVSASKQMDSRAITSADQSGRAAISNLMSLPTNTPRNHQMLT 900

Query: 901  VAQDVFKNDEQTVSSLRXXXXXXXXXXXXXXXXXXXYRPDIGSNDKLARDKEIAIWSRLC 960
            VAQDVFKNDEQTVSSLR                   YRPDIGSNDKLARDKEIAIWSRLC
Sbjct: 901  VAQDVFKNDEQTVSSLRKQLKTKDPLLPLLLLTLKQYRPDIGSNDKLARDKEIAIWSRLC 960

Query: 961  PYFAKKTMMAQTTLQHCNKIFFLVQTGVLKAVFKLPQGCVYETMANRTCYGKIIDSGTTV 1020
            PYFAKKTMMAQTTLQHCNKIFFLVQTGVLKAVFKLPQGCVYETMANRTCYGKIIDSGTTV
Sbjct: 961  PYFAKKTMMAQTTLQHCNKIFFLVQTGVLKAVFKLPQGCVYETMANRTCYGKIIDSGTTV 1020

Query: 1021 DDADTSNPDFSKLFITTETDSELWVIDAAAMGRLEREDPELFIQLALLVMLIKDKRFKDL 1080
            DDADTSNPDFSKLFITTETDSELWVIDAAAMGRLEREDPELFIQLALLVMLIKDKRFKDL
Sbjct: 1021 DDADTSNPDFSKLFITTETDSELWVIDAAAMGRLEREDPELFIQLALLVMLIKDKRFKDL 1080

Query: 1081 LGHALISA 1088
            LGHALISA
Sbjct: 1081 LGHALISA 1088

>NCAS0E00950 Chr5 complement(171346..174504) [3159 bp, 1052 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1052

 Score = 1157 bits (2994), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 620/1089 (56%), Positives = 743/1089 (68%), Gaps = 57/1089 (5%)

Query: 10   KRPARQSISESISVSLGLQNNDARQSDNENPLQVLPGESSYLGRSYVSGLWS------PT 63
            K+  +QSIS SISVSLGLQ  +  + D  +   V    ++Y+GRSYVSG  S       +
Sbjct: 11   KKNKQQSISGSISVSLGLQQEEEPRDDYFDDENV--NNNNYMGRSYVSGFLSVSPALMGS 68

Query: 64   QRNNKSGYDLLPTSNEQAYSKPIHKSQMLHRQTQAIGENFSDSNGDEGSENKDLNEYIDL 123
             + ++    +     ++ +++PIH S+ LH+QT AI E+F D       ++  + +YI L
Sbjct: 69   MKQDEESLPMAYNGGQRLFNRPIHASEKLHKQTAAISEDFEDD-----EDDTRIKDYITL 123

Query: 124  V--EHNERKTANIDNVDQIGGLATGPQTTVPGNKTHPVTSPLSDEYGIPDENSRLLLTPX 181
               E N       D++DQ  GL  G       +   PV      E    DE+SRLL++P 
Sbjct: 124  FQGEDNGLMADKNDSLDQRLGL--GQDEEAEEDFIEPVA-----EAADVDESSRLLISPL 176

Query: 182  XXXXX--XXXXXXXXTPEDYNGRARSPLNGINSTYGSQIPTLSSYSSAGMKIGPPITSKW 239
                           T ED        ++   S Y +  P+LS  S           + W
Sbjct: 177  SSNINPNIDDLLPTVTGED--------VSSYQSIYRTATPSLSRNSE----------TIW 218

Query: 240  DYISALSHDIVHYXXXXXXXXXXXXXXXXXYGMIIFPITEPIFSQLGPSGLSMFYISTVI 299
              I+   +  +HY                 YGMIIFPITEPIFS LGP+GLSMFYIST+I
Sbjct: 219  QNIADFPYQFIHYLPAAVLGLLLNILDALSYGMIIFPITEPIFSHLGPTGLSMFYISTII 278

Query: 300  SQFTYSSGWSSFPCGIGSEMIEVTPFFHTMALTIMKTLGEERKNEIITTTIFCYVISSMX 359
            SQ  YSSGWSSFP GIGSEMIEVTPFFHTMAL I +TL   R +EIITTTIFCYVISSM 
Sbjct: 279  SQTIYSSGWSSFPSGIGSEMIEVTPFFHTMALAIKETL-PGRDDEIITTTIFCYVISSML 337

Query: 360  XXXXXXXXXXXXXXXXVGFFPRHILIGCIGGVGYFLLITGIEVCTRIAKFEYSIPFLLNL 419
                            VGFFPRHILIGCIGGVGYFLL+TGIEV TR+AKFEYSIPFL +L
Sbjct: 338  TGLTFYSLGKLHLGKIVGFFPRHILIGCIGGVGYFLLVTGIEVTTRVAKFEYSIPFLASL 397

Query: 420  FTDEKTLFQWLLPTMLTIILIFTQNRFRNSLVLPSFYILTLILFHFIVAIVPNLSLTKLR 479
            F+D  TL++WLLP +LT+ILI TQ  F+NSLVLPSFYILTLILFHFIVAI+P+L+L +LR
Sbjct: 398  FSDWATLWKWLLPVLLTVILIVTQRCFKNSLVLPSFYILTLILFHFIVAIIPSLTLNQLR 457

Query: 480  NSGWIFPVAASNVTWYDHYKYFNFSDVHWALVIKQIPTMMALTFFGILHVPINVPALAMS 539
            +SGWIFP+A SN  WYDHYK F+F  VHW LV KQIPTM+ALTFFGILHVPINVPALAMS
Sbjct: 458  DSGWIFPIAISNSKWYDHYKLFDFKKVHWTLVFKQIPTMLALTFFGILHVPINVPALAMS 517

Query: 540  LQMDKYDVDRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGYXXXXXXXX 599
            L +DKYDVD+ELIAHG SNF SG  GSI+NYLVYTNSVLFIRAGADSA+AGY        
Sbjct: 518  LHLDKYDVDKELIAHGLSNFISGAVGSIQNYLVYTNSVLFIRAGADSAMAGYILIILTAI 577

Query: 600  XXXXGPVIISFIPICIVGSLIFLLGYELLMEALVDTWGKLNTFEYVTVGIIILTMGIFDF 659
                GPVIISFIPICIVGSLIFLLGYELL+EAL D WGK++ FEY+T+ II+LTMGIFDF
Sbjct: 578  VMFIGPVIISFIPICIVGSLIFLLGYELLVEALWDPWGKISNFEYITIVIIVLTMGIFDF 637

Query: 660  VLGIIVGILIACFKFLIDSTHLQTVNGEFSGEVAKSTVYRDPIQTTFLDGVGEQIYVLKL 719
            VLGIIVGILIACF FLIDST LQT+NGE+ G VAKSTVYRD IQT FL+G+GEQIYVLKL
Sbjct: 638  VLGIIVGILIACFSFLIDSTKLQTINGEYDGTVAKSTVYRDLIQTKFLNGIGEQIYVLKL 697

Query: 720  QNLLFFGTIISIEEKIDKLLEISNNDSSKRRIKYLILDFKNINTDNIDYSAAEGFNRIRR 779
            QNLLFFGTIISIEEKID+LLEI + DSS+ RIKYLILDFKNIN DNIDYSAAEGFNRI+R
Sbjct: 698  QNLLFFGTIISIEEKIDELLEICHKDSSRLRIKYLILDFKNINADNIDYSAAEGFNRIKR 757

Query: 780  FTQTKGIQLIISSIREKDGIYRAFNNVGLLEDVELFQDLNSSLEWCENELLHWYNELRTK 839
            FTQTK IQL+ISSI+E+D IY+AF+NVGLL+ VELF DLNS+LEWCENE L  Y +LR K
Sbjct: 758  FTQTKKIQLLISSIKERDHIYKAFDNVGLLKGVELFNDLNSALEWCENEFLFKYKQLRDK 817

Query: 840  AKARLRKLNNTANSVVSRLPVSASKQMDSRAITSADQSGRAAISNLMSLPTNTPRNHQML 899
            AK+RL +        +  +  S   Q       +  +S      NLMSLP NTPRNHQ+L
Sbjct: 818  AKSRLHR------KQIIDINASIGSQKYQFTAGNDKKSNLDIPRNLMSLPINTPRNHQIL 871

Query: 900  TVAQDVFKNDEQTVSSLRXXXXXXXXXXXXXXXXXXXYRPDIGSNDKLARDKEIAIWSRL 959
            +VAQ+VF+N+EQTV +L+                   YRP I S DK  ++ EI  WS+L
Sbjct: 872  SVAQNVFQNEEQTVKNLKTELKDQAPFLPLLLFTLKQYRPGIISTDKTVKENEIKFWSQL 931

Query: 960  CPYFAKKTMMAQTTLQHCNKIFFLVQTGVLKAVFKLPQGCVYETMANRTCYGKIIDSGTT 1019
            CPYF K  + +Q+TL H N IFF+V+TG+LKA F LPQG +YETM+NRTCYGKI      
Sbjct: 932  CPYFVKLPLASQSTLIHNNNIFFIVETGILKATFNLPQGNIYETMSNRTCYGKI------ 985

Query: 1020 VDDADTSNPDFSKLFITTETDSELWVIDAAAMGRLEREDPELFIQLALLVMLIKDKRFKD 1079
                  +      L I  E DS LWVID+ ++ ++  E+ ELF +L LL+M +KD RFK+
Sbjct: 986  --TGQHNESTLKTLTIRAEIDSILWVIDSGSLIKMRAENAELFTELTLLIMAVKDNRFKE 1043

Query: 1080 LLGHALISA 1088
            LLG+ L+SA
Sbjct: 1044 LLGYTLVSA 1052

>NDAI0G00990 Chr7 complement(205221..208385) [3165 bp, 1054 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1054

 Score = 1157 bits (2992), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 632/1104 (57%), Positives = 755/1104 (68%), Gaps = 74/1104 (6%)

Query: 8    RIKRPARQSISESISVSLGLQNNDAR--QSDNENP---LQVLPGESSYLGRSYVSGLWSP 62
            R ++  R SIS++ISVSLGLQN D +  Q  N  P   L  +   S+YLGRSYVSG  S 
Sbjct: 2    RRQKNNRHSISDTISVSLGLQNQDPQILQQPNGGPTVTLGNMSDTSNYLGRSYVSGFLSA 61

Query: 63   TQR-NNKSGYDLLPTSNEQAYSKPIHKSQMLHRQTQAIGENFSDSNGDEGSENKDLNEYI 121
            +   N+ +  + LP +N Q  +K IH SQ LHRQT AI E+F+  N     ++ ++ EYI
Sbjct: 62   SPAINHDNNNNTLPIAN-QHLNKSIHASQNLHRQTAAISEDFN--NDPTFEDDINMKEYI 118

Query: 122  DLVEHN------ERKTAN-IDNVDQIGGLATGPQTTVPGNKTHPVTSPLSDEYGIPDENS 174
              +E +      +R TA  IDN D+I  + T         +  PVT     ++   DENS
Sbjct: 119  SNLEDDATGNNGKRYTAYYIDNEDRIDNILT--------EEAEPVT-----DFYPQDENS 165

Query: 175  RLLLTPXXXXXXXXXXXXXXT-----PEDYNGRARSPLNGI-----NSTYGSQIPTLSSY 224
            RLLL+P              +      E    R  S    I      ST  S IPT    
Sbjct: 166  RLLLSPIPSDSLLAGENLLPSISEQEQETAQRRRTSAYQSIRHRNSESTEYSSIPT---- 221

Query: 225  SSAGMKIGPPITSKWDYISALSHDIVHYXXXXXXXXXXXXXXXXXYGMIIFPITEPIFSQ 284
                          W    A   +I+ Y                 YGMIIFPITEPIFS 
Sbjct: 222  --------------WRKYIATPSEIIQYLPASILGLLLTILDALSYGMIIFPITEPIFSH 267

Query: 285  LGPSGLSMFYISTVISQFTYSSGWSSFPCGIGSEMIEVTPFFHTMALTIMKTLGEERKNE 344
            LGP+G+SMFYIST+ISQ  +S GWSSFPCGIGSEMIEVTPFFHTMA  I   L E   ++
Sbjct: 268  LGPTGISMFYISTIISQSIFSGGWSSFPCGIGSEMIEVTPFFHTMAFAIKDALPEGSNDD 327

Query: 345  IITTTIFCYVISSMXXXXXXXXXXXXXXXXXVGFFPRHILIGCIGGVGYFLLITGIEVCT 404
            IITTT+FCYVISSM                 VGFFPRHILIGCIGGVGYFL+ITGIEV T
Sbjct: 328  IITTTLFCYVISSMLTGLTFYSLGKLHLGKIVGFFPRHILIGCIGGVGYFLIITGIEVST 387

Query: 405  RIAKFEYSIPFLLNLFTDEKTLFQWLLPTMLTIILIFTQNRFRNSLVLPSFYILTLILFH 464
            R+AKF+Y+IPF+ +LFTD  TL+QWLLPT+LT+ILI  Q   +NSLVLPSFYILTLILFH
Sbjct: 388  RVAKFQYTIPFITHLFTDVVTLWQWLLPTLLTVILIIAQKCAQNSLVLPSFYILTLILFH 447

Query: 465  FIVAIVPNLSLTKLRNSGWIFPVAASNVTWYDHYKYFNFSDVHWALVIKQIPTMMALTFF 524
            F+VAI+P+LSL +LR+SGWIFP AA++  WYDHYK FN   VHW L++KQIPTM+ALTFF
Sbjct: 448  FMVAIIPSLSLNQLRDSGWIFPQAATDSKWYDHYKLFNLHKVHWTLILKQIPTMLALTFF 507

Query: 525  GILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGA 584
            GILHVPINVPALAMSLQMD+YDVD+ELIAHG SNF SG+FGSI+NYLVYTNSVLFIRAGA
Sbjct: 508  GILHVPINVPALAMSLQMDRYDVDKELIAHGVSNFVSGMFGSIQNYLVYTNSVLFIRAGA 567

Query: 585  DSALAGYXXXXXXXXXXXXGPVIISFIPICIVGSLIFLLGYELLMEALVDTWGKLNTFEY 644
            DSALAG+            GPVIISFIPICIVGSLIFLLGYELL+EALVD  GK++ FEY
Sbjct: 568  DSALAGHILIVLTIIIMIIGPVIISFIPICIVGSLIFLLGYELLVEALVDPLGKISKFEY 627

Query: 645  VTVGIIILTMGIFDFVLGIIVGILIACFKFLIDSTHLQTVNGEFSGEVAKSTVYRDPIQT 704
            +T+ II+ TMGIFDFVLG+IVGILIACF FLIDST LQT+NGEF G VAKSTVYRD IQT
Sbjct: 628  ITIVIIVFTMGIFDFVLGVIVGILIACFSFLIDSTKLQTINGEFDGTVAKSTVYRDLIQT 687

Query: 705  TFLDGVGEQIYVLKLQNLLFFGTIISIEEKIDKLLEISNNDSSKRRIKYLILDFKNINTD 764
             FL+G+GEQIYVLKLQNLLFFGTIISIEEKIDKLLEIS+ DSSK RIKYLILDFKNIN D
Sbjct: 688  KFLNGIGEQIYVLKLQNLLFFGTIISIEEKIDKLLEISDMDSSKHRIKYLILDFKNINAD 747

Query: 765  NIDYSAAEGFNRIRRFTQTKGIQLIISSIREKDGIYRAFNNVGLLEDVELFQDLNSSLEW 824
            NIDYSAAEGFNRI+RFTQTK I+LIISSIRE+D IY AFNNVGLLE VELF DLNS+LEW
Sbjct: 748  NIDYSAAEGFNRIKRFTQTKRIRLIISSIRERDHIYNAFNNVGLLEGVELFNDLNSALEW 807

Query: 825  CENELLHWYNELRTKAKARLRKLNNTANSVVSRLPVSASKQMDSRAITSADQSGRAAISN 884
            CENE L  Y  LR K + + RK     N +   L ++     + R +            N
Sbjct: 808  CENEFLFKYKTLREKTRQK-RK-----NKIDINLAITNGNPTEERNM------HLEIPRN 855

Query: 885  LMSLPTNTPRNHQMLTVAQDVFKNDEQTVSSLRXXXXXXXXXXXXXXXXXXXYRPDIGSN 944
            +MSLP NTPRN+QML+VAQ+VF+N+EQ   +L+                   YRP I SN
Sbjct: 856  IMSLPMNTPRNNQMLSVAQNVFRNEEQAAKALKQQFKNEPSVLPLLLFVLKQYRPRIVSN 915

Query: 945  DKLARDKEIAIWSRLCPYFAKKTMMAQTTLQHCNKIFFLVQTGVLKAVFKLPQGCVYETM 1004
            DK   +KEI  WS+LCPY +++ ++AQ+TL+H N  FF+V++G+LKA F LP G +YETM
Sbjct: 916  DKSIEEKEIKFWSQLCPYLSERFLVAQSTLKHNNNFFFIVESGILKATFTLPSGTLYETM 975

Query: 1005 ANRTCYGKIIDSGTTVDDADTSNPDFSKLFITTETDSELWVIDAAAMGRLEREDPELFIQ 1064
            +NRTCYGKI+ S     + +T+  +   L I TETD  LWVID  A+ R+  E+ EL+I+
Sbjct: 976  SNRTCYGKILGS-----NNETTVLNEQDLTIKTETDCNLWVIDMDALTRMRAENLELYIE 1030

Query: 1065 LALLVMLIKDKRFKDLLGHALISA 1088
            L LL+M I+D RFK+LLG+ L+SA
Sbjct: 1031 LVLLIMSIRDTRFKELLGYTLVSA 1054

>Skud_7.436 Chr7 (721556..724666) [3111 bp, 1036 aa] {ON} YGR125W
            (REAL)
          Length = 1036

 Score = 1152 bits (2981), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 603/1078 (55%), Positives = 742/1078 (68%), Gaps = 65/1078 (6%)

Query: 19   ESISVSLGLQNNDARQSDNENPLQVLPGESSYLGRSYVSGLW----SPTQRNNKSGYDLL 74
            E+ISVSLG+  + ++   +   +  +   S  L RSY+SG +    SP  +N       L
Sbjct: 16   EAISVSLGINQDSSKNKMHRASVSAM---SPPLCRSYMSGFFTGGSSPMVKNMSDSK--L 70

Query: 75   PTSNEQAYSKPIHKSQMLHRQTQAIGENFSDSNGDEGSENKDLNEYIDLVEHNERKTANI 134
            P SN+Q +   IH S+ LHRQT  +   F  S+ +E S    + +Y+D+++ ++RK    
Sbjct: 71   PFSNKQ-HPTVIHGSENLHRQTAQLSNEFCSSSVEENSPT--IKDYMDIIDSDDRKD--- 124

Query: 135  DNVDQIGGLATGPQTTVPGNKTHPVTSPLSDEYGIPDENSRLLLTPXXXXXXXXXXXXXX 194
               DQ                   +   + +EY   DE SRLLL+P              
Sbjct: 125  ---DQ---------------SMRTIVENIDEEYS--DEYSRLLLSPASSNV--------- 155

Query: 195  TPEDYNGRA--RSPLNGINSTYGSQIPTLSSYSSAGMKIGPPITSKWDYISALSHDIVHY 252
              +D   RA    P++ +   YG    +L    S  ++  P   + W + ++      HY
Sbjct: 156  --DDERNRALQSGPISELEDDYGGGYQSLRP--SHNLRFRP--RNIWQWCTSFPFKFAHY 209

Query: 253  XXXXXXXXXXXXXXXXXYGMIIFPITEPIFSQLGPSGLSMFYISTVISQFTYSSGWSSFP 312
                             YGMIIFPITEP+FS LGP+G+SMFYIST+ISQ  YS GWSSFP
Sbjct: 210  LPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQAVYSGGWSSFP 269

Query: 313  CGIGSEMIEVTPFFHTMALTIMKTLGEERKNEIITTTIFCYVISSMXXXXXXXXXXXXXX 372
             GIGSEMIE+TPF+HTMAL +   L E   +EIITTTIFCYVISSM              
Sbjct: 270  SGIGSEMIEITPFYHTMALAVKDAL-EGNDDEIITTTIFCYVISSMLTGVVFYVLGKLRL 328

Query: 373  XXXVGFFPRHILIGCIGGVGYFLLITGIEVCTRIAKFEYSIPFLLNLFTDEKTLFQWLLP 432
               VGFFPRHILIGCIGGVGYFL+ITGIEV TR+AKFEYS PF   LFT+  TL +WLLP
Sbjct: 329  GKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFFSGLFTNYDTLAKWLLP 388

Query: 433  TMLTIILIFTQNRFRNSLVLPSFYILTLILFHFIVAIVPNLSLTKLRNSGWIFPVAASNV 492
             +LT+ILI TQ  F+NSLVLP+FYILTL+LFHFIVAI+P LSL  LR +GWIFP+A S+ 
Sbjct: 389  VLLTVILIGTQRYFKNSLVLPTFYILTLVLFHFIVAIIPTLSLDTLREAGWIFPIANSDS 448

Query: 493  TWYDHYKYFNFSDVHWALVIKQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELI 552
             WYDHYK FN   VHW+LV++QIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELI
Sbjct: 449  KWYDHYKLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELI 508

Query: 553  AHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGYXXXXXXXXXXXXGPVIISFIP 612
            AHGYSNFFSGL GS++NYLVYTNSVLFIRAGADS+ AG+            GPVIISFIP
Sbjct: 509  AHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICVMLIGPVIISFIP 568

Query: 613  ICIVGSLIFLLGYELLMEALVDTWGKLNTFEYVTVGIIILTMGIFDFVLGIIVGILIACF 672
            ICIVGSLIFLLGYELL+EALVDTW KLN FEY+TV II+ TMG+FDFVLGIIVGILIACF
Sbjct: 569  ICIVGSLIFLLGYELLVEALVDTWNKLNRFEYLTVVIIVFTMGVFDFVLGIIVGILIACF 628

Query: 673  KFLIDSTHLQTVNGEFSGEVAKSTVYRDPIQTTFLDGVGEQIYVLKLQNLLFFGTIISIE 732
             FL+DST LQT+NGE++G VAKSTVYRD +QT FLDG+GEQIYVLKLQN+LFFGTIISIE
Sbjct: 629  SFLVDSTKLQTINGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNVLFFGTIISIE 688

Query: 733  EKIDKLLEISNNDSSKRRIKYLILDFKNINTDNIDYSAAEGFNRIRRFTQTKGIQLIISS 792
            EKI+KLL+ISN D+ KRRIKYLILDFKNIN DNIDYSAAEGFNRI+RFT TK I+LIISS
Sbjct: 689  EKIEKLLQISNKDAKKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTGTKRIKLIISS 748

Query: 793  IREKDGIYRAFNNVGLLEDVELFQDLNSSLEWCENELLHWYNELRTKAKARL--RKLNNT 850
            I+E+D IY AFNNVGLL DVELF DLNS+LEWCENE L  Y +LR KAK RL  RK ++ 
Sbjct: 749  IKERDRIYNAFNNVGLLNDVELFADLNSALEWCENEFLFQYKQLREKAKKRLEERKQSSV 808

Query: 851  ANSVVSRLPVSASKQMDSRAITSADQSGRAAISNLMSLPTNTPRNHQMLTVAQDVFKNDE 910
            A+++++    + +K++D      +    R    NLMSLPTNTPRN+QML+VAQ+VF NDE
Sbjct: 809  ASAIMA---ATQNKKIDGLGNGLSTGENRDHARNLMSLPTNTPRNYQMLSVAQNVFVNDE 865

Query: 911  QTVSSLRXXXXXXXXXXXXXXXXXXXYRPDIGSNDKLARDKEIAIWSRLCPYFAKKTMMA 970
            Q V + +                   YRPDI S  +  R+KEI  W++LCPYF ++ + +
Sbjct: 866  QAVKNFKMEYKNDEPILPILLFALKQYRPDIISEIQTVREKEIKFWAQLCPYFTRRRLAS 925

Query: 971  QTTLQHCNKIFFLVQTGVLKAVFKLPQGCVYETMANRTCYGKIIDSGTTVDDADTSNPDF 1030
            Q+ L H + IFFLV+TG+LKA ++LPQG +YE  +N TC+GKII  G  +       P  
Sbjct: 926  QSLLLHADNIFFLVETGMLKATYELPQGTLYEIFSNGTCFGKIIAPGNAM-------PRE 978

Query: 1031 SKLFITTETDSELWVIDAAAMGRLEREDPELFIQLALLVMLIKDKRFKDLLGHALISA 1088
             KL I TETDS LWVID++++ +++ E+  L++++ L+VM IKD RFK+LLG+ L+SA
Sbjct: 979  QKLTIETETDSVLWVIDSSSLKKMKEENLALYVEVTLMVMCIKDTRFKELLGYTLVSA 1036

>Suva_7.413 Chr7 (712372..715485) [3114 bp, 1037 aa] {ON} YGR125W
            (REAL)
          Length = 1037

 Score = 1145 bits (2962), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 610/1079 (56%), Positives = 753/1079 (69%), Gaps = 66/1079 (6%)

Query: 19   ESISVSLGLQNNDARQSDNENPLQVLPGESSYLGRSYVSGLWSPTQRNNKSGYDL----L 74
            E+I+VSLG+   D+  S N+         S  L RSY+SG +  T  ++   Y++    L
Sbjct: 16   EAITVSLGINYQDS--SKNKIHRASASTMSPPLCRSYMSGFF--TGGSSPMNYNMSDPKL 71

Query: 75   PTSNEQAYSKPIHKSQMLHRQTQAIGENFSDSNGDEGSENKDLNEYIDLVEHNERKTANI 134
            P SN+Q + K IH S+ LHRQT  +   F  S+ +E S    + +Y+D+++ ++RK    
Sbjct: 72   PFSNKQ-HPKVIHGSENLHRQTAQLSNEFCSSSVEENSPT--IKDYMDIIDSDDRKD--- 125

Query: 135  DNVDQIGGLATGPQTTVPGNKTHPVTSPLSDEYGIPDENSRLLLTPXXXXXXXXXXXXXX 194
               DQ                   +   + +EY   DE SRLLL+P              
Sbjct: 126  ---DQ---------------SMRTIEENIDEEYA--DEYSRLLLSPASSNV--------- 156

Query: 195  TPEDYNGRAR--SPLNGINSTYGSQIPTLSSYSSAGMKIGPPITSKWDYISALSHDIVHY 252
              +D   RA   SP + +   +G      S + S  ++ GP   S W + ++       Y
Sbjct: 157  --DDERNRALQGSPTSDLEDGHGGGYQ--SVHPSHDLRFGP--RSVWQWFTSFPSKFAQY 210

Query: 253  XXXXXXXXXXXXXXXXXYGMIIFPITEPIFSQLGPSGLSMFYISTVISQFTYSSGWSSFP 312
                             YGMIIFPITEP+FS LGP+G+SMFYIST+ISQ  YS GWSSFP
Sbjct: 211  LPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQSVYSGGWSSFP 270

Query: 313  CGIGSEMIEVTPFFHTMALTIMKTL-GEERKNEIITTTIFCYVISSMXXXXXXXXXXXXX 371
             G+GSEMIE+TPF+HTMAL I + L G +  +EIITTTIFCYVISSM             
Sbjct: 271  SGVGSEMIEITPFYHTMALGIKEALVGSD--DEIITTTIFCYVISSMLTGVVFYVLGKLR 328

Query: 372  XXXXVGFFPRHILIGCIGGVGYFLLITGIEVCTRIAKFEYSIPFLLNLFTDEKTLFQWLL 431
                VGFFPRHILIGCIGGVGYFL+ITGIEV TR+AKFEYS PF+  LFT+  TL +WLL
Sbjct: 329  LGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFVSGLFTNYDTLAKWLL 388

Query: 432  PTMLTIILIFTQNRFRNSLVLPSFYILTLILFHFIVAIVPNLSLTKLRNSGWIFPVAASN 491
            P +LT++LI TQ  F+NSLVLP+FYILTL+LFHFIVAI+P LSL  LR+SGWIFP+A+S+
Sbjct: 389  PVLLTVVLIGTQRCFKNSLVLPTFYILTLVLFHFIVAIIPTLSLDTLRDSGWIFPIASSD 448

Query: 492  VTWYDHYKYFNFSDVHWALVIKQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDREL 551
              WYDHYK FN   VHW LV++QIPTMMALTFFGILHVPINVPALAMSLQMDKYDVD+EL
Sbjct: 449  SKWYDHYKLFNIHKVHWTLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDKEL 508

Query: 552  IAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGYXXXXXXXXXXXXGPVIISFI 611
            IAHGYSNFFSGL GS++NYLVYTNSVLFIRAGADS+ AG+            GPVIISFI
Sbjct: 509  IAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLVALTVCIMVIGPVIISFI 568

Query: 612  PICIVGSLIFLLGYELLMEALVDTWGKLNTFEYVTVGIIILTMGIFDFVLGIIVGILIAC 671
            PICIVGSLIFLLGYELL+EALVDTW KLN FEY+TV II+ TMGIFDFVLGIIVGILIAC
Sbjct: 569  PICIVGSLIFLLGYELLVEALVDTWSKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIAC 628

Query: 672  FKFLIDSTHLQTVNGEFSGEVAKSTVYRDPIQTTFLDGVGEQIYVLKLQNLLFFGTIISI 731
            F FL+DST LQTVNGE++G VAKSTVYRD +QT FLDG+GEQIYVLKLQN+LFFGTIISI
Sbjct: 629  FSFLVDSTKLQTVNGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNVLFFGTIISI 688

Query: 732  EEKIDKLLEISNNDSSKRRIKYLILDFKNINTDNIDYSAAEGFNRIRRFTQTKGIQLIIS 791
            EEKI++LLEISN DS+KRRIKYLILDFKNIN DNIDYSAAEGFNRI+RFT+TK I+LIIS
Sbjct: 689  EEKIERLLEISNKDSTKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRIKLIIS 748

Query: 792  SIREKDGIYRAFNNVGLLEDVELFQDLNSSLEWCENELLHWYNELRTKAKARL--RKLNN 849
            SI+E+D IY AFNNVGLL DVELF DLN +LEWCENE L  Y +LR KAK RL  RK NN
Sbjct: 749  SIKERDHIYNAFNNVGLLNDVELFADLNGALEWCENEFLFQYKQLREKAKKRLEERKQNN 808

Query: 850  TANSVVSRLPVSASKQMDSRAITSADQSGRAAISNLMSLPTNTPRNHQMLTVAQDVFKND 909
              +++++    + +K++D   I       R    +LMSLPTNTPRNHQML+VAQ+VF ND
Sbjct: 809  VVSAIMA---ATQNKKIDRSGIDLNKGGNRDQARHLMSLPTNTPRNHQMLSVAQNVFAND 865

Query: 910  EQTVSSLRXXXXXXXXXXXXXXXXXXXYRPDIGSNDKLARDKEIAIWSRLCPYFAKKTMM 969
            EQ V +L+                   YRPDI S  +  R+KEI  W++LCPYF+++ + 
Sbjct: 866  EQAVKNLKKEYKEDEPVLPILLFALKQYRPDIVSEVQKVREKEIKFWAQLCPYFSRRRLA 925

Query: 970  AQTTLQHCNKIFFLVQTGVLKAVFKLPQGCVYETMANRTCYGKIIDSGTTVDDADTSNPD 1029
            +Q+ L H + +FFL++TG+LKAV++LPQG +YE M+N TC+GKII  G T+       P 
Sbjct: 926  SQSLLLHADNVFFLIETGMLKAVYELPQGSLYEIMSNGTCFGKIIAPGNTM-------PR 978

Query: 1030 FSKLFITTETDSELWVIDAAAMGRLEREDPELFIQLALLVMLIKDKRFKDLLGHALISA 1088
              KL I TETDS LWVID++++ +++ E+  L++++ L++M IKD RFK+LLG+ L+SA
Sbjct: 979  EQKLTIETETDSILWVIDSSSLKKMKEENLALYVEVTLMIMCIKDTRFKELLGYTLVSA 1037

>Smik_6.221 Chr6 (360160..363270) [3111 bp, 1036 aa] {ON} YGR125W
            (REAL)
          Length = 1036

 Score = 1145 bits (2961), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 609/1080 (56%), Positives = 743/1080 (68%), Gaps = 69/1080 (6%)

Query: 19   ESISVSLGLQNNDARQSDNENPLQVLPGESSYLGRSYVSGLWSPTQRN--NKSGYDLLPT 76
            E+ISVSLG+ N D+  S N+     +   S  L RSY+SG ++       N      LP 
Sbjct: 16   EAISVSLGI-NQDS--SINKMHRASVSAMSPPLCRSYMSGFFTGGNSPMINSMSDSKLPL 72

Query: 77   SNEQAYSKPIHKSQMLHRQTQAIGENFSDSNGDEGSENKDLNEYIDLVEHNERKTANIDN 136
            SN+Q + K IH S+ LHRQT  +   F  S+ +E S    + +Y+D+++  +RK      
Sbjct: 73   SNKQ-HPKVIHGSENLHRQTAQLSNEFCSSSVEENSPT--IKDYMDIIDSGDRKD----- 124

Query: 137  VDQIGGLATGPQTTVPGNKTHPVTSPLSDEYGIPDENSRLLLTPXXXXXXXXXXXXXXTP 196
             DQ                   +   + +EY   DE SRLLL+P                
Sbjct: 125  -DQ---------------SMRTIEEDIDEEYS--DEYSRLLLSPASSNIN---------- 156

Query: 197  EDYNGRARSPLNGINST----YGSQIPTLSSYSSAGMKIGPPITSKWDYISALSHDIVHY 252
               + R R   NG+ S     Y     +L S  S  ++  P    +    ++     +HY
Sbjct: 157  ---DDRNRGLQNGLTSELEDDYEGGYQSLRS--SHNLRSRPRNFRRL--CTSFPSKFIHY 209

Query: 253  XXXXXXXXXXXXXXXXXYGMIIFPITEPIFSQLGPSGLSMFYISTVISQFTYSSGWSSFP 312
                             YGMIIFPITEP+FS LGP+G+SMFYIST+ISQ  YS G SSFP
Sbjct: 210  LPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQAVYSGGCSSFP 269

Query: 313  CGIGSEMIEVTPFFHTMALTIMKTLGEERKNEIITTTIFCYVISSMXXXXXXXXXXXXXX 372
             GIGSEMIE+TPF+HTMAL + + L  +  +EIITTTIFCYVISSM              
Sbjct: 270  SGIGSEMIEITPFYHTMALAVKEALAGD-DDEIITTTIFCYVISSMLTGTVFYVLGKLQL 328

Query: 373  XXXVGFFPRHILIGCIGGVGYFLLITGIEVCTRIAKFEYSIPFLLNLFTDEKTLFQWLLP 432
               VGFFPRHILIGCIGGVGYFL+ITGIEV TR+AKFEYS PF L LFT+  TL +WLLP
Sbjct: 329  GKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFFLGLFTNYDTLAKWLLP 388

Query: 433  TMLTIILIFTQNRFRNSLVLPSFYILTLILFHFIVAIVPNLSLTKLRNSGWIFPVAASNV 492
             +LT+ILI TQ  F+NSLVLPSFYILTL+LFHFIVAI+P LSL  LR +GWIFP+A S+ 
Sbjct: 389  VILTVILIGTQRYFKNSLVLPSFYILTLVLFHFIVAIIPTLSLDTLRAAGWIFPIANSDS 448

Query: 493  TWYDHYKYFNFSDVHWALVIKQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELI 552
             WYDHYK FN   VHW+LV++QIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELI
Sbjct: 449  KWYDHYKLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELI 508

Query: 553  AHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGYXXXXXXXXXXXXGPVIISFIP 612
            AHGYSNFFSGL GS++NYLVYTNSVLFIRAGADS+ AG+            GPVIISFIP
Sbjct: 509  AHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICIMMIGPVIISFIP 568

Query: 613  ICIVGSLIFLLGYELLMEALVDTWGKLNTFEYVTVGIIILTMGIFDFVLGIIVGILIACF 672
            ICIVGSLIFLLGYELL+EAL+DTW KLN FEY+TV II+ TMGIFDFVLGIIVGILIACF
Sbjct: 569  ICIVGSLIFLLGYELLVEALIDTWNKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACF 628

Query: 673  KFLIDSTHLQTVNGEFSGEVAKSTVYRDPIQTTFLDGVGEQIYVLKLQNLLFFGTIISIE 732
             FL+DST LQT+NGE++G VAKSTVYRD +QT FLDG+GEQIYVLKLQNLLFFGTI+SIE
Sbjct: 629  SFLVDSTKLQTINGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNLLFFGTILSIE 688

Query: 733  EKIDKLLEISNNDSSKRRIKYLILDFKNINTDNIDYSAAEGFNRIRRFTQTKGIQLIISS 792
            EKI+KLL+ISN D++KRRIKYLILDFKNIN DNIDYSAAEGFNRI+RFT+TK I+LIISS
Sbjct: 689  EKIEKLLQISNKDATKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKKIKLIISS 748

Query: 793  IREKDGIYRAFNNVGLLEDVELFQDLNSSLEWCENELLHWYNELRTKAKARL--RKLNNT 850
            IRE+D IY AFNNVGLL DVELF DLNS+LEWCENE L  Y +LR KAK RL  RK NN 
Sbjct: 749  IRERDRIYNAFNNVGLLNDVELFADLNSALEWCENEFLFQYKQLRIKAKERLEERKQNNI 808

Query: 851  ANSVVSRLPVSASKQMDSRAITSADQSGRA--AISNLMSLPTNTPRNHQMLTVAQDVFKN 908
             ++V     ++A++  +  A+ +    G     + NLMSLPTNTPRN+QML+VAQ+VF N
Sbjct: 809  VSAV-----MAATQNKNINALGNGLNKGNNIDPVRNLMSLPTNTPRNYQMLSVAQNVFVN 863

Query: 909  DEQTVSSLRXXXXXXXXXXXXXXXXXXXYRPDIGSNDKLARDKEIAIWSRLCPYFAKKTM 968
            DEQ V + +                   YRPDI S  +  R+KEI  W++LCPYF ++ +
Sbjct: 864  DEQAVKNFKKEYKDDEPVLPILLFALKQYRPDIISEIQKVREKEIKFWAQLCPYFTRRRL 923

Query: 969  MAQTTLQHCNKIFFLVQTGVLKAVFKLPQGCVYETMANRTCYGKIIDSGTTVDDADTSNP 1028
             +Q+ L H + +FFLV+TG+LKA ++LPQG +YE  +N TC+GKII  G  +       P
Sbjct: 924  ASQSLLLHADNVFFLVETGMLKATYELPQGTLYEIFSNGTCFGKIIAPGNAM-------P 976

Query: 1029 DFSKLFITTETDSELWVIDAAAMGRLEREDPELFIQLALLVMLIKDKRFKDLLGHALISA 1088
               KL I TETDS LWVID++++ +++ E+  L++++AL+VM IKD RFK+LLG+ L+SA
Sbjct: 977  REQKLTIETETDSILWVIDSSSLKKMKEENLALYVEVALMVMCIKDTRFKELLGYTLVSA 1036

>YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative
            protein of unknown function; deletion mutant has
            decreased rapamycin resistance but normal wormannin
            resistance; green fluorescent protein (GFP)-fusion
            protein localizes to the vacuole
          Length = 1036

 Score = 1127 bits (2914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 609/1076 (56%), Positives = 740/1076 (68%), Gaps = 61/1076 (5%)

Query: 19   ESISVSLGLQNNDARQSDNENPLQVLPGESSYLGRSYVSGLWSPTQR---NNKSGYDLLP 75
            E+ISVSLG+ N D+  S N+     +   S  L RSY+SG ++       NN S   L P
Sbjct: 16   EAISVSLGI-NQDS--SVNKMHRASVSAMSPPLCRSYMSGFFTGGNSPMINNLSDSKL-P 71

Query: 76   TSNEQAYSKPIHKSQMLHRQTQAIGENFSDSNGDEGSENKDLNEYIDLVEHNERKTANID 135
             SN+Q + K IH S+ LHRQT  +   F  S+ +E S    + +Y+D++ + +RK     
Sbjct: 72   ISNKQ-HPKVIHGSENLHRQTAQLSNEFCSSSVEENSPT--IKDYMDIIGNGDRKD---- 124

Query: 136  NVDQIGGLATGPQTTVPGNKTHPVTSPLSDEYGIPDENSRLLLTPXXXXXXXXXXXXXXT 195
              DQ                   +   + +EY   DE SRLLL+P               
Sbjct: 125  --DQ---------------SMRTIEENIDEEYS--DEYSRLLLSPASSN----------V 155

Query: 196  PEDYN-GRARSPLNGINSTYGSQIPTLSSYSSAGMKIGPPITSKWDYISALSHDIVHYXX 254
             +D N G   S L  +   Y     +L    S  ++  P   + W   ++      HY  
Sbjct: 156  DDDRNRGLQNSSLPELEDGYAGGYQSLRP--SHNLRFRP--RNLWHMCTSFPSKFAHYLP 211

Query: 255  XXXXXXXXXXXXXXXYGMIIFPITEPIFSQLGPSGLSMFYISTVISQFTYSSGWSSFPCG 314
                           YGMIIFPITEP+FS LGP+G+SMFYIST+ISQ  YS GWSSFP G
Sbjct: 212  AAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQAVYSGGWSSFPSG 271

Query: 315  IGSEMIEVTPFFHTMALTIMKTLGEERKNEIITTTIFCYVISSMXXXXXXXXXXXXXXXX 374
            IGSEMIE+TPF+HTMAL I + L     +EIITTTIFCYVISSM                
Sbjct: 272  IGSEMIEITPFYHTMALAIKEALAGN-DDEIITTTIFCYVISSMLTGVVFYALGKLRLGK 330

Query: 375  XVGFFPRHILIGCIGGVGYFLLITGIEVCTRIAKFEYSIPFLLNLFTDEKTLFQWLLPTM 434
             VGFFPRHILIGCIGGVGYFL+ITGIEV TR+AKFEYS PF   LFTD  TL +WLLP +
Sbjct: 331  IVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFFSGLFTDYDTLAKWLLPVL 390

Query: 435  LTIILIFTQNRFRNSLVLPSFYILTLILFHFIVAIVPNLSLTKLRNSGWIFPVAASNVTW 494
            LT++LI TQ  F+NSLVLPSFYILTL+LFHFIVAI+P LSL  LR +GWIFP+A S+  W
Sbjct: 391  LTVVLIGTQRYFKNSLVLPSFYILTLVLFHFIVAIIPTLSLDALRQAGWIFPIANSDSKW 450

Query: 495  YDHYKYFNFSDVHWALVIKQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAH 554
            YDHY+ FN   VHW+LV++QIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAH
Sbjct: 451  YDHYRLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAH 510

Query: 555  GYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGYXXXXXXXXXXXXGPVIISFIPIC 614
            GYSNFFSGL GS++NYLVYTNSVLFIRAGADS  AG+            GPVIISFIPIC
Sbjct: 511  GYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSPFAGFLLIALTICIMIIGPVIISFIPIC 570

Query: 615  IVGSLIFLLGYELLMEALVDTWGKLNTFEYVTVGIIILTMGIFDFVLGIIVGILIACFKF 674
            IVGSLIFLLGYELL+EALVDTW KLN FEY+TV II+ TMGIFDFVLGIIVGILIACF F
Sbjct: 571  IVGSLIFLLGYELLVEALVDTWNKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSF 630

Query: 675  LIDSTHLQTVNGEFSGEVAKSTVYRDPIQTTFLDGVGEQIYVLKLQNLLFFGTIISIEEK 734
            L+DST LQT+NGE++G VA+STVYRD +QT FLDG+GEQIYVLKLQNLLFFGTIISIEEK
Sbjct: 631  LVDSTKLQTINGEYNGNVARSTVYRDYVQTKFLDGIGEQIYVLKLQNLLFFGTIISIEEK 690

Query: 735  IDKLLEISNNDSSKRRIKYLILDFKNINTDNIDYSAAEGFNRIRRFTQTKGIQLIISSIR 794
            I++LL+ISN D++KRRIKYLILDFKNIN DNIDYSAAEGFNRI+RFT+TK I+LIISSI+
Sbjct: 691  IERLLQISNKDATKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRIKLIISSIK 750

Query: 795  EKDGIYRAFNNVGLLEDVELFQDLNSSLEWCENELLHWYNELRTKAKARLR--KLNNTAN 852
            E+D IY AFNNVGLL DVELF DLNS+LEWCENE L  Y +LR KAK RL   K NN  +
Sbjct: 751  ERDRIYNAFNNVGLLNDVELFADLNSALEWCENEFLFQYKQLRKKAKERLEEGKQNNVVS 810

Query: 853  SVVSRLPVSASKQMDSRAITSADQSGRAAISNLMSLPTNTPRNHQMLTVAQDVFKNDEQT 912
            +V++    + +K++D+        S      NLMSLPTNTPRN+Q+L+VAQ+VF NDEQ 
Sbjct: 811  AVIA---ATKNKKIDTIGNGLNRGSNGDTARNLMSLPTNTPRNYQILSVAQNVFVNDEQA 867

Query: 913  VSSLRXXXXXXXXXXXXXXXXXXXYRPDIGSNDKLARDKEIAIWSRLCPYFAKKTMMAQT 972
            V + +                   YRPDI S  +  R+KEI  W++LCPYF ++ + +Q+
Sbjct: 868  VKNFKKEYKDDEPVLPILLFALKQYRPDIISEVQKVREKEIKFWAQLCPYFTRRRLASQS 927

Query: 973  TLQHCNKIFFLVQTGVLKAVFKLPQGCVYETMANRTCYGKIIDSGTTVDDADTSNPDFSK 1032
             L H + IFFLV+TG+LKA ++LPQG +YE  +N TC+GKII  G  +       P   K
Sbjct: 928  HLLHADNIFFLVETGMLKATYELPQGTLYEIFSNGTCFGKIIAPGNAM-------PREQK 980

Query: 1033 LFITTETDSELWVIDAAAMGRLEREDPELFIQLALLVMLIKDKRFKDLLGHALISA 1088
            L I TETDS LWVID++++ +L+ ++  L++++AL+VM IKD RFK+LLG+ L+SA
Sbjct: 981  LTIETETDSVLWVIDSSSLNKLKEDNLALYVEVALMVMCIKDTRFKELLGYTLVSA 1036

>KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3.485
            YGR125W
          Length = 1020

 Score = 1117 bits (2888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 607/1093 (55%), Positives = 741/1093 (67%), Gaps = 87/1093 (7%)

Query: 4    SKAHRIKRPARQSISESISVSLGLQNNDARQSDNENPLQVLPGESSYLGRSYVSGLWSPT 63
            +K++  +   R S+S+SIS SLGLQ+ ++  +  +N L     +S+YL RSY+ GL    
Sbjct: 5    NKSNDARASKRLSLSDSISRSLGLQDQESNIAGTDNELS--NSKSNYLSRSYMYGLLPSA 62

Query: 64   QRNNKSGYDLLPTSNEQAYSKPIHKSQMLHRQTQAIGENFSDSNGDEGSENKDLNEYIDL 123
                +   + LP SN+   +K IH+S++LH+QT AI E+F++S  DEGS    + +Y+D 
Sbjct: 63   TPVEELETNTLPLSND-LRNKSIHQSRILHKQTAAICEDFNES--DEGS----MKDYLDF 115

Query: 124  VEHNERKTANIDNVDQIGGLATGPQTTVPGNKTHPVTSPLS---DEYGIPDENSRLLLTP 180
            +E+ +R     DN+++               ++ PVT  LS   DE    DE+SRLLLTP
Sbjct: 116  IENTDR-----DNINE-------------HKESLPVTVVLSTPADEVEEQDESSRLLLTP 157

Query: 181  XXXXXXXXXXXXXXTPEDYNGRARSPLNGINSTYGSQIPTLSSYSSAGMKIGPPITSKWD 240
                               N    S   G+   Y S    + S     M    PI  + D
Sbjct: 158  SSS----------------NAEVSSIAEGLRHHYSS----IESTKDNNM----PIEEQQD 193

Query: 241  -----YISALSHDIVHYXXXXXXXXXXXXXXXXXYGMIIFPITEPIFSQLGPSGLSMFYI 295
                  +S   ++ + Y                 YGMIIFPI+EPIFS LGP+G+SMFYI
Sbjct: 194  NTINEKLSTFFYNTLQYFPASVLGLLLNILDALSYGMIIFPISEPIFSHLGPTGMSMFYI 253

Query: 296  STVISQFTYSSGWSSFPCGIGSEMIEVTPFFHTMALTIMKTL-GEERKNEIITTTIFCYV 354
            ST+I QF YSSGWSSFP  IGSEMIE+TPFFHTMA  IM++L GEE ++ IITTTIFCYV
Sbjct: 254  STIICQFIYSSGWSSFPSCIGSEMIEITPFFHTMAFAIMRSLPGEENQDAIITTTIFCYV 313

Query: 355  ISSMXXXXXXXXXXXXXXXXXVGFFPRHILIGCIGGVGYFLLITGIEVCTRIAKFEYSIP 414
            ISSM                 VGFFPRHILIGCIGGVGYFLLITGIEV TRIAKFEYS+P
Sbjct: 314  ISSMFTGLTFLTLGKLRLGKIVGFFPRHILIGCIGGVGYFLLITGIEVTTRIAKFEYSLP 373

Query: 415  FLLNLFTDEKTLFQWLLPTMLTIILIFTQNRFRNSLVLPSFYILTLILFHFIVAIVPNLS 474
             +  LFTD   L++WL PT+LT++LI TQ  F+ SLVLPSFYI TLILFHFIVAI+P LS
Sbjct: 374  LIKELFTDTSMLWKWLTPTLLTVVLILTQKCFKRSLVLPSFYIATLILFHFIVAIIPRLS 433

Query: 475  LTKLRNSGWIFPVAASNVTWYDHYKYFNFSDVHWALVIKQIPTMMALTFFGILHVPINVP 534
            LT+LR +GWIF   A N  WYDHYK F+F  VHW LV KQIPTM+ALTFFGILHVPINVP
Sbjct: 434  LTQLREAGWIFSNTAPNSAWYDHYKLFDFHKVHWLLVFKQIPTMLALTFFGILHVPINVP 493

Query: 535  ALAMSLQMDKYDVDRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGYXXX 594
            ALAMS+QMDKYDVD+ELIAHG SN  SG+FGSI+NYLVYTNSVLFIRAGADS  AGY   
Sbjct: 494  ALAMSVQMDKYDVDKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLI 553

Query: 595  XXXXXXXXXGPVIISFIPICIVGSLIFLLGYELLMEALVDTWGKLNTFEYVTVGIIILTM 654
                     GPVIISFIPICIVGSLIFLLGYELL+EAL+DTW KL TFEYVTV +I+LTM
Sbjct: 554  FLTIVVMLIGPVIISFIPICIVGSLIFLLGYELLVEALLDTWDKLTTFEYVTVVVIVLTM 613

Query: 655  GIFDFVLGIIVGILIACFKFLIDSTHLQTVNGEFSGEVAKSTVYRDPIQTTFLDGVGEQI 714
            GI DFVLGIIVGILIACFKFLIDS+ LQT+NGEFSG+VAKSTV RD IQ+ FL+G+G+QI
Sbjct: 614  GIVDFVLGIIVGILIACFKFLIDSSKLQTINGEFSGKVAKSTVNRDLIQSKFLNGIGDQI 673

Query: 715  YVLKLQNLLFFGTIISIEEKIDKLLEISNNDSSKRRIKYLILDFKNINTDNIDYSAAEGF 774
            YVLKLQNLLFFGTIISIEEKIDKLLE+S+ +SSKR+IKYLILDF+NIN DNIDYSAAEGF
Sbjct: 674  YVLKLQNLLFFGTIISIEEKIDKLLEMSDRNSSKRQIKYLILDFRNINADNIDYSAAEGF 733

Query: 775  NRIRRFTQTKGIQLIISSIREKDGIYRAFNNVGLLEDVELFQDLNSSLEWCENELLHWYN 834
            NRI+R T++K IQLIISSI+ +D IY +FN VGLL  VELF DLN +LEWCENE L+ Y 
Sbjct: 734  NRIKRLTESKNIQLIISSIKVRDRIYNSFNKVGLLVGVELFNDLNGALEWCENEFLYQYK 793

Query: 835  ELRTKAKARLRKLNNTANSVVSRLPVSASKQMDSRAITSADQSGRAAISNLMSLPTNTPR 894
             +R + K +  K                       A  S+D  G  +  + M+L  NTPR
Sbjct: 794  MIRERIKIKNVK----------------------TATHSSD--GNLSKPSAMTLSINTPR 829

Query: 895  NHQMLTVAQDVFKNDEQTVSSLRXXXXXXXXXXXXXXXXXXXYRPDIGSNDKLARDKEIA 954
            N+Q+ +VAQ++FKN+EQTV  L+                   YRPDI S DK+ + KEI 
Sbjct: 830  NYQIYSVAQNIFKNEEQTVDRLKNRFQDQTPVLPLLLFALKQYRPDIVSVDKVKKGKEIE 889

Query: 955  IWSRLCPYFAKKTMMAQTTLQHCNKIFFLVQTGVLKAVFKLPQGCVYETMANRTCYGKII 1014
             WS+L PYF+KK + +Q+ L H N IFFLV+ GVLK  F LPQG VYETM+ R CYGKI+
Sbjct: 890  FWSQLAPYFSKKRIASQSILYHGNNIFFLVEIGVLKVTFDLPQGKVYETMSKRACYGKIM 949

Query: 1015 DSGTTVDDADTSNPDFSKLFITTETDSELWVIDAAAMGRLEREDPELFIQLALLVMLIKD 1074
                 V +AD   P    + I TE D+ +W+ID++A+ +++ E+ EL+++L LLVM IKD
Sbjct: 950  -GKIPVSEADA--PSSQAMIIKTEADTVIWIIDSSALKKMKDENIELYLELVLLVMTIKD 1006

Query: 1075 KRFKDLLGHALIS 1087
             RFK LLGHAL+S
Sbjct: 1007 IRFKSLLGHALVS 1019

>CAGL0I10626g Chr9 complement(1048818..1052030) [3213 bp, 1070 aa]
            {ON} similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125w
          Length = 1070

 Score = 1100 bits (2846), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 578/1048 (55%), Positives = 710/1048 (67%), Gaps = 48/1048 (4%)

Query: 48   SSYLGRSYVSGLWSPT-----QRNNKSGYDLLPTSNEQAYSKPIHKSQMLHRQTQAIGEN 102
            +++LGRSYVSG+   +     +RN       LP SN+   S+ IH+   LHRQT AI E 
Sbjct: 64   NTFLGRSYVSGILGSSLPQGGERNT------LPVSNKFG-SRAIHEQNKLHRQTAAIAEE 116

Query: 103  FSDSNGDEGSENKDLNEYIDLVEHNERKTANIDNV-DQIGGLATGPQTTVPGNKTHPVTS 161
            F D  G  G     L EY++L++  + +  ++ N  D    L T  +T V  N       
Sbjct: 117  FDD--GTIGESPSSLKEYLNLLDEAQEEELDLRNRRDLDNDLITDNKTPVSINLKRATDP 174

Query: 162  PLSDEYGIPDENSRLLLTPXXXXXXXXXXXXXXTPEDYNGRARSPLNGINSTYGSQIPTL 221
             L       ++ +  LLTP              +PE+    A S      STY S    +
Sbjct: 175  EL-------EQQTVALLTPSSSNNDNYGSV---SPEENFLSATSNYEQ-ESTYQS----I 219

Query: 222  SSYSSAGMKIGPPITSKWDYISALSHDIVHYXXXXXXXXXXXXXXXXXYGMIIFPITEPI 281
            +   SAG +  P  T+   +++     + +Y                 YGMIIFPITEPI
Sbjct: 220  TVVPSAGFRQMPTSTTAKAWMTL--KRVTNYMPAAILGLLLNILDALSYGMIIFPITEPI 277

Query: 282  FSQLGPSGLSMFYISTVISQFTYSSGWSSFPCGIGSEMIEVTPFFHTMALTIMKTLGEER 341
            F+QLGP+G+SMFYIST+ISQF YSSGWSSFP GIGSEMIE+TPF+HTMAL I + L   R
Sbjct: 278  FAQLGPTGISMFYISTIISQFIYSSGWSSFPSGIGSEMIEITPFYHTMALAISQAL-PGR 336

Query: 342  KNEIITTTIFCYVISSMXXXXXXXXXXXXXXXXXVGFFPRHILIGCIGGVGYFLLITGIE 401
             +EIITTTIFCYVISS+                 VGFFPRHILIGCIGGVGYFL+ITG+E
Sbjct: 337  DDEIITTTIFCYVISSVITGLTFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGLE 396

Query: 402  VCTRIAKFEYSIPFLLNLFTDEKTLFQWLLPTMLTIILIFTQNRFRNSLVLPSFYILTLI 461
            V TRIAKFEYSIPFL  LF D   LF+WLLPT+LTIILI TQ  F+NSLVLPSFYI+TLI
Sbjct: 397  VTTRIAKFEYSIPFLTKLFLDSSMLFKWLLPTILTIILIVTQKCFKNSLVLPSFYIITLI 456

Query: 462  LFHFIVAIVPNLSLTKLRNSGWIFPVAASNVTWYDHYKYFNFSDVHWALVIKQIPTMMAL 521
            LFHF+VAI PNLSL +LR +GWIFP    +  WYDHY+YF+    HW+LV+KQIPTM+AL
Sbjct: 457  LFHFVVAIAPNLSLHQLRKTGWIFPAPEVSSKWYDHYRYFDIGKAHWSLVVKQIPTMLAL 516

Query: 522  TFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIR 581
            TFFGILHVPINVPALAMSLQMDKYDVD+ELIAHGYSNFFSGLFGS++NYLVYTNSVLFIR
Sbjct: 517  TFFGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLFGSVQNYLVYTNSVLFIR 576

Query: 582  AGADSALAGYXXXXXXXXXXXXGPVIISFIPICIVGSLIFLLGYELLMEALVDTWGKLNT 641
            AGADSA+AGY            GPVIISFIPICIVGSLIFLLGYELL+EA++D +GK+ T
Sbjct: 577  AGADSAIAGYVLIVLTIMVMVIGPVIISFIPICIVGSLIFLLGYELLVEAMIDPFGKVTT 636

Query: 642  FEYVTVGIIILTMGIFDFVLGIIVGILIACFKFLIDSTHLQTVNGEFSGEVAKSTVYRDP 701
            FEY T+GII+LTMGIFDFVLGI+VGILIACF FL+DST LQTVNGEF G VAKSTVYRD 
Sbjct: 637  FEYATIGIIVLTMGIFDFVLGIVVGILIACFSFLVDSTKLQTVNGEFDGTVAKSTVYRDF 696

Query: 702  IQTTFLDGVGEQIYVLKLQNLLFFGTIISIEEKIDKLLEISNNDSSKRRIKYLILDFKNI 761
             QT FL  +GEQIYVLKLQN+LFFGTIISIEEKI++LLEIS+ND SK RIK+LILDFKNI
Sbjct: 697  TQTRFLSQIGEQIYVLKLQNILFFGTIISIEEKIERLLEISDNDVSKHRIKFLILDFKNI 756

Query: 762  NTDNIDYSAAEGFNRIRRFTQTKGIQLIISSIREKDGIYRAFNNVGLLEDVELFQDLNSS 821
            N DNIDYSAAEGFNRI+R+T+ K I+LIIS+IRE D IY  FN VGLL+D+ELF DLNS+
Sbjct: 757  NADNIDYSAAEGFNRIKRYTEAKRIKLIISTIRESDRIYHVFNQVGLLQDIELFNDLNSA 816

Query: 822  LEWCENELLHWYNELRTKAKARLRKLNNTANSVVSRLPVSASKQMDSRAITSADQSGRAA 881
            LEWCENE L+ Y ELR KA+ +L++ +   N+ +         Q+     T+ +Q   ++
Sbjct: 817  LEWCENEFLYQYKELREKARNKLQRRSKNINAAI-------GNQLRRYDQTNKNQGPTSS 869

Query: 882  I-SNLMSLPTNTPRNHQMLTVAQDVFKNDEQTVSSLRXXXXXXXXXXXXXXXXXXXYRPD 940
            +  NLMSL  NTPRN+Q+++ AQ  F N++Q  + +                    YRP+
Sbjct: 870  LMQNLMSLSNNTPRNYQLVSAAQQAFSNEQQISTEIDTKLKIPDPLLKVLLFALKLYRPN 929

Query: 941  IGSNDKLARDKEIAIWSRLCPYFAKKTMMAQTTLQHCNKIFFLVQTGVLKAVFKLPQGCV 1000
            I S D   R  E+  W +LCPYF +K   A TT  H N  FFLV  G+LK ++ LP G V
Sbjct: 930  IVSMDTEKRTDEVEFWKQLCPYFTRKVFTANTTFLHNNNFFFLVDAGILKVIYNLPAGSV 989

Query: 1001 YETMANRTCYGKIIDSGTTVDDADTSNPDFSKLFITTETDSELWVIDAAAMGRLEREDPE 1060
            YET++N TCYGKI+         D  N +   L +  ETD+ LW+ID  +M  ++ ++  
Sbjct: 990  YETLSNGTCYGKILSK------RDNENIN-QNLRVQVETDTILWIIDEKSMEIMKMDNIV 1042

Query: 1061 LFIQLALLVMLIKDKRFKDLLGHALISA 1088
            L+ +L LL++ I+D RFK+LLG+ L+SA
Sbjct: 1043 LYTELVLLILAIRDTRFKELLGYTLVSA 1070

>TDEL0D05530 Chr4 (999021..1002116) [3096 bp, 1031 aa] {ON} Anc_3.485
            YGR125W
          Length = 1031

 Score = 1058 bits (2737), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 575/1090 (52%), Positives = 726/1090 (66%), Gaps = 80/1090 (7%)

Query: 10   KRPARQSISESISVSLGLQN----NDARQSDNENPL-----QVLPGESSYLGRSYVSGLW 60
            +   R SISE+ISVSLGLQN     D    ++ NP      Q +   ++YLGRSYVSG  
Sbjct: 11   RNRGRHSISEAISVSLGLQNTNTPRDHHDGNHSNPYDSQNDQFMSPRNNYLGRSYVSGFL 70

Query: 61   SPTQRNNKS-GYDLLPTSNEQAYSKPIHKSQMLHRQTQAIGENFSDSNGDEGSENKDLNE 119
            S +   + S   D LP +  +  +K IH ++ LHRQT  + E+F++ N     E+ ++ +
Sbjct: 71   SCSPYGSNSLESDRLPIARMR--TKSIHAAKNLHRQTAKLCEDFNEPN----VEDNNIQD 124

Query: 120  YIDLVEHNERKTANIDNVDQIGGLATGPQTTVPGNKTHPVTSPLSDEYGIPDENSRLLLT 179
            Y+   E  E +   I + +++       Q     N  H  T    D+  I D    L+  
Sbjct: 125  YVSATE--EPRPMEISDAERMYD-----QEDELRNPVHVNTEDRGDD--IEDVYESLV-- 173

Query: 180  PXXXXXXXXXXXXXXTPEDYNGRARSPLNGINSTYGSQIPTLSSYSSAGMKIGPPITSKW 239
                               Y     SP  G+ ++  S +                    W
Sbjct: 174  -------------TGAHGGYRAIPTSPGGGLRTSSRSAL--------------------W 200

Query: 240  DYISALSHDIVHYXXXXXXXXXXXXXXXXXYGMIIFPITEPIFSQLGPSGLSMFYISTVI 299
                + S  +VHY                 YGMIIFPITEPIFS LGPSGLSMFY+ST+I
Sbjct: 201  RQFMSSSSKLVHYLPATILGLLLNVLDGLSYGMIIFPITEPIFSHLGPSGLSMFYVSTII 260

Query: 300  SQFTYSSGWSSFPCGIGSEMIEVTPFFHTMALTIMKTLGEERKNEIITTTIFCYVISSMX 359
            SQ  YSSG+S+FP G+GSEMIEVTPFFH+MAL I   L   R +EI+TTTIFCYVISS+ 
Sbjct: 261  SQVIYSSGFSNFPTGVGSEMIEVTPFFHSMALAIKDAL-PGRDDEILTTTIFCYVISSLV 319

Query: 360  XXXXXXXXXXXXXXXXVGFFPRHILIGCIGGVGYFLLITGIEVCTRIAKFEYSIPFLLNL 419
                            VGFFPRHILIGCIGGVGYFL++TG+EV TR+AK EY+ PF+ ++
Sbjct: 320  TGLTFYVLGKMKLGKIVGFFPRHILIGCIGGVGYFLVVTGLEVTTRVAKLEYTWPFISHM 379

Query: 420  FTDEKTLFQWLLPTMLTIILIFTQNRFRNSLVLPSFYILTLILFHFIVAIVPNLSLTKLR 479
            FTD  TL +W+LP +LT++LI TQ  F+NSLVLP+FYI TL+ FHF+VAI+PN+SL KLR
Sbjct: 380  FTDVSTLVKWVLPVLLTVLLIVTQRHFQNSLVLPTFYIATLVAFHFVVAIIPNVSLGKLR 439

Query: 480  NSGWIFPVAASNVTWYDHYKYFNFSDVHWALVIKQIPTMMALTFFGILHVPINVPALAMS 539
            N GWIFPVAAS   WYDHYK F    VHW L+ KQ PTM+AL+FFGILHVPINVPALA+S
Sbjct: 440  NMGWIFPVAASKDQWYDHYKLFQPHRVHWGLIAKQAPTMLALSFFGILHVPINVPALAIS 499

Query: 540  LQMDKYDVDRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGYXXXXXXXX 599
            LQMDKYDVD+ELIAHGYSN  SG  GSI+NYLVYTNS+LFIRAGADSA+AGY        
Sbjct: 500  LQMDKYDVDKELIAHGYSNLLSGALGSIQNYLVYTNSLLFIRAGADSAMAGYLLAFLTFI 559

Query: 600  XXXXGPVIISFIPICIVGSLIFLLGYELLMEALVDTWGKLNTFEYVTVGIIILTMGIFDF 659
                GPVIIS+IPICIVGSLIFLLGYELL EAL++T GK+  FEY+T+ II+LTMGIFDF
Sbjct: 560  MMVIGPVIISYIPICIVGSLIFLLGYELLYEALIETRGKVTNFEYITICIIVLTMGIFDF 619

Query: 660  VLGIIVGILIACFKFLIDSTHLQTVNGEFSGEVAKSTVYRDPIQTTFLDGVGEQIYVLKL 719
            VLG+IVGILIACF FL+DST LQT+NGE+ G++AKSTVYRD +Q+ FLDG+GEQIYVLKL
Sbjct: 620  VLGVIVGILIACFSFLVDSTKLQTINGEYDGKIAKSTVYRDYVQSRFLDGIGEQIYVLKL 679

Query: 720  QNLLFFGTIISIEEKIDKLLEISNND-SSKRRIKYLILDFKNINTDNIDYSAAEGFNRIR 778
            Q+LLFFGTIISIEEKI+KLLEIS++  +SKRRIK LILD KNIN DNIDYSAAEGFNRI+
Sbjct: 680  QSLLFFGTIISIEEKINKLLEISDDQKNSKRRIKCLILDLKNINADNIDYSAAEGFNRIK 739

Query: 779  RFTQTKGIQLIISSIREKDGIYRAFNNVGLLEDVELFQDLNSSLEWCENELLHWYNELRT 838
            RFTQ+K IQLIISSI E D IY AF+ V LL+DVELF DLN +LEWCENELL  Y ELR 
Sbjct: 740  RFTQSKHIQLIISSISETDHIYTAFSKVKLLDDVELFGDLNGALEWCENELLFKYKELRA 799

Query: 839  KAKARLRKLNNTANSVVSRLPVSASKQMDSRAITSADQSGRAAISNLMSLPTNTPRNHQM 898
            KA+ RL+     AN   +          D++AI    +S    + NLMSLP NTPRN QM
Sbjct: 800  KARDRLQNKMQMANLAANN---------DTKAIDGVPKSHH--MQNLMSLPFNTPRNDQM 848

Query: 899  LTVAQDVFKNDEQTVSSLRXXXXXXXXXXXXXXXXXXXYRPDIGSNDKLARDKEIAIWSR 958
            L+VAQ VFKN+++TV SL+                   YRP I S D   ++ E+ +WS+
Sbjct: 849  LSVAQRVFKNEQKTVDSLKVNYKELPPVLPLLLFALKPYRPGILSEDTNVKNSELELWSK 908

Query: 959  LCPYFAKKTMMAQTTLQHCNKIFFLVQTGVLKAVFKLPQGCVYETMANRTCYGKIIDSGT 1018
            LCPYF ++ + +Q+ L H + IFF+++TG+LK V+ LPQG VYE+++NRTCYG +++ GT
Sbjct: 909  LCPYFTRRRLASQSILLHNSDIFFVMETGILKIVYDLPQGIVYESLSNRTCYGIVLNPGT 968

Query: 1019 TVDDADTSNPDFSKLFITTETDSELWVIDAAAMGRLEREDPELFIQLALLVMLIKDKRFK 1078
                        SK+ I TET+  LWVID++ + RL++E+  L+ +L LL+  +K++R++
Sbjct: 969  RPCSE-------SKVTIKTETEVVLWVIDSSILARLKQENLSLYTELILLIATVKEQRYR 1021

Query: 1079 DLLGHALISA 1088
             +LG+ L+SA
Sbjct: 1022 QILGYTLVSA 1031

>SAKL0F02926g Chr6 complement(245957..249109) [3153 bp, 1050 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1050

 Score = 1035 bits (2677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 565/1099 (51%), Positives = 714/1099 (64%), Gaps = 73/1099 (6%)

Query: 11   RPARQSISESISVSLGLQNNDARQSDNENPLQVLPGESS---YLGRSYVSGLWSPT--QR 65
            +  R+SISE+I++SLGL +++ +Q    N    +  E+S   YLGRSYV    SP+  QR
Sbjct: 4    KKNRKSISEAITISLGLHSDNIKQPSQANRRSSMNPENSSNYYLGRSYVGSFSSPSFLQR 63

Query: 66   NNKSGYDLLPTSNEQAYSKPIHKSQMLHRQTQAIGENFSDSNGDEGSENKDLNEYIDLVE 125
             + +    + + ++ A SK IH+S  LHRQT A+  NF DS+ D  S+  D+    +   
Sbjct: 64   ESSADTGHILSLHKDA-SKSIHESVKLHRQTAALSNNFDDSS-DGKSDEIDVAASQEFQN 121

Query: 126  HNERKTANIDNVDQIGGLATGPQTTVPGNKTHPVTSPLSDEYGIPDENSRLLLTPXXXXX 185
               ++  +++N    G  +         N+       ++ E    +E +RLL +P     
Sbjct: 122  EALQRELSLEN----GSYSNSNNNNNNNNQIAYSEDAITQENNGLNECTRLL-SPTSAAA 176

Query: 186  XXXXXXXXXT----------PEDYNGRA--RSPLNGI-NSTYGSQIPTLSSYSSAGMKIG 232
                     T           E Y       SP + + +   G      ++Y S      
Sbjct: 177  TDLEYGTSPTNLSPPSSQYEQEQYVSLVADHSPSSAVYDQATGDGDNAFNTYHSLRQ--- 233

Query: 233  PPITSKWDYISALSHDIVHYXXXXXXXXXXXXXXXXXYGMIIFPITEPIFSQLGPSGLSM 292
            P + S +DY    S   ++Y                 YGMIIFPITEP+FS LGP+GLSM
Sbjct: 234  PVVRSYYDYAKGWSIKTLNYMPAVILGLLLNVLDALSYGMIIFPITEPVFSHLGPTGLSM 293

Query: 293  FYISTVISQFTYSSGWSSFPCGIGSEMIEVTPFFHTMALTIMKTLGEERKNEIITTTIFC 352
            FY+ST++SQ  YS G+S+F  GIGSEMIE+TPFFHTMAL+IM +L     +EII+TTI C
Sbjct: 294  FYVSTILSQLVYSCGFSAFGNGIGSEMIEITPFFHTMALSIMNSL-PGHDDEIISTTIVC 352

Query: 353  YVISSMXXXXXXXXXXXXXXXXXVGFFPRHILIGCIGGVGYFLLITGIEVCTRIAKFEYS 412
            Y +SS+                 VGFFPRHILIGC+GGVGYFLLITGIEVCTR++KFEYS
Sbjct: 353  YALSSIFTGLAFFLLGKLRLGKIVGFFPRHILIGCVGGVGYFLLITGIEVCTRVSKFEYS 412

Query: 413  IPFLLNLFTDEKTLFQWLLPTMLTIILIFTQNRFRNSLVLPSFYILTLILFHFIVAIVPN 472
             PFL  LF + + L +W+LP +LT+ LI TQ+ F NSLVLPSFYI+TL LFHF+VAIVPN
Sbjct: 413  WPFLRELFYNTEVLGKWMLPLILTLSLIVTQHYFNNSLVLPSFYIITLALFHFVVAIVPN 472

Query: 473  LSLTKLRNSGWIFPVAASNVTWYDHYKYFNFSDVHWALVIKQIPTMMALTFFGILHVPIN 532
            LSL  LR SGWIFP+A S+  WYD YK ++F +VHW LV+KQ+PTM+ALTFFGILHVPIN
Sbjct: 473  LSLNSLRESGWIFPMAGSSNHWYDFYKLYDFQNVHWTLVLKQVPTMLALTFFGILHVPIN 532

Query: 533  VPALAMSLQMDKYDVDRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGYX 592
            VPALAMS+ MDK+DVD+ELIAHGYSN  SG  GSI+NYLVYTNS LFIRAG+DS+ AG+ 
Sbjct: 533  VPALAMSIGMDKFDVDKELIAHGYSNLLSGFSGSIQNYLVYTNSFLFIRAGSDSSWAGFL 592

Query: 593  XXXXXXXXXXXGPVIISFIPICIVGSLIFLLGYELLMEALVDTWGKLNTFEYVTVGIIIL 652
                       GPVIISFIPICIVGSLIFLLGYEL+ EAL DTWGKLN FEY+T+ II+ 
Sbjct: 593  LALGTFVVMIIGPVIISFIPICIVGSLIFLLGYELIKEALFDTWGKLNRFEYITIVIIVF 652

Query: 653  TMGIFDFVLGIIVGILIACFKFLIDSTHLQTVNGEFSGEVAKSTVYRDPIQTTFLDGVGE 712
            TMG+FDFVLGIIVGILIACF FL+DST LQT+NGEF+G+VA+STVYRD IQT FL+ VGE
Sbjct: 653  TMGVFDFVLGIIVGILIACFSFLVDSTKLQTINGEFNGQVARSTVYRDYIQTKFLNKVGE 712

Query: 713  QIYVLKLQNLLFFGTIISIEEKIDKLLEISNNDSSKRRIKYLILDFKNINTDNIDYSAAE 772
            QI+VLKLQNLLFFGTIISIEEKID LLEIS+ DSS++RIKYLILDFKNIN DNIDYSAAE
Sbjct: 713  QIHVLKLQNLLFFGTIISIEEKIDGLLEISDKDSSRQRIKYLILDFKNINADNIDYSAAE 772

Query: 773  GFNRIRRFTQTKGIQLIISSIREKDGIYRAFNNVGLLEDVELFQDLNSSLEWCENELLHW 832
            GFNRI+RFT+TK IQLIISSI EKD IY AFN VGLL+DVELF DLNS+LEWCENE L  
Sbjct: 773  GFNRIKRFTETKRIQLIISSITEKDRIYNAFNKVGLLQDVELFADLNSALEWCENEFLLQ 832

Query: 833  YNELRTKAKARLRKLNNTANSVVSRLPVSASKQMDSRAITSADQSGRAAISNLMSLPTNT 892
            Y ++RT+ KA+L+                A K+ +     S              LP NT
Sbjct: 833  YKQIRTRTKAKLQ----------------AQKKQEKHLSKSL-------------LPINT 863

Query: 893  PRNHQMLTVAQDVFKNDEQTVSSLRXXXXXXXXXXXXXXXXXXXYRPDIGSNDKLARDKE 952
            PRN+Q++TVAQ +F  DEQ V+ LR                   +RP I S DK  +  E
Sbjct: 864  PRNNQIVTVAQKIFP-DEQNVTHLRTQYQKREPVLPLLLVALKKFRPQIMSYDKDVKQAE 922

Query: 953  IAIWSRLCPYFAKKTMMAQTTLQHCNKIFFLVQTGVLKAVFKLPQGCVYETMANRTCYGK 1012
               WS+LCPYF +K     + L H N +FFLV++G+LK  + L QG  YETM+++TCYG+
Sbjct: 923  EDFWSKLCPYFVRKRFAPGSLLLHNNNLFFLVESGMLKITYDLHQGQFYETMSSKTCYGR 982

Query: 1013 IIDSGTTVDDADTSNPDFSK---LFITTETDSELWVIDAAAMGRLEREDPELFIQLALLV 1069
            I           + N +F+    + I TETD  +W+IDA  +  L+ ++  L+ +L L+V
Sbjct: 983  I-----------SGNAEFTTNLYVNIKTETDCAVWIIDATNLANLKEKNLALYAELLLVV 1031

Query: 1070 MLIKDKRFKDLLGHALISA 1088
            M I   R K+LLG++L+S+
Sbjct: 1032 MSINQYRSKELLGYSLVSS 1050

>Kpol_480.18 s480 complement(36794..39967) [3174 bp, 1057 aa] {ON}
            complement(36794..39967) [3174 nt, 1058 aa]
          Length = 1057

 Score = 1010 bits (2612), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 572/1106 (51%), Positives = 704/1106 (63%), Gaps = 91/1106 (8%)

Query: 11   RPARQSISESISVSLGLQNND---ARQSDNENP-----------LQVLPGESSYLGRSYV 56
            R  R S SE++SVSLGL        R   N  P             V   E   +GRSY 
Sbjct: 15   RRVRPSFSEALSVSLGLHEQGIGAGRTRSNLAPNSYSGYNDNTTSSVSNREFGRIGRSYA 74

Query: 57   SGLWS--PTQRNNKSGYD-LLPTSNEQAYSKPIHKSQMLHRQTQAIGENFSDSNGDEGSE 113
              + S  P+   N S  D LLP    +  SK I     LHRQT  I  +F+D++ DE   
Sbjct: 75   GSISSNSPSLYLNTSRTDELLPI--RKMPSKSILGPDALHRQTAEISNDFNDTSMDEAK- 131

Query: 114  NKDLNEYIDLVEHNERKTANIDNVDQIGGLATGPQTTVPGNK-THPVTSPLSDEYGIPDE 172
               +  YI+L+    RK    +   +   +   P T + G     P+ S  S   G+   
Sbjct: 132  ---IKRYIELLN---RKQIEAEEEGEESAVHLRPHTFIEGKSFLSPIGSSASQLDGL--- 182

Query: 173  NSRLLLTPXXXXXXXXXXXXXXTPE---DYNGRARSPLNGINSTYGSQIPTLSSYSSAGM 229
              R LLTP                E   DYN   R           S+  T SS+++ G+
Sbjct: 183  EQRALLTPSSSIVGNEFDLESTYDEINNDYNSILR---------IQSRELTSSSFATKGL 233

Query: 230  KIGPPITSKWDYISALSHDIVHYXXXXXXXXXXXXXXXXXYGMIIFPITEPIFSQLGPSG 289
                              ++++Y                 YGMIIFPITEP+FS LGP+G
Sbjct: 234  ------------------ELLNYLPAAILGLLLNILDALSYGMIIFPITEPLFSGLGPTG 275

Query: 290  LSMFYISTVISQFTYSSGWSSFPCGIGSEMIEVTPFFHTMALTIMKTLGEERKNEIITTT 349
            +SMFYIST++ Q   S G+SSFPCGIGSEMIE+TPF+HTMA  I   L   + NE+ITTT
Sbjct: 276  ISMFYISTIVCQLVLSGGFSSFPCGIGSEMIEITPFYHTMAFAIKDAL-PNQDNEVITTT 334

Query: 350  IFCYVISSMXXXXXXXXXXXXXXXXXVGFFPRHILIGCIGGVGYFLLITGIEVCTRIAKF 409
            IFCYVISS+                 VGFFPRHILIGCIGGVGYFL+ITGIEV TRI KF
Sbjct: 335  IFCYVISSVVTGLVFFMLGKLKMGKIVGFFPRHILIGCIGGVGYFLIITGIEVSTRIGKF 394

Query: 410  EYSIPFLLNLFTDEKTLFQWLLPTMLTIILIFTQNRFRNSLVLPSFYILTLILFHFIVAI 469
            EY+  FLL+L T+  TL +WLLPT+LT+ LI  Q + +NSLVLPSFYILT+ILFHFIVAI
Sbjct: 395  EYNWEFLLSLLTNLDTLGKWLLPTLLTLSLILIQRQVQNSLVLPSFYILTIILFHFIVAI 454

Query: 470  VPNLSLTKLRNSGWIFPVAASNVTWYDHYKYFNFSDVHWALVIKQIPTMMALTFFGILHV 529
            +PNLSL  LR +GWIFPV  S  +WYDHYKYFN  D+HW LV+KQIPTM+ALTFFGILHV
Sbjct: 455  LPNLSLDHLRENGWIFPVTDSKNSWYDHYKYFNLHDIHWGLVLKQIPTMLALTFFGILHV 514

Query: 530  PINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALA 589
            PINVPALAMSL MDKYDVDRELIAHGYSN  SGL GS++NYLVYTNSVLFIRAGADS+ A
Sbjct: 515  PINVPALAMSLHMDKYDVDRELIAHGYSNLISGLLGSVQNYLVYTNSVLFIRAGADSSSA 574

Query: 590  GYXXXXXXXXXXXXGPVIISFIPICIVGSLIFLLGYELLMEALVDTWGKLNTFEYVTVGI 649
            G+            G VI+SFIP+CIVGSLIFLLGYEL++EALVDT G + +FEY+T+ I
Sbjct: 575  GFLLVALTVVVMVAGSVIVSFIPVCIVGSLIFLLGYELMVEALVDTIGTVTSFEYITILI 634

Query: 650  IILTMGIFDFVLGIIVGILIACFKFLIDSTHLQTVNGEFSGEVAKSTVYRDPIQTTFLDG 709
            I+  MGI+DFVLGIIVGILIAC  F++D T L+T+NGE+ G+VAKSTVYRD IQT FL+G
Sbjct: 635  IVFIMGIYDFVLGIIVGILIACLSFMVDGTKLETINGEYDGQVAKSTVYRDYIQTKFLNG 694

Query: 710  VGEQIYVLKLQNLLFFGTIISIEEKIDKLLEISNNDSSKRRIKYLILDFKNINTDNIDYS 769
            + +QIY+LKLQN+LFFGTIISIEEKIDKLLEIS+ D SKRRIKYLILDFKNIN DNIDYS
Sbjct: 695  IRQQIYLLKLQNVLFFGTIISIEEKIDKLLEISDKDPSKRRIKYLILDFKNINADNIDYS 754

Query: 770  AAEGFNRIRRFTQTKGIQLIISSIREKDGIYRAFNNVGLLEDVELFQDLNSSLEWCENEL 829
            AAEGFNRI+RFTQ K IQLIISSI+EKD IY  FN V LLEDVELF DLNS+LEWCENE 
Sbjct: 755  AAEGFNRIKRFTQGKRIQLIISSIKEKDKIYSVFNMVRLLEDVELFDDLNSALEWCENEF 814

Query: 830  LHWYNELRTKAKARLRKLNNTANSVVSRLPVSA-------SKQMDSRAITSADQSGRAAI 882
            L+ Y +L  KAK R+ K          R+ +S        S+      +++ADQ      
Sbjct: 815  LYQYMQLHEKAKDRIHK----------RISISKDSGSTYFSRNRSDSGLSAADQ------ 858

Query: 883  SNLMSLPTNTPRNHQMLTVAQDVFKNDEQTVSSLRXXXXXXXXXXXXXXXXXXXYRPDIG 942
              LMSLP NTPRN+Q+L+VA+ VFKN+ QT S  +                   +RPD+ 
Sbjct: 859  QMLMSLPINTPRNNQVLSVARKVFKNEAQTASKFKTHNETDKPVLSLLLYSIRLFRPDVF 918

Query: 943  SNDKLARDKEIAIWSRLCPYFAKKTMMAQTTLQHCNKIFFLVQTGVLKAVFKLPQGCVYE 1002
            S D   R+KEI  W +L PYF +      +TL + +  FF+V++GV++    LPQG V E
Sbjct: 919  SEDVSIREKEINFWGQLSPYFRRSLFPTGSTLVNSSNFFFVVESGVVRVTHDLPQGIVSE 978

Query: 1003 TMANRTCYGKIIDSGTTVDDADTSNPDFSKLFITTETDSELWVIDAAAMGRLEREDPELF 1062
            TM+NRTCYGK++    TV        +  K+   TET+S +W+ID   M R+++E+  L+
Sbjct: 979  TMSNRTCYGKVVGHRGTV-------TNLPKIIFKTETESIIWMIDDDTMSRIKKENLNLY 1031

Query: 1063 IQLALLVMLIKDKRFKDLLGHALISA 1088
             +L LLVM I++ R+K L+G+ L+SA
Sbjct: 1032 TELLLLVMTIREYRYKGLIGYTLVSA 1057

>TBLA0C04440 Chr3 (1075482..1078934) [3453 bp, 1150 aa] {ON} Anc_3.485
            YGR125W
          Length = 1150

 Score =  999 bits (2584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/919 (56%), Positives = 644/919 (70%), Gaps = 31/919 (3%)

Query: 171  DENSRLLLTPXXXXXXXXXXXXXXTPEDYNGRARSPLNGINSTYGSQIPTLSSYSSAGMK 230
            DE SRLL TP              +  +Y+       N I+S+    IPT +  + +   
Sbjct: 262  DEYSRLLPTPSPSIYDDENALFFSSSNNYDSTDLENNNYISSS----IPTTTDVTQSTS- 316

Query: 231  IGPPITSKWDYISALSHDIVHYXXXXXXXXXXXXXXXXXYGMIIFPITEPIFSQLGPSGL 290
                  S  D ++  S  I+H                  YGMI+FPIT+ +F  LGP+GL
Sbjct: 317  -----LSFKDMLTKHSLQILHDIPACILGLLLNILDALSYGMILFPITDSVFGHLGPTGL 371

Query: 291  SMFYISTVISQFTYSSGWSSFPCGIGSEMIEVTPFFHTMALTIMKTLGEERKNEIITTTI 350
            SMFYIST+ISQ  YS G+S+FP G+G EMIE+ PFFHTMALT+  ++  + +NEIITTTI
Sbjct: 372  SMFYISTIISQLVYSGGFSAFPSGLGGEMIEIVPFFHTMALTVKNSIPSKDQNEIITTTI 431

Query: 351  FCYVISSMXXXXXXXXXXXXXXXXXVGFFPRHILIGCIGGVGYFLLITGIEVCTRIAKFE 410
            FCYVIS +                 VGFFPRHILIGCIGGVGYFL++TGIEV TR+ K E
Sbjct: 432  FCYVISCIFTGIVFFCLGKFKLGKLVGFFPRHILIGCIGGVGYFLIVTGIEVTTRVKKLE 491

Query: 411  YSIPFLLNLFTDEKTLFQWLLPTMLTIILIFTQNRFRNSLVLPSFYILTLILFHFIVAIV 470
            YS+ FLL++ T+  TLF+ +LP  L+++L   Q  + +SL+LPSFYI+T I FHFIVA+V
Sbjct: 492  YSLEFLLSVITNMSTLFKLVLPISLSVLLNILQKIYSHSLLLPSFYIITFIAFHFIVALV 551

Query: 471  PNLSLTKLRNSGWIFPVAASNVTWYDHYKYFNFSDVHWALVIKQIPTMMALTFFGILHVP 530
            PNLSL  LR +GWIFPVA S+ TWY HYKYFNF + HW LV KQIPTM ALTFFGILHVP
Sbjct: 552  PNLSLDSLRATGWIFPVAESSDTWYSHYKYFNFFNCHWDLVFKQIPTMFALTFFGILHVP 611

Query: 531  INVPALAMSLQMDKYDVDRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAG 590
            INVPALAMS+QMDKYDVD+ELIAHGYSN  SGLFGS++NYLVYTNSVLFIRAG ++A AG
Sbjct: 612  INVPALAMSVQMDKYDVDKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAGGNTASAG 671

Query: 591  YXXXXXXXXXXXXGPVIISFIPICIVGSLIFLLGYELLMEALVDTWGKLNTFEYVTVGII 650
                         GPVIISFIP+CIVGSLIFLLG+EL++EAL+DTWGK+  FEY+T+ II
Sbjct: 672  LVLAGFTAIILFIGPVIISFIPVCIVGSLIFLLGWELIVEALLDTWGKVTKFEYITIMII 731

Query: 651  ILTMGIFDFVLGIIVGILIACFKFLIDSTHLQTVNGEFSGEVAKSTVYRDPIQTTFLDGV 710
            + TMGI+DFVLGI+VGILIACF FL+DST LQTVNGEF+G VAKSTVYRD +Q+ FL G+
Sbjct: 732  VFTMGIYDFVLGILVGILIACFSFLVDSTKLQTVNGEFNGTVAKSTVYRDYVQSQFLSGI 791

Query: 711  GEQIYVLKLQNLLFFGTIISIEEKIDKLLEISNNDSSKRRIKYLILDFKNINTDNIDYSA 770
             EQIYVLKLQN+LFFGTIISIEEKID LLEIS+NDSSKRRIKYLILD KN+N+DNIDYSA
Sbjct: 792  AEQIYVLKLQNVLFFGTIISIEEKIDMLLEISDNDSSKRRIKYLILDLKNVNSDNIDYSA 851

Query: 771  AEGFNRIRRFTQTKGIQLIISSIREKDGIYRAFNNVGLLEDVELFQDLNSSLEWCENELL 830
            AEGFNRI+RFTQ+K IQLIISSI++ D IY+ FNNV LLE+VELF DLN +LEWCENE L
Sbjct: 852  AEGFNRIKRFTQSKRIQLIISSIKDTDKIYKMFNNVNLLENVELFSDLNGALEWCENEFL 911

Query: 831  HWYNELRTKAKARLRKLNNTANSV-VSRLPVSASKQMDSRAITSADQSGRAAISNLMSLP 889
            + Y +++ KA+AR ++   + + V    L  S S  ++ R       SG        +LP
Sbjct: 912  YQYRQVKNKARARAKRKATSRDVVRTGYLSTSVSNTLNDRK-----SSG--------NLP 958

Query: 890  TNTPRNHQMLTVAQDVFKNDEQTVSSLRXXXXXXXXXXXXXXXXXXXYRPDIGSNDKLAR 949
             NTPRNHQM++VA+++F+N EQ V S                     YR DI S+D   R
Sbjct: 959  INTPRNHQMVSVAKNIFQNIEQPVRSFSTNLNKSIPVLELLVFALKQYRSDIFSDDNKVR 1018

Query: 950  DKEIAIWSRLCPYFAKKTMMAQTTLQHCNKIFFLVQTGVLKAVFKLPQGCVYETMANRTC 1009
            DKE+  WS+LCPYF K+ +  +T+L H N +FF+V++GVLK  F LPQG VYETM+NRTC
Sbjct: 1019 DKEVEFWSQLCPYFTKQPLANKTSLLHNNNVFFIVESGVLKMEFNLPQGSVYETMSNRTC 1078

Query: 1010 YGKIIDSGTTVDDADTSNPDFSKLFITTETDSELWVIDAAAMGRLEREDPELFIQLALLV 1069
            YG+I+  G             S L I  ETD  +W+I++  + +++ E+ EL+ +L LLV
Sbjct: 1079 YGRILGKGYLKKST-------SPLNIKAETDCIIWLINSEGLDKMKAENLELYTELTLLV 1131

Query: 1070 MLIKDKRFKDLLGHALISA 1088
            M +KD RF +LLG+ALISA
Sbjct: 1132 MSVKDDRFNNLLGYALISA 1150

>ZYRO0C07986g Chr3 complement(609503..612577) [3075 bp, 1024 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1024

 Score =  999 bits (2582), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 510/852 (59%), Positives = 620/852 (72%), Gaps = 19/852 (2%)

Query: 242  ISALSHDIVHYXXXXXXXXXXXXXXXXXYGMIIFPITEPIFSQLGPSGLSMFYISTVISQ 301
            I     D++HY                 YGMIIFPITEPIFS LG +GLSMFYIST+ISQ
Sbjct: 187  IVQFGQDVLHYFPSAVLGLLLNILDGLSYGMIIFPITEPIFSHLGSTGLSMFYISTIISQ 246

Query: 302  FTYSSGWSSFPCGIGSEMIEVTPFFHTMALTIMKTLGEERKNEIITTTIFCYVISSMXXX 361
              YS G SSF  GIGSEMIEVTPFFHTMA  I   +   + ++IITTTIFCY ISS+   
Sbjct: 247  CLYSGGLSSFTSGIGSEMIEVTPFFHTMAFAIRDAI-PGQDDDIITTTIFCYAISSVVTG 305

Query: 362  XXXXXXXXXXXXXXVGFFPRHILIGCIGGVGYFLLITGIEVCTRIAKFEYSIPFLLNLFT 421
                          VGFFPRHILIGCIGGVGYFLLITG+ V TR+AK EY+  FL  LF 
Sbjct: 306  ITFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLLITGLGVTTRLAKIEYTWEFLKKLFL 365

Query: 422  DEKTLFQWLLPTMLTIILIFTQNRFRNSLVLPSFYILTLILFHFIVAIVPNLSLTKLRNS 481
            D   L++WLLP +LTI+L+ TQ  F+NSLVLPSFYI+TLILFHF+VAIVP++SL +LR+ 
Sbjct: 366  DTDILWKWLLPVVLTILLVNTQKCFQNSLVLPSFYIVTLILFHFVVAIVPSISLDQLRDL 425

Query: 482  GWIFPVAASNVTWYDHYKYFNFSDVHWALVIKQIPTMMALTFFGILHVPINVPALAMSLQ 541
            GWIFP A S   W+DHYK F++  VHW LV+ QIPTM+ALTFFGILHVPINVPALA+SL 
Sbjct: 426  GWIFPAATSKDRWFDHYKLFDWHKVHWNLVLAQIPTMLALTFFGILHVPINVPALAISLH 485

Query: 542  MDKYDVDRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGYXXXXXXXXXX 601
            MDK+DVD+ELIAHGYSNF SG+ GSI+NYLVYTNSVLFIRAGADS  AGY          
Sbjct: 486  MDKFDVDKELIAHGYSNFISGMVGSIQNYLVYTNSVLFIRAGADSPFAGYMLAILTFAVM 545

Query: 602  XXGPVIISFIPICIVGSLIFLLGYELLMEALVDTWGKLNTFEYVTVGIIILTMGIFDFVL 661
              GPVI+SFIPICIVGSLIFLLGYELL+EAL+DT GK+  FEY+T+ II+LTMGI+DFVL
Sbjct: 546  VIGPVIVSFIPICIVGSLIFLLGYELLVEALLDTRGKVTNFEYITIVIIVLTMGIYDFVL 605

Query: 662  GIIVGILIACFKFLIDSTHLQTVNGEFSGEVAKSTVYRDPIQTTFLDGVGEQIYVLKLQN 721
            G+IVGILIACF FL+DST LQT+NGEF G+VA+STV RD +Q+ FL+GVGEQIYVLKLQN
Sbjct: 606  GVIVGILIACFSFLVDSTKLQTINGEFDGKVARSTVNRDYVQSNFLNGVGEQIYVLKLQN 665

Query: 722  LLFFGTIISIEEKIDKLLEISNN-DSSKRRIKYLILDFKNINTDNIDYSAAEGFNRIRRF 780
            +LFFGTIISIEEKIDKLLEI+++  SSKRRIKYLILDFKNIN DNIDYSAAEGFNRI+RF
Sbjct: 666  VLFFGTIISIEEKIDKLLEITDSKSSSKRRIKYLILDFKNINADNIDYSAAEGFNRIKRF 725

Query: 781  TQTKGIQLIISSIREKDGIYRAFNNVGLLEDVELFQDLNSSLEWCENELLHWYNELRTKA 840
            TQTK I+LIISSI+E+D IY  F+NVGLL+DVELF DLN +LEWCENE L  Y +LR +A
Sbjct: 726  TQTKRIKLIISSIKERDHIYNVFSNVGLLDDVELFNDLNGALEWCENEFLGEYKKLRDRA 785

Query: 841  KARLRKLNNTANSVVSRLPVSASKQM--DSRAITSADQSGRAAISNLMSLPTNTPRNHQM 898
            + +++   N    V S +  +A+K++  D+  I+  + S      NL SLP NTPRNHQM
Sbjct: 786  REKMQHSYN----VTSAIEAAAAKKVPTDNNQISKKNLS-LLNFRNLSSLPMNTPRNHQM 840

Query: 899  LTVAQDVFKNDEQTVSSLRXXXXXXXXXXX--XXXXXXXXYRPDIGSNDKLARDKEIAIW 956
            L+VAQ++F NDE+ V +L                      YR +I S D   R++E  +W
Sbjct: 841  LSVAQNMF-NDEEDVDALEDESCNDGQQPVLPLLLFALKSYRKNITSTDPHLRERETQLW 899

Query: 957  SRLCPYFAKKTMMAQTTLQHCNKIFFLVQTGVLKAVFKLPQGCVYETMANRTCYGKIIDS 1016
            S+L PYF K+ +  Q+ L H    FF+V++G+LK    LPQG VYETM+NRTC G I+ S
Sbjct: 900  SQLVPYFVKRRLTTQSILLHNQDFFFVVESGLLKIALDLPQGVVYETMSNRTCCGNIVGS 959

Query: 1017 GTTVDDADTSNPDFSKLFITTETDSELWVIDAAAMGRLEREDPELFIQLALLVMLIKDKR 1076
                   D  + +  K+ I TETD+ LW+ID   + +L  E+ +L+ +L LL +LIK +R
Sbjct: 960  -------DYKSSEEHKVTIVTETDTCLWLIDVDGLQKLRAENLQLYTELVLLCLLIKSRR 1012

Query: 1077 FKDLLGHALISA 1088
            F+ LLG+ L+SA
Sbjct: 1013 FEQLLGYTLVSA 1024

 Score = 58.2 bits (139), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 71/140 (50%), Gaps = 37/140 (26%)

Query: 9   IKRPAR--QSISESISVSLGLQNNDARQSDNE-------------------NPLQVLP-- 45
           + RP+R  QSIS +ISVSLGL     R SD E                   + ++++   
Sbjct: 5   VDRPSRNRQSISGAISVSLGLNRQVHRNSDGEFTNYNNTNNNGGRINQNDSSSIEIVSPP 64

Query: 46  --GESSYLGRSYVSGLW---SPT----QRNNKSGYDLLPTSNEQAYSKPIHKSQMLHRQT 96
               ++Y GRSY+ G +   SP     QRN+ S   +LP   +++ SK IH SQ++HRQT
Sbjct: 65  FYNSNNYAGRSYLGGGFLSASPKMNLQQRNDDSS--VLPI--DRSRSKSIHGSQIIHRQT 120

Query: 97  QAIGENFS-DSNGDEGSENK 115
             +  NFS D+ G E   N+
Sbjct: 121 AELSNNFSDDTTGMEEVRNR 140

>TPHA0D04210 Chr4 (908861..912010) [3150 bp, 1049 aa] {ON} Anc_3.485
            YGR125W
          Length = 1049

 Score =  993 bits (2566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 542/1104 (49%), Positives = 695/1104 (62%), Gaps = 78/1104 (7%)

Query: 6    AHRIKRPARQSISESISVSLGLQNN-DARQSDNEN----------PLQ-----VLPGESS 49
            + + +R    S SE++SVSLGLQ   + R ++  N          PL+      LP   S
Sbjct: 3    SRKKERRVSSSFSEALSVSLGLQEQGNLRSTERANVKRNAIFDEFPLESTNSLTLPDSMS 62

Query: 50   YLGRSY-VSGLWSPTQRNNKSGYD--LLPTSNEQAYSKPIHKSQMLHRQTQAIGENFSDS 106
                +  ++    P    N++ Y+  + P  N+ +  K I  + +LHRQT  + + F DS
Sbjct: 63   MKNNTVNINDKLVPDNSKNRTFYNDSIYPPENKTSM-KSITVADILHRQTAELSKTFYDS 121

Query: 107  NGDEGSENKDLNEYIDLVEHNERKTANIDNVDQIGGLATGPQTTVPGNKTHPVTSPLSDE 166
            N  +    KD+ +YID+++ N+  T+N  + +       G +            SP    
Sbjct: 122  NFTD----KDVKDYIDIID-NDVATSNESDSNSTPEPYLGDEYDQHRLAIRTQKSP---- 172

Query: 167  YGIPDENSRLLLTPXXXXXXXXXXXXXXTPEDYNGRARSPLNGINSTYGSQIPTLSSYSS 226
              I D+    LLTP                E      R   + IN    S++   S    
Sbjct: 173  -NIADDEQSRLLTPSSSIIGAELDLEAHYDE--FEPVRMDASSINRQNESKLIDFSQ--- 226

Query: 227  AGMKIGPPITSKWDYISALSHDIVHYXXXXXXXXXXXXXXXXXYGMIIFPITEPIFSQLG 286
                                  I+HY                 YGMIIFPITEPIF+ +G
Sbjct: 227  ----------------------ILHYFPAAVLGLLLNILDALSYGMIIFPITEPIFANMG 264

Query: 287  PSGLSMFYISTVISQFTYSSGWSSFPCGIGSEMIEVTPFFHTMALTIMKTLGEERKNEII 346
             +G+SMFYIS++I Q+  S G+SSFP GIGSEMIE+TPF+HTMAL I  +L  + + EII
Sbjct: 265  TAGISMFYISSIICQYILSGGFSSFPTGIGSEMIEITPFYHTMALAIKNSL--DVQEEII 322

Query: 347  TTTIFCYVISSMXXXXXXXXXXXXXXXXXVGFFPRHILIGCIGGVGYFLLITGIEVCTRI 406
            +TTIFCYVISS+                 V FFPRHILIGCIGGVGYFL++TG+EV TR+
Sbjct: 323  STTIFCYVISSLVTGLVFYSLGKLKLGKIVAFFPRHILIGCIGGVGYFLVVTGLEVTTRV 382

Query: 407  AKFEYSIPFLLNLFTDEKTLFQWLLPTMLTIILIFTQNRFRNSLVLPSFYILTLILFHFI 466
            AK EYS  FL  L +D   + +WL P +LT ILIFTQ+ F+NSLVLPSFYI+T+ILFHFI
Sbjct: 383  AKVEYSWEFLSYLLSDFNIIGKWLTPILLTTILIFTQHHFQNSLVLPSFYIITIILFHFI 442

Query: 467  VAIVPNLSLTKLRNSGWIFPVAASNVTWYDHYKYFNFSDVHWALVIKQIPTMMALTFFGI 526
            VA+VP LSL KLR+SGWIFP+  SN  W+DHYKYFN  +V W L++KQ+PTM+ALTFFGI
Sbjct: 443  VALVPMLSLNKLRDSGWIFPLTNSNDKWFDHYKYFNVYNVSWVLILKQMPTMLALTFFGI 502

Query: 527  LHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADS 586
            LHVPINVPALAMSL +DK+DVDRE IAHGYSNF SGLFGS++NYLVYTNSVLFIRAGADS
Sbjct: 503  LHVPINVPALAMSLNIDKFDVDREFIAHGYSNFLSGLFGSVQNYLVYTNSVLFIRAGADS 562

Query: 587  ALAGYXXXXXXXXXXXXGPVIISFIPICIVGSLIFLLGYELLMEALVDTWGKLNTFEYVT 646
             +AGY            GPVIISFIPICIVGSLIFLLGYELL+EAL+DT GK+  FEY T
Sbjct: 563  PIAGYLLIVLTAIVMLIGPVIISFIPICIVGSLIFLLGYELLIEALLDTVGKVTFFEYTT 622

Query: 647  VGIIILTMGIFDFVLGIIVGILIACFKFLIDSTHLQTVNGEFSGEVAKSTVYRDPIQTTF 706
            + II+ TMGI+DFVLGIIVGIL+AC KF++D T LQT+N E+ G +AKSTVYRD IQ+ F
Sbjct: 623  IIIIVFTMGIYDFVLGIIVGILLACIKFMVDGTKLQTINTEYDGTIAKSTVYRDFIQSKF 682

Query: 707  LDGVGEQIYVLKLQNLLFFGTIISIEEKIDKLLEISNNDSSKRRIKYLILDFKNINTDNI 766
            LDG+GEQIY++KLQN+LFFGTIISIEEKID LL++S++DSSK RI+YLILDFKNIN DNI
Sbjct: 683  LDGIGEQIYLIKLQNVLFFGTIISIEEKIDTLLQLSDSDSSKHRIRYLILDFKNINDDNI 742

Query: 767  DYSAAEGFNRIRRFTQTKGIQLIISSIREKDGIYRAFNNVGLLEDVELFQDLNSSLEWCE 826
            DYSAAEGFNRI+RFT  + I+LIISSI   D IY+AFN +GLL+D+ELF DLN+ LEWCE
Sbjct: 743  DYSAAEGFNRIKRFTHGRHIKLIISSITHTDKIYKAFNKIGLLQDIELFSDLNNGLEWCE 802

Query: 827  NELLHWYNELRTKAKARLRKLNNTANSVVSRLPVSASKQMDSRAI--TSADQSGRAAISN 884
            N+ L  Y EL  KAK RL           SR+ +   K + SR I  TS+D +   +   
Sbjct: 803  NKYLEKYRELHEKAKKRLH----------SRMSILQDKNISSRQINSTSSDGNEYQSSQR 852

Query: 885  LMSLPTNTPRNHQMLTVAQDVFKNDEQTVSSLRXXXXXXXXXXXXXXXXXXXYRPDIGSN 944
            LMSLP NTPRNHQ+L+VA++VFKN+ Q VS  +                   +RPD+ S 
Sbjct: 853  LMSLPLNTPRNHQLLSVARNVFKNETQAVSRFKNLDNGEDAFTQLLLQSIRRFRPDVFSE 912

Query: 945  DKLARDKEIAIWSRLCPYFAKKTMMAQTTLQHCNKIFFLVQTGVLKAVFKLPQGCVYETM 1004
             K  R +EI  W++L PYF K  +   +T  + N  FFL+ +GV+K    L  G + ETM
Sbjct: 913  SKDIRAQEIKFWTQLAPYFNKIFVETNSTFLNENNFFFLLDSGVIKVTHDLAPGKLSETM 972

Query: 1005 ANRTCYGKIIDSGTTVDDADTSNPDFSKLFITTETDSELWVIDAAAMGRLEREDPELFIQ 1064
             +RT YG        +   +       K+    ET S +W+ID+  + ++E+E+ +L+ +
Sbjct: 973  LSRTSYG-------ILSSKNNRTYKTHKVTFIPETKSVIWLIDSEGLKKMEKENLKLYSE 1025

Query: 1065 LALLVMLIKDKRFKDLLGHALISA 1088
            L LL+M I D RFK LLG+ L++A
Sbjct: 1026 LTLLIMSISDYRFKALLGYTLVNA 1049

>Kwal_55.21201 s55 (727206..730241) [3036 bp, 1011 aa] {ON} YGR125W -
            Hypothetical ORF [contig 295] FULL
          Length = 1011

 Score =  945 bits (2442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/1090 (48%), Positives = 676/1090 (62%), Gaps = 95/1090 (8%)

Query: 11   RPA-RQSISESISVSLGLQNNDARQSD-----NENPLQVLPGESS---YLGRSYVSGLWS 61
            RP  + SISE+ISVSLGLQ+      D       NP     G+ S   YLGRSYV+ L  
Sbjct: 5    RPKNKPSISEAISVSLGLQSQSNSDQDSSYIPRANPFS-HTGDGSPHYYLGRSYVANLSP 63

Query: 62   PTQRNNKSGY-DLLPTSNEQAYSKPIHKSQMLHRQTQAIGENFSDSNGDEGSENKDLNEY 120
            P       G    LP S     S+ IH+S  L RQT A+                  NE+
Sbjct: 64   PPLARLPGGLPGELPLSYRPEQSQSIHQSVSLRRQTAALS-----------------NEF 106

Query: 121  IDLVEHNERKTANIDNVDQIGGLATGPQTTVPGNKTHPVTSPLSDEYGIPDENSRLLLTP 180
             D  E  E + A +   D  G   T  + ++ G    PV+S       I +E S  LL P
Sbjct: 107  EDTFEF-EDQLAGVSEDD--GHSTTAEEPSMNGTLISPVSSVPDTPIDI-NEPSNALLPP 162

Query: 181  XXXXXXXXXXXXXXTPEDYNGRARSPLNGINSTYGSQIPTLSSYSSAG--MKIGPPITSK 238
                               N         I+  Y  Q  +L S  S      IGP  + +
Sbjct: 163  -------------------NAEHDLEYGSIDG-YEHQYVSLQSRRSGANTHNIGPDASLR 202

Query: 239  WDYISALSHDIVHYXXXXXXXXXXXXXXXXXYGMIIFPITEPIFSQLGPSGLSMFYISTV 298
             + +   +  +V+Y                 YGMIIFPITEP+FS LGP+G+SMFY+S++
Sbjct: 203  -EKMMFTARRMVNYMPAVILGLLLNILDALSYGMIIFPITEPLFSHLGPTGMSMFYVSSI 261

Query: 299  ISQFTYSSGWSSFPCGIGSEMIEVTPFFHTMALTIMKTLGEERKNEIITTTIFCYVISSM 358
            ISQ  YS G+S+F   +GSEMIE+TPF+H MA +I+  L  E K+ +++TTI CY +SS+
Sbjct: 262  ISQLIYSGGFSAFGNAVGSEMIEITPFYHAMAASIVAGLPGE-KDRVLSTTIVCYALSSI 320

Query: 359  XXXXXXXXXXXXXXXXXVGFFPRHILIGCIGGVGYFLLITGIEVCTRIAKFEYSIPFLLN 418
                             VGFFPRHILIGCIGGVGYFLLITG+EV TR+AKFEYS  FL +
Sbjct: 321  ITGLVFFLLGRLRLGKIVGFFPRHILIGCIGGVGYFLLITGLEVTTRVAKFEYSFEFLSS 380

Query: 419  LFTDEKTLFQWLLPTMLTIILIFTQNRFRNSLVLPSFYILTLILFHFIVAIVPNLSLTKL 478
            LFT+ + L +W LP ++ ++L+  Q+ F NSLVLP+FYI  L+LFHFIVA++P+LSL  L
Sbjct: 381  LFTNIEVLGKWGLPALMAVLLVVVQHAFGNSLVLPAFYIAALLLFHFIVALIPSLSLDIL 440

Query: 479  RNSGWIFPVAASNVTWYDHYKYFNFSDVHWALVIKQIPTMMALTFFGILHVPINVPALAM 538
            R+SGWIFP   S   W+D Y  +NF  V W +++KQIPTM+ALTFFGILHVPINVPALAM
Sbjct: 441  RDSGWIFPATDSTEHWFDFYTLYNFKLVSWPMILKQIPTMLALTFFGILHVPINVPALAM 500

Query: 539  SLQMDKYDVDRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGYXXXXXXX 598
            S+ +DK DVD+ELIAHGYSNF SG+ GS++NYLVYTNSVLFIRAG D ALAG        
Sbjct: 501  SIGLDKLDVDKELIAHGYSNFLSGIMGSVQNYLVYTNSVLFIRAGGDDALAGLMLAAATF 560

Query: 599  XXXXXGPVIISFIPICIVGSLIFLLGYELLMEALVDTWGKLNTFEYVTVGIIILTMGIFD 658
                 GPVI+++IP+CIVGSLIFLLGYELL EAL DTWGKLN FEY TV  I+ TMG FD
Sbjct: 561  GIMIVGPVIVAYIPVCIVGSLIFLLGYELLKEALYDTWGKLNNFEYATVVAIVFTMGAFD 620

Query: 659  FVLGIIVGILIACFKFLIDSTHLQTVNGEFSGEVAKSTVYRDPIQTTFLDGVGEQIYVLK 718
            FVLGIIVGILIACF FL+DST LQTVNGEF G+VA+STV RD IQT FL+ +GEQI+VLK
Sbjct: 621  FVLGIIVGILIACFSFLVDSTKLQTVNGEFDGQVARSTVSRDYIQTQFLNKIGEQIHVLK 680

Query: 719  LQNLLFFGTIISIEEKIDKLLEISNNDSSKRRIKYLILDFKNINTDNIDYSAAEGFNRIR 778
            LQNLLFFGTI+SIEEKIDKLLE+S+ DSSK+RIKYLILDFKNIN DNIDYSAAEGFNRI+
Sbjct: 681  LQNLLFFGTILSIEEKIDKLLELSDKDSSKKRIKYLILDFKNINADNIDYSAAEGFNRIK 740

Query: 779  RFTQTKGIQLIISSIREKDGIYRAFNNVGLLEDVELFQDLNSSLEWCENELLHWYNELRT 838
            RFT +K I LIISSI+  D IYRAFN VG+LE VELF DLNS+LEWCENE L  + +LR 
Sbjct: 741  RFTSSKRIHLIISSIKTSDRIYRAFNKVGMLEGVELFDDLNSALEWCENEFLIQFKDLRN 800

Query: 839  KAKARLRKLNNTANSVVSRLPVSASKQMDSRAITSADQSGRAAISNLMSLPTNTPRNHQM 898
            K K +                  A K+ D R              + + LP NTPRN+Q 
Sbjct: 801  KTKLK------------------AGKKQDRRM-------------SKVPLPFNTPRNNQF 829

Query: 899  LTVAQDVFKNDEQTVSSLRXXXXXXXXXXXXXXXXXXXYRPDIGSNDKLARDKEIAIWSR 958
            ++VAQ +F  DEQ+++ L+                   +RP I S+DK  ++ E  +WS 
Sbjct: 830  VSVAQKLF-TDEQSMTHLKSSYRERPPVLPLLLSALQRFRPQIMSSDKSVKEGEERLWSD 888

Query: 959  LCPYFAKKTMMAQTTLQHCNKIFFLVQTGVLKAVFKLPQGCVYETMANRTCYGKIIDSGT 1018
            LC YF KK + A + L H + IFF+++TG++K  + L QG +YETM+ +TCYG++     
Sbjct: 889  LCKYFYKKRLAAHSLLLHKDNIFFVIETGMVKVTYNLRQGQLYETMSGKTCYGRMSIPNN 948

Query: 1019 TVDDADTSNPDFSKLFITTETDSELWVIDAAAMGRLEREDPELFIQLALLVMLIKDKRFK 1078
              +             +  ETD  LW+ID A + +L+RE+  L+ ++ L+ + I   R K
Sbjct: 949  NNNPISCVE-------VEMETDCSLWIIDDAGLAKLKRENLNLYTEVLLVTLCINQDRLK 1001

Query: 1079 DLLGHALISA 1088
            +LLGH L+S+
Sbjct: 1002 ELLGHCLVSS 1011

>KLTH0F14674g Chr6 (1201874..1204906) [3033 bp, 1010 aa] {ON} similar
            to uniprot|P53273 Saccharomyces cerevisiae YGR125W
            Hypothetical ORF
          Length = 1010

 Score =  945 bits (2442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/1102 (47%), Positives = 683/1102 (61%), Gaps = 106/1102 (9%)

Query: 1    MGMSKAHRIKRPARQSISESISVSLGLQNNDARQSD-----NENPLQVLPGESS--YLGR 53
            MG S+        + S+SE+ISVSLGLQ+    ++D       NP       S   YLGR
Sbjct: 1    MGFSRPRN-----KHSLSEAISVSLGLQSQPGSETDTLSVPRGNPFSNGADGSPHYYLGR 55

Query: 54   SYVSGLWSPTQRNNKSGYDLLPTSNEQA-YSKPIHKSQMLHRQTQAIGENFSDSNGDEGS 112
            SYV+ L SP     K  +   PTS+ +   S+ IH+S  L RQT A+   F D   +   
Sbjct: 56   SYVANL-SPPPLAIKERFSGDPTSSSRPEQSQSIHQSLSLRRQTAALSNEF-DGTFEFED 113

Query: 113  ENKDLNEYIDLVEHNERKTANIDNVDQIGGLATGPQTTVPGNKT-----HPVTSPLSDEY 167
            + +DL E  +    +E   A       I   ++GP+ +V  N        P  +    EY
Sbjct: 114  QLEDLAENGNTAVPDESVMAG----SAISPTSSGPEPSVLDNTDVSNLLLPPNTQRDLEY 169

Query: 168  GIPDENSRLLLTPXXXXXXXXXXXXXXTPEDYNGRARSPLNGINSTYGSQIPTLSSYSSA 227
            G  DE     ++                    + RA S    I+     +  TL ++   
Sbjct: 170  GSIDEFDHQYVSLQ------------------SQRAGSNSRAIDPNASMRDKTLFTFRRL 211

Query: 228  GMKIGPPITSKWDYISALSHDIVHYXXXXXXXXXXXXXXXXXYGMIIFPITEPIFSQLGP 287
            G           +Y+ A+   ++                   YGMIIFPITEP+FS LGP
Sbjct: 212  G-----------NYVPAVILGLL-----------LNILDALSYGMIIFPITEPLFSHLGP 249

Query: 288  SGLSMFYISTVISQFTYSSGWSSFPCGIGSEMIEVTPFFHTMALTIMKTLGEERKNEIIT 347
            SGLSMFY+S+V+SQ  YS G+S+F   +GSEMIE+TPF+H+MA +IM ++  E K+ ++T
Sbjct: 250  SGLSMFYMSSVVSQLVYSCGFSAFGNAVGSEMIEITPFYHSMAASIMASMPGE-KDRVLT 308

Query: 348  TTIFCYVISSMXXXXXXXXXXXXXXXXXVGFFPRHILIGCIGGVGYFLLITGIEVCTRIA 407
            TTI CY +SS+                 VGFFPRHILIGCIGGVGYFL+ITG EV TR +
Sbjct: 309  TTIVCYAMSSIMTGLVFFLLGRLKLGKIVGFFPRHILIGCIGGVGYFLVITGFEVTTRAS 368

Query: 408  KFEYSIPFLLNLFTDEKTLFQWLLPTMLTIILIFTQNRFRNSLVLPSFYILTLILFHFIV 467
            KFEYS  FL +L TD + L +W LP ++ ++L+  Q   +NSLVLP+FYI  L+LFHFIV
Sbjct: 369  KFEYSFEFLSSLLTDPEILGKWGLPALMAVLLVVIQRACKNSLVLPTFYIAALLLFHFIV 428

Query: 468  AIVPNLSLTKLRNSGWIFPVAASNVTWYDHYKYFNFSDVHWALVIKQIPTMMALTFFGIL 527
            A++P+LSL  LR+SGW+FP   +   W+D YK +NF  V W LV+KQ+PTM+ALTFFGIL
Sbjct: 429  ALIPSLSLHSLRDSGWVFPATTTTEHWFDFYKLYNFKLVSWPLVLKQVPTMLALTFFGIL 488

Query: 528  HVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSA 587
            HVPINVPALAMS+ +DK DVD+ELIAHGYSNF SG+ GS++NYLVYTNS+LFI+AGAD +
Sbjct: 489  HVPINVPALAMSIGLDKLDVDKELIAHGYSNFLSGMIGSVQNYLVYTNSLLFIKAGADDS 548

Query: 588  LAGYXXXXXXXXXXXXGPVIISFIPICIVGSLIFLLGYELLMEALVDTWGKLNTFEYVTV 647
            LAG             GPVI+++IP+CIVGSLIFLLGYELL EALVDTWGKLN FEY TV
Sbjct: 549  LAGLMLAAATFGIMVIGPVIVAYIPVCIVGSLIFLLGYELLKEALVDTWGKLNNFEYATV 608

Query: 648  GIIILTMGIFDFVLGIIVGILIACFKFLIDSTHLQTVNGEFSGEVAKSTVYRDPIQTTFL 707
              I+ TMG FDFVLGIIVGILIACF FL+DST LQT+NGEF G+VA+STV RD IQT FL
Sbjct: 609  VAIVFTMGAFDFVLGIIVGILIACFSFLVDSTKLQTINGEFDGQVARSTVRRDYIQTQFL 668

Query: 708  DGVGEQIYVLKLQNLLFFGTIISIEEKIDKLLEISNNDSSKRRIKYLILDFKNINTDNID 767
            + +GEQI+VLKLQNLLFFGTIISIEEKIDKLLE+S+ D+SK+RIKYLILDFKNIN DNID
Sbjct: 669  NKIGEQIHVLKLQNLLFFGTIISIEEKIDKLLELSDKDASKKRIKYLILDFKNINADNID 728

Query: 768  YSAAEGFNRIRRFTQTKGIQLIISSIREKDGIYRAFNNVGLLEDVELFQDLNSSLEWCEN 827
            YSAAEGFNRI+RFT +K I LIISSI+  D IYRAFN VG L+ VELF DLNS+LEWCEN
Sbjct: 729  YSAAEGFNRIKRFTFSKRIHLIISSIKTTDRIYRAFNKVGTLDGVELFDDLNSALEWCEN 788

Query: 828  ELLHWYNELRTKAKAR-LRKLNNTANSVVSRLPVSASKQMDSRAITSADQSGRAAISNLM 886
            E L  + +LR K K + +RK                 +Q+   A                
Sbjct: 789  EFLRQFRDLRNKTKLKAVRK---------------QERQLSKGA---------------- 817

Query: 887  SLPTNTPRNHQMLTVAQDVFKNDEQTVSSLRXXXXXXXXXXXXXXXXXXXYRPDIGSNDK 946
             LP NTPRN+  ++VAQ +F  DEQ++  L+                   YRP+I S +K
Sbjct: 818  -LPFNTPRNNHFVSVAQKLF-TDEQSMPHLKTHYKEKTPVLHLLLSALQRYRPEIMSPEK 875

Query: 947  LARDKEIAIWSRLCPYFAKKTMMAQTTLQHCNKIFFLVQTGVLKAVFKLPQGCVYETMAN 1006
              ++ E  +WS L  +F K+ + AQ+ L H N IF +V++G++K  + L QG +YE ++ 
Sbjct: 876  PVKETEEKMWSELGKFFFKRRLAAQSLLPHKNNIFLVVESGMVKVTYNLRQGQLYEILSG 935

Query: 1007 RTCYGKIIDSGTTVDDADTSNPDFSKLFITTETDSELWVIDAAAMGRLEREDPELFIQLA 1066
            +TCYG+I          ++S    S + I  ETD  LW++D A + +L++E+  L+ +L 
Sbjct: 936  KTCYGRIT-------APNSSEVPISSVEIKMETDCALWILDEANLAKLKKENLALYTELL 988

Query: 1067 LLVMLIKDKRFKDLLGHALISA 1088
            L+ + +   R K+LLGH L+S+
Sbjct: 989  LVTLCMNQDRLKELLGHCLVSS 1010

>KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1060

 Score =  917 bits (2371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/1101 (46%), Positives = 660/1101 (59%), Gaps = 125/1101 (11%)

Query: 44   LPGESSYLGRSYVSGLWSPTQRNNKSGYDLL--------------PTSNEQAYSKPIHKS 89
            +P  S+YLGRSYV    SP      +                   P S+E   SK IH+S
Sbjct: 27   MPTTSTYLGRSYVGSFISPPMEYRSNSNTTSNNNNNSNVGDPFKSPFSSEG--SKLIHES 84

Query: 90   QMLHRQTQAIGENF-SDSNGDEGS-------------ENKDLNEYID---LVEHNERKTA 132
              LH+QT  +   F +D+  DEG+             E  D++  ++   ++++++R+  
Sbjct: 85   GNLHKQTAFLSNTFDNDAGNDEGAGFPLDGNDDEFNLEQNDIDMIVEEDQMLQNSQRRRG 144

Query: 133  N----------------------IDNVDQIGGLATGPQTTVPGNKTHPVTSPLSDEYGIP 170
                                   +   D +G  +T    + PG          S    + 
Sbjct: 145  RMSVDAAADIEADAHLMDLEDMALKRADDVGIFST----SFPGKDD-------SSFLDVS 193

Query: 171  DENSRLLLTPXXXXXXXXXXXXXXTPEDYNGRARSPLNGINSTYGSQIPTLSS---YSSA 227
            D    L L P                E          N   + Y S +P  +S   ++S 
Sbjct: 194  DSTENLALLPTNSHNSMYVEYGTFDEE----------NQPATQYISLLPDGASSGGFTSQ 243

Query: 228  GMKIGPPITSKWDYISALSHDIVHYXXXXXXXXXXXXXXXXXYGMIIFPITEPIFSQLGP 287
            G +      S +D    L   I  Y                 YGMIIFPITEP+FS LGP
Sbjct: 244  GFRSS---MSHYDKARDLMLRIFQYTPAVGLGLLLNILDALSYGMIIFPITEPLFSHLGP 300

Query: 288  SGLSMFYISTVISQFTYSSGWSSFPCGIGSEMIEVTPFFHTMALTIMKTLGEERKNEIIT 347
            +GLSMFY+STVI Q  +S G SSFP  IGSEMIE+TPFFHTMAL+IM ++ E   N++I+
Sbjct: 301  TGLSMFYVSTVICQLCFSLGLSSFPSAIGSEMIEITPFFHTMALSIMNSIPEGNDNKVIS 360

Query: 348  TTIFCYVISSMXXXXXXXXXXXXXXXXXVGFFPRHILIGCIGGVGYFLLITGIEVCTRIA 407
            TTI CY +SS+                 VGFFPRHILIGCIGGVGYFL+ITG+EVCTR+ 
Sbjct: 361  TTIVCYALSSIITGLTFFLLGKMRLGKIVGFFPRHILIGCIGGVGYFLIITGLEVCTRVP 420

Query: 408  KFEYSIPFLLNLFTDEKTLFQWLLPTMLTIILIFTQNRFRNSLVLPSFYILTLILFHFIV 467
            +F+YS  FL +LFTD   L +WL P +LT+ILI  Q+R  NSLVLPSFYI+TL+LFHF+V
Sbjct: 421  EFKYSWQFLSSLFTDFDILLKWLTPVILTLILISVQSRIHNSLVLPSFYIITLLLFHFVV 480

Query: 468  AIVPNLSLTKLRNSGWIFPVAASNVTWYDHYKYFNFSDVHWALVIKQIPTMMALTFFGIL 527
            A+VP+LSL KLR+ GWIF    +   WYD YK ++F +V W+L+ KQ+PTM+ALTFFGIL
Sbjct: 481  ALVPSLSLDKLRDFGWIFAKVNAKENWYDFYKLYDFKNVQWSLIPKQVPTMLALTFFGIL 540

Query: 528  HVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSA 587
            HVPINVPALAMSL +DKYDVD+ELIAHGYSN  SG  GSI+NYLVYTNSVLFIRAGADS 
Sbjct: 541  HVPINVPALAMSLNVDKYDVDKELIAHGYSNLISGFLGSIQNYLVYTNSVLFIRAGADSP 600

Query: 588  LAGYXXXXXXXXXXXXGPVIISFIPICIVGSLIFLLGYELLMEALVDTWGKLNTFEYVTV 647
            +AG             GPVIISFIPICIVGSLIFLLGYEL+ EA++DTWGKL  FEY+T+
Sbjct: 601  IAGIMLTIGTFIVMVIGPVIISFIPICIVGSLIFLLGYELIQEAVIDTWGKLQPFEYLTI 660

Query: 648  GIIILTMGIFDFVLGIIVGILIACFKFLIDSTHLQTVNGEFSGEVAKSTVYRDPIQTTFL 707
             II++TMG+ DFV+GIIVGIL+ACF FL++ST LQT+NGE+ G+VAKSTVYRD IQ+ FL
Sbjct: 661  WIIVITMGVVDFVIGIIVGILLACFSFLVNSTQLQTINGEYDGKVAKSTVYRDYIQSKFL 720

Query: 708  DGVGEQIYVLKLQNLLFFGTIISIEEKIDKLLEISNNDSSKRRIKYLILDFKNINTDNID 767
              +GEQIYVLKLQN+LFFGTIISIEEK++ LLEI  +DSSK+RIKYLILDFKNI   +ID
Sbjct: 721  RNIGEQIYVLKLQNILFFGTIISIEEKVNSLLEICESDSSKKRIKYLILDFKNIRAKSID 780

Query: 768  YSAAEGFNRIRRFTQTKGIQLIISSIREKDGIYRAFNNVGLLEDVELFQDLNSSLEWCEN 827
            YSAAEGFNRI+RF + + I LIISSI ++D IY AF+ V L E+VELF DLN +LEWCEN
Sbjct: 781  YSAAEGFNRIKRFLEKERIHLIISSIDKEDQIYLAFDKVRLFENVELFSDLNGALEWCEN 840

Query: 828  ELLHWYNELRTKAKAR-LRKLNNTANSVVSRLPVSASKQMDSRAITSADQSGRAAISNLM 886
            E L  Y  +RTK +AR L +L  + N + S+LPV                          
Sbjct: 841  EFLMRYKRIRTKTRARKLAQLKKSQNRM-SKLPV-------------------------- 873

Query: 887  SLPTNTPRNHQMLTVAQDVFKNDEQTVSSLRXXXXXXXXXXXXXXXXXXXYRPDIGSNDK 946
                NTPRNHQ ++  ++++  +E  +  L                    +R  I S ++
Sbjct: 874  ----NTPRNHQFVSEVRNIY-TEEMEIQKLSNELKERQQFLPIFLMSIRKFRNAIQSPNE 928

Query: 947  LARDKEIAIWSRLCPYFAKKTMMAQTTLQHCNKIFFLVQTGVLKAVFKLPQGCVYETMAN 1006
            L R  E+ +W RL  YF +K     T ++H N +F +V++GVL     L QG  YETM+ 
Sbjct: 929  LKRTNELDLWKRLISYFQQKKFPPNTEIRHRNNMFIVVESGVLNLTHHLIQGEFYETMSP 988

Query: 1007 RTCYGKIIDSGTTVDDADTSNPDFSKLFITTETDSELWVIDAAAMGRLEREDPELFIQLA 1066
            +T YG I             N D   + ITT+T+  L  IDA ++  L+  DPELF +L 
Sbjct: 989  KTAYGVI----------SNVNSDPLAVSITTDTECVLRYIDAESLADLKLTDPELFTELL 1038

Query: 1067 LLVMLIKDKRFKDLLGHALIS 1087
            +LVM I   RF++LLG++LIS
Sbjct: 1039 ILVMAIHRDRFRELLGYSLIS 1059

>AFR304W Chr6 (991645..994692) [3048 bp, 1015 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YGR125W
          Length = 1015

 Score =  843 bits (2178), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/820 (52%), Positives = 550/820 (67%), Gaps = 47/820 (5%)

Query: 270  YGMIIFPITEPIFSQLGPSGLSMFYISTVISQFTYSSGWSSFPCGIGSEMIEVTPFFHTM 329
            YGMIIFPI EPIFS LGP GLSMFY+ST+ISQ  YS G+SSF  G GSEMIEVTPFFHTM
Sbjct: 242  YGMIIFPIAEPIFSHLGPHGLSMFYVSTIISQLVYSGGFSSFGYGTGSEMIEVTPFFHTM 301

Query: 330  ALTIMKTLGEERKNEIITTTIFCYVISSMXXXXXXXXXXXXXXXXXVGFFPRHILIGCIG 389
            AL+I  +L  E+ ++IITTTI CY +S++                 V FFP HILIGCIG
Sbjct: 302  ALSIKNSLSAEKSDDIITTTIVCYALSTIITGAVFLTLGKLRLGKLVSFFPLHILIGCIG 361

Query: 390  GVGYFLLITGIEVCTRIAKFEYSIPFLLNLFTDEKTLFQWLLPTMLTIILIFTQNRFRNS 449
            GV YFL+ITGIEV TR+ KFEYS+ FL NLF D   L +WL+P +L + +I  Q R  NS
Sbjct: 362  GVAYFLIITGIEVSTRVTKFEYSLAFLRNLFMDPDILAKWLIPALLAVSIILLQRRIHNS 421

Query: 450  LVLPSFYILTLILFHFIVAIVPNLSLTKLRNSGWIFPVAASNVTWYDHYKYFNFSDVHWA 509
            ++LP FY+    LFHFIVA++P+LSL  LR+ GWIFP+  S   WYD+ + +N   +HW 
Sbjct: 422  MLLPLFYLSAFALFHFIVALIPSLSLDTLRDKGWIFPLTESGGRWYDYLELYNPQRIHWE 481

Query: 510  LVIKQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLFGSIEN 569
            LV+ +IPTM+ALTFFGILHVPINVPALA+S  +DK DVD+ELIAHGYSN FSG  GSI+N
Sbjct: 482  LVLGEIPTMLALTFFGILHVPINVPALAISCGIDKIDVDKELIAHGYSNIFSGCAGSIQN 541

Query: 570  YLVYTNSVLFIRAGADSALAGYXXXXXXXXXXXXGPVIISFIPICIVGSLIFLLGYELLM 629
            YLVYTNSVLFIRAGADS  AG+            GP IIS IP+CIV SLIFLLGYELL 
Sbjct: 542  YLVYTNSVLFIRAGADSRYAGFLLAIATFMTMTAGPWIISIIPVCIVSSLIFLLGYELLK 601

Query: 630  EALVDTWGKLNTFEYVTVGIIILTMGIFDFVLGIIVGILIACFKFLIDSTHLQTVNGEFS 689
            E L D++ +L+ FEY+TV IIILTMGIFDFVLGIIVG+L+ACF FL++ST  +T++ EF 
Sbjct: 602  EVLYDSYNRLSNFEYITVVIIILTMGIFDFVLGIIVGVLVACFSFLVESTRAKTISSEFD 661

Query: 690  GEVAKSTVYRDPIQTTFLDGVGEQIYVLKLQNLLFFGTIISIEEKIDKLLEISNNDSSKR 749
            G+VAKS  +RD +Q+ FL+ V EQIYVLKLQN LFFGTIISIEEKI  LLE  N    K+
Sbjct: 662  GKVAKSACHRDYLQSNFLEKVAEQIYVLKLQNNLFFGTIISIEEKIGNLLE-PNGSEYKK 720

Query: 750  RIKYLILDFKNINTDNIDYSAAEGFNRIRRFTQTKGIQLIISSIREKDGIYRAFNNVGLL 809
             IKYLILDFK+IN DNIDYSAAEGFNRI+R  + K I+LI+SSI E D IY  F+ +GLL
Sbjct: 721  IIKYLILDFKHINIDNIDYSAAEGFNRIKRVMEIKRIKLIVSSISECDKIYTIFSKIGLL 780

Query: 810  EDVELFQDLNSSLEWCENELLHWYNELRTKA-KARLRKLNNTANSVVSRLPVSASKQMDS 868
            +DVELFQDLNS+LEWCENELL  Y  L ++A + ++R+                SK +  
Sbjct: 781  QDVELFQDLNSALEWCENELLCEYRSLLSRAHRVKVRR---------------RSKDIVP 825

Query: 869  RAITSADQSGRAAISNLMSLPTNTPRNHQMLTVAQDVFKNDEQTVSSLRXXXXXXXXXXX 928
            +A    +               NTPRN Q++T AQ V+  ++Q   +L            
Sbjct: 826  KAQIPLE---------------NTPRNAQIMTAAQAVYSGEQQLNKTL-SKYKASHPALA 869

Query: 929  XXXXXXXXYRPDIGSNDKLARDKEIAIWSRLCPYFAKKTMMAQTTLQHCNKIFFLVQTGV 988
                    YR    S       KEI +W  LCPYF +K+   QT++     +FF+V++G+
Sbjct: 870  LLLVALKTYR----SGHAYKETKEIRLWKHLCPYFVRKSFSPQTSISDEGDMFFVVESGL 925

Query: 989  LKAVFKLPQGCVYETMANRTCYGKIIDSGTTVDDADTSNPDFSKLFITTETDSELWVIDA 1048
            LK  + LPQG + E +A++TCYG I   G+           +S + + TET+  LW+IDA
Sbjct: 926  LKITYMLPQGSLQEAIASKTCYGNISGPGSL---------SYSSV-VRTETECVLWMIDA 975

Query: 1049 AAMGRLEREDPELFIQLALLVMLIKDKRFKDLLGHALISA 1088
              + +L+ E+  L+ +L ++ + +   RFK+LLGH+LI+ 
Sbjct: 976  PGLQKLQEENLPLYTELLVVYISVIQHRFKELLGHSLING 1015

 Score = 38.5 bits (88), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 53/111 (47%), Gaps = 11/111 (9%)

Query: 14  RQSISESISVSLGLQNNDARQSDNENPLQ----VLPGESSYLGRSYVSGLWSP----TQR 65
           R SISE++++ L + ++ +  ++   P+      L    +YLGRSYV    +     ++ 
Sbjct: 13  RPSISEALNIQLNIPDSPSGGANAGGPVSERIPTLMRPEAYLGRSYVGSFSNSGSLMSRE 72

Query: 66  NNKSGYDL--LPTSNEQAYSKPIHKSQMLHRQTQAIGENFSDSNGDEGSEN 114
              +G D   LP   +QA S  +H    LHRQT A+ ++    +G    E 
Sbjct: 73  AGAAGPDSPPLPRFRDQA-SSYVHNGSHLHRQTAALCDDSRAYDGGPEEEE 122

>SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {ON}
           similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 744

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 80/354 (22%), Positives = 147/354 (41%), Gaps = 49/354 (13%)

Query: 548 DRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGYXXXXXXXXXXXXGPVI 607
           +REL+A G  N    LFG++ ++  Y  S +   +GA + ++G                 
Sbjct: 400 NRELVALGSLNLIGSLFGALPSFGGYGRSKINAYSGAQTVVSGACMGTITMFTIKFLLKF 459

Query: 608 ISFIPICIVGSLIFLLGYELLMEALVDTWGKLNTFEY---VTVGIIILTMGIFDFVLGII 664
           I +IP+C++  +  ++G  LL EA  D    +    Y   ++  I +LT   +    GI 
Sbjct: 460 IRYIPVCVLSVITTVVGLSLLEEAPADLRFHIRCRGYNELISFIITVLTTFFYSVEAGIT 519

Query: 665 VGILIACFKFLIDSTHLQT------------VNG-EFSGEVAKSTVYRDPIQTTFLDGVG 711
           VG   +  + +  ST  +             VN  E+ G+ + S    +P Q   ++G  
Sbjct: 520 VGCGYSIIRVIKHSTKSRIQILGKLAGTNKFVNADEYEGKNSTSERRVNP-QLEEIEGC- 577

Query: 712 EQIYVLKLQNLLFFGTIISIEEKIDKLLEISNNDS--------SKRRIKYLILDFKNINT 763
               ++++   L F     ++ ++++L    +  +         +   KY+I D   + T
Sbjct: 578 ---LIVRIPEPLTFTNTDDLKTRLNRLELYGSTKTHPAAPRSRDQEMTKYVIFDLHGMTT 634

Query: 764 DNIDYSAAEGFNRIRRFTQTKGIQLIISSIREKDGIYRAFNNVGLLEDVELFQDLNSSL- 822
             ID SA +    I    + + + + +  +     +   F N G+LE VE   D++ SL 
Sbjct: 635 --IDSSAIQILQEIISSYKRRHVHVFLVRVPSARKVRNRFVNSGILEMVE--SDIHRSLL 690

Query: 823 -------------EWCENELLHWYNELRTKAKARLRKLNNTANSVVSRLPVSAS 863
                        E  E E L   +EL  +A + L  L +  NS++SR  V++S
Sbjct: 691 PSAQQMLTSSPYFETIE-EALRIVDELELRAASHLDTL-SVCNSIISRTFVNSS 742

>Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {ON}
           YPR003C (REAL)
          Length = 744

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 61/289 (21%), Positives = 123/289 (42%), Gaps = 24/289 (8%)

Query: 548 DRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGYXXXXXXXXXXXXGPVI 607
           +REL+A G+ N    LFG++ ++  Y  S +   +GA S ++G                 
Sbjct: 398 NRELVALGFMNIVISLFGALPSFGGYGRSKINALSGAQSVISGVFVGVITLITMNLLLQF 457

Query: 608 ISFIPICIVGSLIFLLGYELLMEALVDTWGKLNTFEYVTVGIIILTMGIFDFVLGIIVGI 667
           + +IP C++  +  ++G  LL E   D    L    Y  + +  +T G+  F   I  GI
Sbjct: 458 VHYIPNCVLSVITTVIGISLLEEVPSDIKFHLRCGGYSELFVFAVTFGVTIF-YSIEAGI 516

Query: 668 LIAC-FKFLIDSTHLQTVNGEFSGEVAKSTVY-----------RDPIQTTFLDGVGEQIY 715
            I C +  L    H      +    VA ++ +           R+P+     + + E   
Sbjct: 517 CIGCVYSILNIIKHSAKSRIQILARVAGTSNFTNLDDYLMNMKRNPLSIENTEEI-EGCM 575

Query: 716 VLKLQNLLFFGTIISIEEKIDKLLEISNND--------SSKRRIKYLILDFKNINTDNID 767
           ++++   L F     +++++D++    ++          SK  IKY+I D   + +  +D
Sbjct: 576 IVRIPEPLTFTNSEDLKQRLDRIERFGSSKIHPGRKSFRSKDSIKYVIFDLGGMTS--LD 633

Query: 768 YSAAEGFNRIRRFTQTKGIQLIISSIREKDGIYRAFNNVGLLEDVELFQ 816
            SAA+  + I    + + + + ++++   D I    +  G++ +VE  Q
Sbjct: 634 SSAAQVLDEIITSYKRRNVFIYLANVSINDKIRTRLSKAGVIPNVERAQ 682

>Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {ON}
           YPR003C (REAL)
          Length = 742

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 65/289 (22%), Positives = 125/289 (43%), Gaps = 23/289 (7%)

Query: 548 DRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGYXXXXXXXXXXXXGPVI 607
           +REL+A G  N F  LFG++ ++  Y  S +   +GA S ++G                 
Sbjct: 398 NRELVALGCINMFISLFGALPSFGGYGRSKINALSGAQSVMSGVFVGIITLITMKLLLQF 457

Query: 608 ISFIPICIVGSLIFLLGYELLMEALVDTWGKLNTFEYVTVGIIILTMGIFDFVLGIIVGI 667
           + +IP C++  +  ++G  LL E   D    L    Y  + +  +T G+  F   I  GI
Sbjct: 458 VHYIPNCVLSVITTVIGISLLEEVPGDIKFHLQCGGYSELFVFAVTFGVTIF-YSIESGI 516

Query: 668 LIAC-FKFLIDSTHLQTVNGEFSGEVAKSTVYR---DPIQTT-----FLDGVGEQI---Y 715
            I C +  L    H      +    +A ++ +    D ++TT      ++G  E+I    
Sbjct: 517 CIGCVYSILNIIKHSAKSRIQILARIAGTSNFTNLDDYLRTTKKNPPAVEGRIEEIEGCM 576

Query: 716 VLKLQNLLFFGTIISIEEKIDKLLEISNND--------SSKRRIKYLILDFKNINTDNID 767
           ++++   L F     +++++D++    ++          SK  IKY+I D   + +  ID
Sbjct: 577 IVRIPEPLTFTNSEDLKQRLDRIERFGSSKIHPGRKSFRSKDSIKYVIFDLGGMTS--ID 634

Query: 768 YSAAEGFNRIRRFTQTKGIQLIISSIREKDGIYRAFNNVGLLEDVELFQ 816
            SAA+  + I    + + + + ++++   D I       G+  +VE  Q
Sbjct: 635 SSAAQVLDEIISCYKRRNVFIYLANVSINDKIRTRLLKAGVTPNVERVQ 683

>Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {ON}
           YPR003C (REAL)
          Length = 745

 Score = 52.8 bits (125), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 60/286 (20%), Positives = 122/286 (42%), Gaps = 23/286 (8%)

Query: 548 DRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGYXXXXXXXXXXXXGPVI 607
           +REL+A G+ N    LFG++ ++  Y  S +   +GA S ++G                 
Sbjct: 398 NRELVALGFMNIVISLFGALPSFGGYGRSKINALSGAQSVMSGVFVGIITLITMNLLLQF 457

Query: 608 ISFIPICIVGSLIFLLGYELLMEALVDTWGKLNTFEYVTVGIIILTMGIFDFVLGIIVGI 667
           + +IP C++  +  ++G  LL E   D    L    Y  + +  +T G+   +  I  GI
Sbjct: 458 VHYIPNCVLSVITTVIGISLLEEVPGDIKFHLRCGGYSELFVFAVTFGV-TILCSIEAGI 516

Query: 668 LIAC-FKFLIDSTHLQTVNGEFSGEVAKSTVYR---DPIQTTFLDGVG--------EQIY 715
            I C +  L    H      +    VA ++ +    D ++T   + +G        E   
Sbjct: 517 CIGCVYSILNIIKHSAKSRIQILARVAGTSNFTNLDDYLRTMKKNPLGGENRLEEVEGCM 576

Query: 716 VLKLQNLLFFGTIISIEEKIDKLLEISNND--------SSKRRIKYLILDFKNINTDNID 767
           ++++   L F     +++++D++    ++          SK  IKY+I D   + +  ID
Sbjct: 577 IVRIPEPLTFTNSEDLKQRLDRIERFGSSKIHPGRKSFRSKDSIKYVIFDLGGMTS--ID 634

Query: 768 YSAAEGFNRIRRFTQTKGIQLIISSIREKDGIYRAFNNVGLLEDVE 813
            SAA+  + I    + + + + ++++   D I       G++ ++E
Sbjct: 635 SSAAQVLDEIITSYKRRNVFIYVANVSINDKIRTRLLKAGVIPNLE 680

>AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPR003C
          Length = 689

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 66/291 (22%), Positives = 122/291 (41%), Gaps = 37/291 (12%)

Query: 545 YDVD----RELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGYXXXXXXXXX 600
           +D+D    REL++ G  N    +F S+  +  Y  S L I  GA + +AG          
Sbjct: 343 FDIDVSSNRELVSLGLINIVGSVFSSLPAFGGYGRSKLNIFCGAQTPMAGIFVSLSAIFC 402

Query: 601 XXXGPVIISFIPICIVGSLIFLLGYELLMEALVDT---WGKLNTFEYVTVGIIILTMGIF 657
                 +  ++P+CI+  +I  + Y LL E   D    W      E +T   ++L+  I+
Sbjct: 403 MRFLMGVFHYLPLCILAVIISFIAYNLLEEVPGDMFFYWSVSGYQELITFSAVVLSTLIW 462

Query: 658 DFVLGIIVGILIACFKFLIDSTHLQT-VNGEFSGEVAKSTVYRDPIQTTFLDGVGEQIYV 716
               G+++G+ +   + L  +T  +  + G+         +Y +  +   L+ + E+  V
Sbjct: 463 SPQFGLVMGLGLTMIRLLKHTTQSRIQILGKDPITKKFRNIYSEHNEEIPLEEI-EKTMV 521

Query: 717 LKLQNLLFFGTIISIEEKIDKL-----LEISNNDSSKRR-------------IKYLILDF 758
           +K+   L F  +  + +K+ +L     L +  +  +  R             +KY+I+D 
Sbjct: 522 IKVPEPLVFWNVPDLMKKVKRLEKYGSLYVHPSYPTSLRPVSGVTTLKDNVYVKYIIMDL 581

Query: 759 KNINTDNIDYSAAEGFNRIRRFTQTKGIQLII--SSIR------EKDGIYR 801
             +    ID SA +    +      +GI +I   SSIR      +K GI R
Sbjct: 582 --LGMTYIDMSALQALVDMVVNYHKRGIYVIFCRSSIRDLKNKFDKSGITR 630

>ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 735

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 57/124 (45%), Gaps = 1/124 (0%)

Query: 548 DRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGYXXXXXXXXXXXXGPVI 607
           +REL+A G  N FS + GS+  +  Y  S +   +GA + ++G                +
Sbjct: 393 NRELVALGSMNLFSSILGSLPAFGGYGRSKINAFSGAQTVMSGAFMGLLVLLTIKFLLPM 452

Query: 608 ISFIPICIVGSLIFLLGYELLMEALVDTWGKLNTFEYVTVGIIILTMGIFDFVLGIIVGI 667
           I +IPIC++  +  ++G  LL EA  D       F Y  + +  LT+ +      + VGI
Sbjct: 453 IHYIPICVLSVVTTMVGISLLEEAPADLMFHFRCFGYDELLVFTLTV-LTTMFYSVEVGI 511

Query: 668 LIAC 671
            I C
Sbjct: 512 CIGC 515

>SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} similar
           to uniprot|Q74ZI9 Ashbya gossypii AGR213C AGR213Cp and
           weakly similar to YPR003C uniprot|P53394 Saccharomyces
           cerevisiae YPR003C Hypothetical ORF
          Length = 620

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/262 (21%), Positives = 101/262 (38%), Gaps = 46/262 (17%)

Query: 548 DRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGYXXXXXXXXXXXXGPVI 607
           +REL++ G  N  S +F ++  +  Y  S + I  GA +  +G                 
Sbjct: 272 NRELVSLGVVNLVSSIFSALPAFGGYGRSKMNISCGAQTQFSGVFVSLLAIICMNFLMNA 331

Query: 608 ISFIPICIVGSLIFLLGYELLMEALVDT---WGKLNTFEYVTVGIIILTMGIFDFVLGII 664
              +PICI+  +I  + + LL EA  D    W      E     II++T  ++    G+ 
Sbjct: 332 FHHLPICILAVIISTVAFSLLEEAPADLMFYWSVGGYQELFIFIIIVVTTLVWSPQFGVT 391

Query: 665 VGILIACFKFLIDSTHLQTVNGEFSGEVAKSTVYRDPIQTTF------------LDGVGE 712
           +G+ +   + L  ST  +              + RDPI  TF            L+ + E
Sbjct: 392 MGMCLTMIRLLKHSTRSRV-----------QILGRDPITYTFKNIDDDENSDIPLEEI-E 439

Query: 713 QIYVLKLQNLLFFGTIISIEEKIDKLLE-----------------ISNNDSSKRRIKYLI 755
           ++ V+K+   L F  +  +   + ++ +                 +S   S +  +KYL+
Sbjct: 440 KVMVVKIPEPLIFSNVSDLRTSLKRMEKYGSLKVHPSYPLPLRQMLSPTTSGQVSLKYLV 499

Query: 756 LDFKNINTDNIDYSAAEGFNRI 777
           +D   +    ID SA +    I
Sbjct: 500 IDLFGMT--YIDISALQALREI 519

>TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {ON}
           Anc_8.99 YPR003C
          Length = 727

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 58/285 (20%), Positives = 114/285 (40%), Gaps = 23/285 (8%)

Query: 548 DRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGYXXXXXXXXXXXXGPVI 607
           +REL+A G  N  + + G++  +  Y  S +   +GA + ++G                 
Sbjct: 385 NRELVALGSMNLCASVLGALPAFGGYGRSKINSFSGAQTVMSGVCMGVIVLLTVKFFLSQ 444

Query: 608 ISFIPICIVGSLIFLLGYELLMEALVDTWGKLNTFEY---VTVGIIILTMGIFDFVLGII 664
           I +IP+CI+  +  ++G  LL EA  D     N+  Y   +   + +LT   +   +G+ 
Sbjct: 445 IRYIPVCILSVITTIVGISLLEEAPADLRFHFNSRGYDELLVFAVTVLTTFFYSLEMGVC 504

Query: 665 VGI---LIACFKFLIDSTHLQTVNGEFSGEVAKSTVYRDPIQTTFLDGVG-----EQIYV 716
           +G    +I+  K    S        E +G+   S  Y      T  D +      E   V
Sbjct: 505 IGCGYSVISIIKHSAKSRIQILARVESTGQFINSDEYLS--SATHPDDLPNIEELEGCLV 562

Query: 717 LKLQNLLFFGTIISIEEKIDKLLEI--------SNNDSSKRRIKYLILDFKNINTDNIDY 768
           +K+   L F  +  ++E++ +L           +     +  IKYL+ D   +    +D 
Sbjct: 563 VKIPEPLTFTNMEDLKERLTRLERFGSAIVHPGAKGSRERESIKYLVFDLNGMTF--MDS 620

Query: 769 SAAEGFNRIRRFTQTKGIQLIISSIREKDGIYRAFNNVGLLEDVE 813
           SAA+    I +    + +++ ++ +   + +        +L  VE
Sbjct: 621 SAAQIMLEIVKSYNRRRVKVFLARVPLDEQVRSRLETSNILNYVE 665

>Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AGR213C
          Length = 689

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 54/271 (19%), Positives = 103/271 (38%), Gaps = 49/271 (18%)

Query: 543 DKYDVD----RELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGYXXXXXXX 598
           +K+D+D    REL++ G  N  S +F ++  +  Y  S L I   A + +AG        
Sbjct: 341 EKFDIDISSNRELVSLGLINVVSSVFSALPAFGGYGRSKLNILCSAQTPMAGIVVSVAAI 400

Query: 599 XXXXXGPVIISFIPICIVGSLIFLLGYELLMEALVDT---WGKLNTFEYVTVGIIILTMG 655
                      ++P+C++  +I  + Y LL E   D    W      E +T   +++T  
Sbjct: 401 FCMNYMMGAFHYLPLCVLAVIISYIAYNLLEEIPSDLFFYWSVGGYQELLTFVAVVVTTL 460

Query: 656 IFDFVLGIIVGILIACFKFLIDSTHLQTVNGEFSGEVAKSTVYRDPIQTTFLDGVGEQ-- 713
           ++    G+ +G+ +   + L  +T  +              + RDP+   F +   EQ  
Sbjct: 461 VWSPQFGVSIGVGLTMIRLLKHTTQSRV-----------QILGRDPVTKKFQNIYAEQSE 509

Query: 714 ---------IYVLKLQNLLFFGTIISIEEKIDKL------------------LEISNNDS 746
                      V+K+   L F  +  +++++ +L                  +  S    
Sbjct: 510 QIPLEEIEKTMVIKIPEPLIFSNVSDLKKRLSRLEKYGSLKVHPSYPTPLRPVSASAGSQ 569

Query: 747 SKRRIKYLILDFKNINTDNIDYSAAEGFNRI 777
           S+  I Y+I D   +    ID SA +    +
Sbjct: 570 SESYISYVIFDL--LGMTYIDMSALQALTEM 598

>YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON}
           Putative sulfate permease; physically interacts with
           Hsp82p; green fluorescent protein (GFP)-fusion protein
           localizes to the ER; YPR003C is not an essential gene
          Length = 754

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 61/288 (21%), Positives = 117/288 (40%), Gaps = 22/288 (7%)

Query: 548 DRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGYXXXXXXXXXXXXGPVI 607
           +REL+A G+ N    LFG++  +  Y  S +   +GA S ++G                 
Sbjct: 408 NRELVALGFMNIVISLFGALPAFGGYGRSKINALSGAQSVMSGVFMGVITLITMNLLLQF 467

Query: 608 ISFIPICIVGSLIFLLGYELLMEALVDTWGKLNTFEYVTVGIIILTMGIFDFVLGIIVGI 667
           + +IP C++  +  ++G  LL E   D    L    +  + +  +T     F   I  GI
Sbjct: 468 VHYIPNCVLSVITTIIGISLLEEVPGDIKFHLRCGGFSELFVFAVTFCTTIF-YSIEAGI 526

Query: 668 LIACFKFLID-STHLQTVNGEFSGEVAKSTVYRD------PIQTTFLDGVG----EQIYV 716
            I C   +I+   H      +    VA ++ + +       ++   LD  G    E   +
Sbjct: 527 CIGCVYSIINIIKHSAKSRIQILARVAGTSNFTNLDDYMMNMKRNSLDVEGTEEIEGCMI 586

Query: 717 LKLQNLLFFGTIISIEEKIDKLLEISNND--------SSKRRIKYLILDFKNINTDNIDY 768
           +++   L F     +++++D++    ++          SK  IKY+I D   + +  ID 
Sbjct: 587 VRIPEPLTFTNSEDLKQRLDRIERYGSSKIHPGRKSLRSKDSIKYVIFDLGGMTS--IDS 644

Query: 769 SAAEGFNRIRRFTQTKGIQLIISSIREKDGIYRAFNNVGLLEDVELFQ 816
           SAA+    I    + + + + + ++   D + R     G+   VE  Q
Sbjct: 645 SAAQVLEEIITSYKRRNVFIYLVNVSINDKVRRRLFKAGVAASVERAQ 692

>NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {ON}
           Anc_8.99
          Length = 724

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 56/286 (19%), Positives = 117/286 (40%), Gaps = 32/286 (11%)

Query: 548 DRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGYXXXXXXXXXXXXGPVI 607
           +REL+A G  N    LFG++ ++  Y  S +   +GA + ++G                +
Sbjct: 384 NRELVALGSMNLVGSLFGALPSFGGYGRSKINALSGAQTVMSGACMGLITLFTIKFLLPV 443

Query: 608 ISFIPICIVGSLIFLLGYELLMEALVDTWGKLNTFEY---VTVGIIILTMGIFDFVLGII 664
           I + P+CI+  +  ++G  LL EA  D    +    Y   +   +I +T  I     GI 
Sbjct: 444 IHYTPLCILSVITTVVGLSLLEEAPSDIRFHIRCHGYNELIIFTLIFVTTIIHSVEAGIS 503

Query: 665 VGIL--------------IACFKFLIDSTHLQTVNGEFSGEVAKSTVYRDPIQTTFLDGV 710
           VG +              I     +I +     V+G + G   K+   R   +++ L+ +
Sbjct: 504 VGCIYSIGSIIKHSAQSRIQILTRVIGTNQFVPVDGYYPG--LKTIDLR---ESSALEEL 558

Query: 711 GEQIYVLKLQNLLFFGTIISIEEKIDKLLEISNND--------SSKRRIKYLILDFKNIN 762
            +   ++K+   L F     ++E++++L    +           ++  IKY+I +   + 
Sbjct: 559 DDSTLIVKIPEPLTFTNTEDLKERLNRLERFRSVRIHPGRRPLHNRENIKYVIFELGGMT 618

Query: 763 TDNIDYSAAEGFNRIRRFTQTKGIQLIISSIREKDGIYRAFNNVGL 808
           +  +D SAA+    I +  + + + +    +     I    ++ G+
Sbjct: 619 S--MDSSAAQILKEIIKTYKKRSVNVYFCKVSSNLQIRTRLHDAGI 662

>NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {ON}
           Anc_8.99
          Length = 706

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 53/252 (21%), Positives = 102/252 (40%), Gaps = 33/252 (13%)

Query: 548 DRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGYXXXXXXXXXXXXGPVI 607
           +REL+A G  N    LFG++  +  Y  S +   +G  + ++G                +
Sbjct: 363 NRELVALGSMNIVGSLFGALPAFGGYGRSKINALSGGQTVMSGVCLGSVTLFTIKFFLPV 422

Query: 608 ISFIPICIVGSLIFLLGYELLMEALVDTWGKLNTFEY---VTVGIIILTMGIFDFVLGII 664
           +   P C++  +  ++G  LL EA  D      +  Y   + +G+  +T   +   +GI 
Sbjct: 423 VHNTPTCVLSVVTSVVGLTLLEEAPTDLKFYFQSHGYNELIVLGLTFITTIFYSVEVGIC 482

Query: 665 VGILIACFKFLIDS--THLQTVN--------------GEFSGEVAKSTVYRDPIQTTFLD 708
           VG   +    +  S  + +Q +               G F GE   +  + +P+    L+
Sbjct: 483 VGCCYSIISIIKHSAQSRIQILAKRKGDNRFSNADELGIFDGENNNNNTFFEPL----LE 538

Query: 709 GVGEQIYVLKLQNLLFFGTIISIEEKIDKLLEISN--------NDSSKRRIKYLILDFKN 760
            + E   V+K+   L F     ++E++ +L    +        +  S+ + KY+I D   
Sbjct: 539 DLDEDRLVVKIPEPLTFTNTEDLKERLSRLERFGSVRVHPGRRDLRSRDKTKYIIFDLHG 598

Query: 761 INTDNIDYSAAE 772
           +    ID SAA+
Sbjct: 599 MTY--IDASAAQ 608

>TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa]
           {ON} Anc_8.99 YPR003C
          Length = 776

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 67/360 (18%), Positives = 142/360 (39%), Gaps = 47/360 (13%)

Query: 548 DRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGYXXXXXXXXXXXXGPVI 607
           +REL+A G SN      G++ ++  Y  S +   +G  + L+G                +
Sbjct: 413 NRELVALGLSNIVISTLGALPSFGGYGRSKINALSGGKTLLSGVFMGLTTILAILFLMPV 472

Query: 608 ISFIPICIVGSLIFLLGYELLMEALVDTWGKLNTFEYVTVGIIILT-------------- 653
           I +IP+CI+  +  ++G+ LL E   +         Y  + +I+LT              
Sbjct: 473 IHYIPVCILSVITTVIGFTLLEEIPKEVSFHWRCRGYNELFLIVLTFMTSIFYSVETSMY 532

Query: 654 MGIFDFVLGIIVGILIACFKFLIDSTHLQTVNGE-----------FSGEVAKSTVYRDPI 702
           +G    +L II     +  +   D+  + +++              + +  +S+ YR   
Sbjct: 533 IGCVYSILNIIKHSAKSRIQIYTDAPLITSISNPPSIDNSNINSNNNIKSTRSSDYRPES 592

Query: 703 QTTFLDGV------GEQIYVLKLQNLLFFGTIISIEEKIDKLLEISNNDSSKRRI----- 751
           +    D         EQ  ++K+   L F     ++EK+++   +  + +   +I     
Sbjct: 593 RRNSADECFRCSLTNEQTLIVKIPEPLTFTNCEDLKEKLNRFERLGTHTAHPGKILKDTL 652

Query: 752 ---KYLILDFKNINTDNIDYSAAEGFNRIRRFTQTKGIQLIISSIREKDGIYRAFNNVGL 808
              KY+I D + +    +D SA E    I    +  G  +   ++  ++ I       G+
Sbjct: 653 FQPKYIIFDLQGMTL--MDSSATEILKEIVLSYRRSGSHIFFVNVSFRENIRNRIQASGI 710

Query: 809 LEDVEL-----FQDLNSSLEWCENELLHWYNELRTKAKARLRKLNNTANSVVSRLPVSAS 863
           ++ +EL         N S  + + + L++++ +   A   +RKL  T +  +    +SA+
Sbjct: 711 IDLIELPPVPPIDPNNESSSYADLDDLNYFSSI-DDALIEIRKLKQTDSMSIQESYISAT 769

>KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]
           {ON} similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 710

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 58/287 (20%), Positives = 118/287 (41%), Gaps = 26/287 (9%)

Query: 548 DRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGYXXXXXXXXXXXXGPVI 607
           +REL+A G  N    +FG++ ++  Y  S +   +GA + ++G                 
Sbjct: 373 NRELVALGSLNLVGSIFGALPSFGGYGRSKINAYSGAATVMSGVFMGLITCVTSMFLLNA 432

Query: 608 ISFIPICIVGSLIFLLGYELLMEALVDTWGKLNTFEY---VTVGIIILTMGIFDFVLGII 664
           I  IP+C++  +  ++G  L  EA  D         Y   +   + +LT   +    GI 
Sbjct: 433 IHHIPVCVLSVITTMVGITLFEEAPADLRYHFRCRGYNELLIFALTVLTTFFYSVEAGIT 492

Query: 665 VGILIACFKFLIDSTH-----LQTVNG--------EFSGEVAKSTVY---RDPIQTTFLD 708
           +G   +  + + +ST      L+ V+G        +F+       V     D I+ + + 
Sbjct: 493 LGCGYSVIRVIKNSTKSKIQILRRVSGTDQFVNADDFNSSTNTCVVIPPRLDDIEGSLIV 552

Query: 709 GVGEQIYVLKLQNLLFFGTIISIEEKID--KLLEISNNDSSKRRIKYLILDFKNINTDNI 766
            + E++  +  ++L    T +   EK    K    S    ++ + K++I D   +    I
Sbjct: 553 KIPERLTFMNTEDL---KTRLYRLEKYGSVKTHPASPKPRNRNQTKHMIFDMNGMT--EI 607

Query: 767 DYSAAEGFNRIRRFTQTKGIQLIISSIREKDGIYRAFNNVGLLEDVE 813
           D SA++    I    + +G+++ ++ +    G+       G++E VE
Sbjct: 608 DSSASQILQEIVLSLRKRGVRVYLARVPLIAGVRERLVASGVVEMVE 654

>CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]
           {ON} some similarities with uniprot|P53394 Saccharomyces
           cerevisiae YPR003c
          Length = 725

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 58/132 (43%), Gaps = 1/132 (0%)

Query: 545 YDVDRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGYXXXXXXXXXXXXG 604
           Y  +RELIA G+ N    LFG++ ++  Y  S + + +G  + ++G              
Sbjct: 374 YSSNRELIALGFMNIVGSLFGALPSFGGYGRSKVNVFSGGKTVMSGAMVGLITLLTAKLL 433

Query: 605 PVIISFIPICIVGSLIFLLGYELLMEALVDTWGKLNTFEYVTVGIIILTMGIFDFVLGII 664
             +I + P C++  +  ++G  LL E   D    ++   Y  + +  LT  I      + 
Sbjct: 434 LPMIHYTPTCVLSVITTVIGISLLEEVPSDIKFHIHCSGYSELTVFTLTF-IATLSQSVE 492

Query: 665 VGILIACFKFLI 676
           +G+ + C   LI
Sbjct: 493 LGVTVGCIYSLI 504

>KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 706

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 103/482 (21%), Positives = 187/482 (38%), Gaps = 58/482 (12%)

Query: 381 RHILIGCIGGVGYFLLITGIEV------CTRIAKFEYSIPFLLNLFTDEKTLFQWLLPTM 434
           R +L G I GVG  ++IT + V       T   +  Y  PF   LF  +     +  PT 
Sbjct: 201 RALLRGFISGVGVIMVITSLVVELKLNHVTPTRQEHYHSPFEKVLFIMKYGPENYHKPTA 260

Query: 435 LTIILIFT------------QNRFRNSLVLPSFYILTLILFHFIVAIVPNLSLTKLRNSG 482
           +  ++ F               +F+  ++LP   IL ++     V+   +L   K R   
Sbjct: 261 ILSLVAFVILMSLRIFKKRYGKKFKWLVLLPD--ILVVVALSIFVSYKMHL---KSR--- 312

Query: 483 WIFPVAASNVTWYDHYKYFN--FSDVHWALVIKQIPTMMALTFFGILHVPINVPALAMSL 540
             + +   N    D  K+    FS+V+ A       T   +   G         +L  S 
Sbjct: 313 --YGIEIINDIPKDSMKHLKNPFSNVNVATFKDLFSTGFMVAMLGFFESATASKSLGTSY 370

Query: 541 QMDKYDVDRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGYXXXXXXXXX 600
            +     +RELIA G  N    +F  +  +  Y  S +   +GA + ++G+         
Sbjct: 371 NL-AISSNRELIALGSMNVVGSMFAILPAFGGYGRSKINAYSGAQTTMSGFFMGLVTLFT 429

Query: 601 XXXGPVIISFIPICIVGSLIFLLGYELLMEALVDT---WGKLNTFEYVTVGIIILTMGIF 657
                 II +IP+CI+  +  ++G  LL EA  D    W +   +  +TV  + L   +F
Sbjct: 430 IQFLLPIIRYIPVCILSVITTVVGLTLLEEAPHDLKFHW-RCKGYSELTVFTVTLLATLF 488

Query: 658 DFVLGIIVGILIACFKFLIDS-THLQTVNGEFSGEVAKSTVY--RDPIQTT----FLDGV 710
                +  GI I C   +I+   H      +  G V  +  +   D  Q      F++  
Sbjct: 489 ---YSLEAGIYIGCACSIINVIKHSAKSRIQILGRVPGTETFINADDYQANAAGYFINPQ 545

Query: 711 GEQI---YVLKLQNLLFFGTIISIEEKIDKLLE----ISNNDSSKRRIKYL----ILDFK 759
            E+I    ++K+   L F     ++ ++ +L +    +++  + + R K +    I D K
Sbjct: 546 IEEIEGFLIVKIAEPLTFTNADDLKMRLHRLEKHGSAVTHPAAPRSRRKEMTENVIFDMK 605

Query: 760 NINTDNIDYSAAEGFNRIRRFTQTKGIQLIISSIREKDGIYRAFNNVGLLEDVELFQDLN 819
            +   +ID SAA+    I      + + + ++++   + +       G+ E  E     N
Sbjct: 606 GMT--HIDSSAAQTLEEILSAYNRRDVHVFLTNVPLTEKVRERLVTSGVAELCERNTITN 663

Query: 820 SS 821
           SS
Sbjct: 664 SS 665

>Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {ON}
           YPR003C - Hypothetical ORF [contig 31] FULL
          Length = 726

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 58/136 (42%), Gaps = 3/136 (2%)

Query: 548 DRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGYXXXXXXXXXXXXGPVI 607
           +REL+A G  N    LFG++ ++  Y  S +   +GA + ++G                 
Sbjct: 388 NRELVALGSLNLVGSLFGALPSFGGYGRSKINAYSGAATVMSGVFMGLITLITSKFLLNA 447

Query: 608 ISFIPICIVGSLIFLLGYELLMEALVDTWGKLNTFEY---VTVGIIILTMGIFDFVLGII 664
           I  IPIC++  +  ++G  L  EA  D         Y   +T  I +LT   +    GI 
Sbjct: 448 IRHIPICVLSVITTMVGISLFEEAPADLKFHFRCRGYNELLTFAITVLTTFFYSVEAGIT 507

Query: 665 VGILIACFKFLIDSTH 680
           +G   +  + + +ST 
Sbjct: 508 LGCGYSIIRAIKNSTQ 523

>Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON}
           (26194..28428) [2235 nt, 745 aa]
          Length = 744

 Score = 40.4 bits (93), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 58/281 (20%), Positives = 114/281 (40%), Gaps = 22/281 (7%)

Query: 548 DRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGYXXXXXXXXXXXXGPVI 607
           +REL+A G  N  + LFG++ ++  Y  S +   +G+ + ++G                +
Sbjct: 392 NRELVALGSMNVIASLFGALPSFGGYGRSKINAFSGSKTVMSGVFMGSVTLITIRYLLPL 451

Query: 608 ISFIPICIVGSLIFLLGYELLMEALVDTWGKLNTFEY---VTVGIIILTMGIFDFVLGII 664
           I +IP+CI+  +  ++G  LL EA  +         Y       I +L   ++   +GI 
Sbjct: 452 IHYIPLCILSVITSIVGISLLEEAPSELKFHFRCKGYDELFVFAITVLATLLYSVEMGIC 511

Query: 665 VGILIACFKFLIDSTHLQT-VNGEFSG--EVAKSTVY--RDPI----QTTFLDGVGEQIY 715
           +G   +    +  S   +  + G   G  E A    Y   DPI       F+    E   
Sbjct: 512 IGCGYSIISIVKHSAKSRIQILGRVQGTREFANIDEYLDSDPIGDIETNKFVLEEIEGCL 571

Query: 716 VLKLQNLLFFGTIISIEEKIDKLLEISNNDS--------SKRRIKYLILDFKNINTDNID 767
           ++K+   L F     ++E++++L    +  +        SK   K +I D   + +  ID
Sbjct: 572 IVKIPEPLTFTNTDDLKERLNRLERFGSVKAHPGGPGGRSKDYTKCVIFDLHGMTS--ID 629

Query: 768 YSAAEGFNRIRRFTQTKGIQLIISSIREKDGIYRAFNNVGL 808
            SA + F  I    + + +++ ++ + +   I       G+
Sbjct: 630 SSATQIFFDIVATYKKRKVKVFLARVLQSKQIRERLEKSGV 670

>KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.99
           YPR003C
          Length = 716

 Score = 39.7 bits (91), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 72/340 (21%), Positives = 129/340 (37%), Gaps = 34/340 (10%)

Query: 548 DRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGYXXXXXXXXXXXXGPVI 607
           +REL+A G  N     FG I  +  Y  S +   +GA + +AG                +
Sbjct: 375 NRELVALGLMNTIGSAFGIIPAFGGYGRSKINAFSGAQTVMAGVFMGSVTLFTIKFLLPV 434

Query: 608 ISFIPICIVGSLIFLLGYELLMEALVDTWGKLNTFEYVTVGIIILTMGIFDFVLGIIVGI 667
           I +IP C++  +   +G  LL EA  D    +    Y  + + +LT     F   I  GI
Sbjct: 435 IHYIPTCVLSVITTFVGVSLLEEAPHDIKFHIRCKGYDELIMFVLTFLCTCF-YSIEFGI 493

Query: 668 LIACFKFLID-STHLQTVNGEFSGEVAKSTVYRDPIQTTFLDGVG-----------EQIY 715
           L  C   LI    H      +    V  +  + +  +   LD              E   
Sbjct: 494 LAGCTYSLISIVKHSAQSRIQILARVEGTDHFINANEYLQLDLDSDNCSAPDIEHFEGCL 553

Query: 716 VLKLQNLLFFGTIISIEEKIDKLLEISNNDSSK-------RRIKYLILDFKNINTDNIDY 768
           V+K+   L F     ++E++D+L    +  +           I+Y+I D   +    +D 
Sbjct: 554 VVKIPEPLTFTNTEDLKERLDRLERFGSTKAHPGMKSEGGSSIEYIIFDLHGMTF--MDS 611

Query: 769 SAAEGFNRIRRFTQTKGIQLIISSIREKDGIYRAFNNVG---LLEDVELFQDLNSSLEWC 825
           SA +    I    + + + + ++ +     +       G   L++  E+ Q  N SL+  
Sbjct: 612 SATQILKDIVVEYRKRDVVVFLARVPPNLEVRERLKESGINDLVQKQEVKQHSNHSLQSA 671

Query: 826 EN-------ELLHWYNELRTKAKARLRKLNNTANSVVSRL 858
           +        E L   + L  KA+ R +++  T+ S+ S +
Sbjct: 672 QTPYFPNIAEALSMVDNL--KARTRSQQILRTSPSISSSM 709

>KAFR0D01170 Chr4 complement(234381..235298) [918 bp, 305 aa] {ON}
           Anc_7.73 YAL025C
          Length = 305

 Score = 37.7 bits (86), Expect = 0.13,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 28/51 (54%)

Query: 801 RAFNNVGLLEDVELFQDLNSSLEWCENELLHWYNELRTKAKARLRKLNNTA 851
           RA     L E ++L ++ + +L+  +++LLHW N  R K K R  KL   A
Sbjct: 70  RAHTPAKLWERIKLSKNYSKALKQIDDQLLHWNNFFRHKCKQRFTKLTQVA 120

>TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {ON}
           Anc_8.99 YPR003C
          Length = 787

 Score = 36.2 bits (82), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 57/138 (41%), Gaps = 16/138 (11%)

Query: 548 DRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGYXXXXXXXXXXXXGPVI 607
           +REL+A G  N  + L G + ++  Y  S +   +GA + ++G                 
Sbjct: 428 NRELVALGVMNLTASLLGGLPSFGGYGRSKINAFSGAKTVMSGVVMGGITVLTIKFLLNY 487

Query: 608 ISFIPICIVGSLIFLLGYELLMEA--------LVDTWGKLNTFEYVTVGIIILTMGIFDF 659
           I FIP C++  +  ++G  L+ EA            + +L  F     G I      F  
Sbjct: 488 IHFIPTCVLSVITTIVGLSLIEEAPGEVKFHWRCKGYNELIIFFMTACGTI-----FFSV 542

Query: 660 VLGIIVGI---LIACFKF 674
            +GII+G    +I+  KF
Sbjct: 543 EVGIIIGCSYSIISIIKF 560

>Kpol_1050.18 s1050 complement(45297..47087) [1791 bp, 596 aa] {ON}
           complement(45297..47087) [1791 nt, 597 aa]
          Length = 596

 Score = 36.2 bits (82), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 43/85 (50%), Gaps = 7/85 (8%)

Query: 736 DKLLEISNNDSSK----RRIKYLILDFKNINTDNIDYSAAEGFNRIRRFTQ-TKGIQLII 790
           DK + +SN D+SK    RR+ + I  +  + +  I ++ +  +NR  R     KG+++  
Sbjct: 496 DKFMSLSNEDTSKYDYCRRMDFFICKWSELGSSRIHFTGSSEYNRWMRLKAIEKGMKMTQ 555

Query: 791 SSIREKDGIYRAFNNVGLLE--DVE 813
             + + D +  +FN   + E  D+E
Sbjct: 556 HGLFKDDRLLESFNEKKIFELLDIE 580

>KNAG0L00460 Chr12 complement(68845..69771) [927 bp, 308 aa] {ON}
           Anc_7.73 YAL025C
          Length = 308

 Score = 34.3 bits (77), Expect = 1.4,   Method: Composition-based stats.
 Identities = 17/51 (33%), Positives = 26/51 (50%)

Query: 801 RAFNNVGLLEDVELFQDLNSSLEWCENELLHWYNELRTKAKARLRKLNNTA 851
           RA     L E ++L ++  ++L+  +  LLHW N  + K K R  KL   A
Sbjct: 70  RAHTPAKLWEKIKLSKNYVTALKQIDEHLLHWNNFFKHKCKQRFTKLTQVA 120

>Kpol_2001.33 s2001 complement(95868..98756) [2889 bp, 962 aa] {ON}
            complement(95868..98756) [2889 nt, 963 aa]
          Length = 962

 Score = 33.9 bits (76), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 59/128 (46%), Gaps = 9/128 (7%)

Query: 970  AQTTLQHCNKIFFLVQTGVLKAVFKLPQ-GCVYETMANRTCYGKIIDSGTTV-----DDA 1023
            +Q  L++   + F  Q+G+++++ +LP    V     ++   G I D  TT+      + 
Sbjct: 402  SQPLLRYICNLIFKKQSGLIQSIVELPDTNEVLGKKKSKLLRGDIHDENTTILAHCIKNM 461

Query: 1024 DTSNPDFSKLFI---TTETDSELWVIDAAAMGRLEREDPELFIQLALLVMLIKDKRFKDL 1080
            D    ++S L I     E  S++ VID++ +   E ED E+F   A    LI+      L
Sbjct: 462  DIDGFEWSMLRIYKGNLEVGSKVRVIDSSNLSASENEDGEIFEVDAEEFPLIEISEIGLL 521

Query: 1081 LGHALISA 1088
             G  +IS 
Sbjct: 522  CGRFIISV 529

>SAKL0F06809g2 Chr6 (518357..519658,519660..523625) [5268 bp, 1755
           aa] {ON} Retrotransposon Gag and Pol genes
          Length = 1755

 Score = 33.9 bits (76), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 10/51 (19%)

Query: 412 SIPFLLNLFTDEKTLFQWLLP----------TMLTIILIFTQNRFRNSLVL 452
           S P     FTDEKT FQW+ P           + T IL F + +F+ S+++
Sbjct: 682 SAPSYFITFTDEKTRFQWVYPLHDRREQSILEVFTTILAFIERQFKASVLV 732

>SAKL0C11913g1 Chr3 complement(1069940..1073905,1073907..1075208)
           [5268 bp, 1755 aa] {ON} Retrotransposon Gag and Pol
           genes
          Length = 1755

 Score = 33.9 bits (76), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 10/51 (19%)

Query: 412 SIPFLLNLFTDEKTLFQWLLP----------TMLTIILIFTQNRFRNSLVL 452
           S P     FTDEKT FQW+ P           + T IL F + +F+ S+++
Sbjct: 682 SAPSYFITFTDEKTRFQWVYPLHDRREQSILEVFTTILAFIERQFKASVLV 732

>SAKL0B11583g2 Chr2 (998260..999561,999563..1003528) [5268 bp, 1755
           aa] {ON} Retrotransposon Gag and Pol genes
          Length = 1755

 Score = 33.9 bits (76), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 10/51 (19%)

Query: 412 SIPFLLNLFTDEKTLFQWLLP----------TMLTIILIFTQNRFRNSLVL 452
           S P     FTDEKT FQW+ P           + T IL F + +F+ S+++
Sbjct: 682 SAPSYFITFTDEKTRFQWVYPLHDRREQSILEVFTTILAFIERQFKASVLV 732

>YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON}
           SMC2Subunit of the condensin complex; essential SMC
           chromosomal ATPase family member that forms a complex
           with Smc4p to form the active ATPase; Smc2p/Smc4p
           complex binds DNA; required for clustering of tRNA genes
           at the nucleolus
          Length = 1170

 Score = 33.5 bits (75), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 61/135 (45%), Gaps = 19/135 (14%)

Query: 787 QLIISSIREKDGIYRAFNNVGLLEDVELFQDLN-SSLEWCENELLHWYNELRTKAKARLR 845
           + +  +  E D +      + L ++ EL ++   S LE  EN LL+  + L+T    ++ 
Sbjct: 265 EFVKKTSEEIDSLNEDVEEIKLQKEKELHKEGTISKLENKENGLLNEISRLKTSLSIKVE 324

Query: 846 KLNNTANSVVSRLPVSASKQMDSRAITSADQSGRAAISNLMSLPTNTPRNHQM----LTV 901
            LN+T                 S+A+ S   S  A +    S   NT ++++M    L+ 
Sbjct: 325 NLNDTTEK--------------SKALESEIASSSAKLIEKKSAYANTEKDYKMVQEQLSK 370

Query: 902 AQDVFKNDEQTVSSL 916
            +D++K  E+ VS+L
Sbjct: 371 QRDLYKRKEELVSTL 385

>NCAS0I00400 Chr9 complement(60179..61093) [915 bp, 304 aa] {ON}
           Anc_7.73 YAL025C
          Length = 304

 Score = 32.7 bits (73), Expect = 4.6,   Method: Composition-based stats.
 Identities = 17/51 (33%), Positives = 25/51 (49%)

Query: 801 RAFNNVGLLEDVELFQDLNSSLEWCENELLHWYNELRTKAKARLRKLNNTA 851
           RA     L E ++L ++ + +L+  +  LLHW N    K K R  KL   A
Sbjct: 69  RAHTPAKLWERIKLSKNYSKALKQIDEHLLHWKNFFIHKCKQRFTKLTQVA 119

>NDAI0A08620 Chr1 (1987519..1988442) [924 bp, 307 aa] {ON} Anc_7.73
           YAL025C
          Length = 307

 Score = 32.7 bits (73), Expect = 5.0,   Method: Composition-based stats.
 Identities = 17/51 (33%), Positives = 25/51 (49%)

Query: 801 RAFNNVGLLEDVELFQDLNSSLEWCENELLHWYNELRTKAKARLRKLNNTA 851
           RA     L E ++L ++ + +L+  +  LLHW N    K K R  KL   A
Sbjct: 69  RAHTPAKLWERIKLSKNYSKALKQIDEHLLHWNNFFIHKCKQRFTKLTQVA 119

>TBLA0D04370 Chr4 complement(1082614..1084455) [1842 bp, 613 aa]
           {ON} Anc_1.429 YCR014C
          Length = 613

 Score = 32.7 bits (73), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 749 RRIKYLILDFKNINTDNIDYSAAEGFNR-IRRFTQTKGIQLIISSIREKDGIYRAFN 804
           RRI + I  +  I    + Y+ +  FNR +R+   +KG++L    + + D +  +FN
Sbjct: 534 RRIDFFICKWSEIGASKLHYTGSGEFNREVRKIAISKGMKLTQHGLYQNDILLESFN 590

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 106,467,749
Number of extensions: 4625955
Number of successful extensions: 15332
Number of sequences better than 10.0: 70
Number of HSP's gapped: 15657
Number of HSP's successfully gapped: 80
Length of query: 1088
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 968
Effective length of database: 39,721,479
Effective search space: 38450391672
Effective search space used: 38450391672
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 71 (32.0 bits)